BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS060B10

Length=626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011073820.1|  PREDICTED: probably inactive leucine-rich re...    192   8e-53   Sesamum indicum [beniseed]
emb|CDP14623.1|  unnamed protein product                                190   7e-52   Coffea canephora [robusta coffee]
ref|XP_009589223.1|  PREDICTED: probably inactive leucine-rich re...    189   2e-51   Nicotiana tomentosiformis
emb|CBI39439.3|  unnamed protein product                                186   4e-51   Vitis vinifera
ref|XP_009765958.1|  PREDICTED: probably inactive leucine-rich re...    188   4e-51   Nicotiana sylvestris
ref|XP_006364689.1|  PREDICTED: probably inactive leucine-rich re...    187   5e-51   Solanum tuberosum [potatoes]
ref|XP_002265846.1|  PREDICTED: probably inactive leucine-rich re...    187   8e-51   Vitis vinifera
ref|XP_007034091.1|  Leucine-rich receptor-like protein kinase fa...    186   2e-50   
ref|XP_006840189.1|  hypothetical protein AMTR_s00089p00108500          184   7e-50   
ref|XP_004247993.1|  PREDICTED: probably inactive leucine-rich re...    182   3e-49   Solanum lycopersicum
ref|XP_010528265.1|  PREDICTED: probably inactive leucine-rich re...    181   1e-48   Tarenaya hassleriana [spider flower]
ref|XP_004156987.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    180   2e-48   
ref|XP_004152295.1|  PREDICTED: probably inactive leucine-rich re...    180   2e-48   Cucumis sativus [cucumbers]
ref|XP_002518223.1|  receptor protein kinase, putative                  180   2e-48   Ricinus communis
ref|XP_008453972.1|  PREDICTED: probably inactive leucine-rich re...    179   4e-48   Cucumis melo [Oriental melon]
ref|XP_010268319.1|  PREDICTED: probably inactive leucine-rich re...    178   1e-47   Nelumbo nucifera [Indian lotus]
gb|KJB37929.1|  hypothetical protein B456_006G227000                    177   2e-47   Gossypium raimondii
gb|KHN27185.1|  Probably inactive leucine-rich repeat receptor-li...    177   2e-47   Glycine soja [wild soybean]
ref|XP_003518672.1|  PREDICTED: probably inactive leucine-rich re...    177   2e-47   Glycine max [soybeans]
ref|XP_003552656.1|  PREDICTED: probably inactive leucine-rich re...    177   2e-47   Glycine max [soybeans]
gb|KHN13843.1|  Probably inactive leucine-rich repeat receptor-li...    177   2e-47   Glycine soja [wild soybean]
ref|XP_007139297.1|  hypothetical protein PHAVU_008G017400g             177   3e-47   Phaseolus vulgaris [French bean]
gb|EYU32740.1|  hypothetical protein MIMGU_mgv1a000860mg                176   5e-47   Erythranthe guttata [common monkey flower]
gb|KHG00472.1|  hypothetical protein F383_20103                         174   2e-46   Gossypium arboreum [tree cotton]
ref|XP_008337525.1|  PREDICTED: probably inactive leucine-rich re...    172   2e-45   Malus domestica [apple tree]
ref|XP_011000023.1|  PREDICTED: probably inactive leucine-rich re...    172   2e-45   Populus euphratica
ref|XP_003621730.1|  Probably inactive leucine-rich repeat recept...    172   2e-45   Medicago truncatula
ref|XP_011042759.1|  PREDICTED: probably inactive leucine-rich re...    171   3e-45   Populus euphratica
ref|XP_009371148.1|  PREDICTED: probably inactive leucine-rich re...    171   3e-45   Pyrus x bretschneideri [bai li]
ref|XP_002302895.2|  leucine-rich repeat transmembrane protein ki...    171   3e-45   
ref|XP_002321093.1|  leucine-rich repeat transmembrane protein ki...    171   4e-45   Populus trichocarpa [western balsam poplar]
ref|XP_010514517.1|  PREDICTED: probably inactive leucine-rich re...    170   7e-45   Camelina sativa [gold-of-pleasure]
gb|KFK33718.1|  hypothetical protein AALP_AA5G051000                    169   2e-44   Arabis alpina [alpine rockcress]
ref|XP_010023583.1|  PREDICTED: probably inactive leucine-rich re...    168   5e-44   Eucalyptus grandis [rose gum]
ref|XP_010107246.1|  Probably inactive leucine-rich repeat recept...    168   6e-44   
ref|XP_010425587.1|  PREDICTED: probably inactive leucine-rich re...    167   6e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006494521.1|  PREDICTED: probably inactive leucine-rich re...    167   1e-43   Citrus sinensis [apfelsine]
ref|XP_006421080.1|  hypothetical protein CICLE_v10004238mg             167   1e-43   Citrus clementina [clementine]
ref|XP_006290541.1|  hypothetical protein CARUB_v10016623mg             165   6e-43   Capsella rubella
ref|XP_002875419.1|  hypothetical protein ARALYDRAFT_484589             164   8e-43   
ref|NP_189443.2|  probably inactive leucine-rich repeat receptor-...    164   9e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004296675.1|  PREDICTED: probably inactive leucine-rich re...    164   1e-42   Fragaria vesca subsp. vesca
emb|CDY20032.1|  BnaA09g02190D                                          162   8e-42   Brassica napus [oilseed rape]
ref|XP_009111587.1|  PREDICTED: probably inactive leucine-rich re...    161   1e-41   Brassica rapa
ref|XP_010555905.1|  PREDICTED: probably inactive leucine-rich re...    160   2e-41   Tarenaya hassleriana [spider flower]
gb|EPS70115.1|  hypothetical protein M569_04636                         159   6e-41   Genlisea aurea
ref|XP_006395381.1|  hypothetical protein EUTSA_v10003580mg             159   8e-41   Eutrema salsugineum [saltwater cress]
ref|XP_009151898.1|  PREDICTED: probably inactive leucine-rich re...    159   8e-41   Brassica rapa
ref|XP_004492049.1|  PREDICTED: probably inactive leucine-rich re...    157   3e-40   Cicer arietinum [garbanzo]
ref|XP_010555906.1|  PREDICTED: probably inactive leucine-rich re...    153   7e-39   Tarenaya hassleriana [spider flower]
gb|KDP37890.1|  hypothetical protein JCGZ_05772                         153   9e-39   Jatropha curcas
ref|XP_010502811.1|  PREDICTED: probably inactive leucine-rich re...    152   1e-38   Camelina sativa [gold-of-pleasure]
emb|CDY00141.1|  BnaC09g01600D                                          152   2e-38   
ref|XP_008244427.1|  PREDICTED: probably inactive leucine-rich re...    146   2e-36   Prunus mume [ume]
ref|XP_007225370.1|  hypothetical protein PRUPE_ppa000838mg             146   2e-36   
ref|XP_010673272.1|  PREDICTED: probably inactive leucine-rich re...    142   6e-35   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB67930.1|  hypothetical protein B456_010G218400                    139   3e-34   Gossypium raimondii
gb|KJB67929.1|  hypothetical protein B456_010G218400                    138   1e-33   Gossypium raimondii
gb|KHG03607.1|  hypothetical protein F383_26757                         136   6e-33   Gossypium arboreum [tree cotton]
ref|XP_009403616.1|  PREDICTED: probably inactive leucine-rich re...    135   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008350571.1|  PREDICTED: probably inactive leucine-rich re...    132   2e-32   
ref|XP_009372024.1|  PREDICTED: probably inactive leucine-rich re...    134   3e-32   Pyrus x bretschneideri [bai li]
ref|XP_007207150.1|  hypothetical protein PRUPE_ppa000904mg             134   4e-32   Prunus persica
ref|XP_008244834.1|  PREDICTED: probably inactive leucine-rich re...    134   4e-32   Prunus mume [ume]
ref|XP_002275275.1|  PREDICTED: probably inactive leucine-rich re...    133   5e-32   Vitis vinifera
ref|XP_010931370.1|  PREDICTED: probably inactive leucine-rich re...    133   6e-32   Elaeis guineensis
ref|XP_011002596.1|  PREDICTED: probably inactive leucine-rich re...    132   1e-31   Populus euphratica
ref|XP_007220278.1|  hypothetical protein PRUPE_ppa000889mg             132   2e-31   
gb|KHG09451.1|  hypothetical protein F383_09289                         132   2e-31   Gossypium arboreum [tree cotton]
ref|XP_003521989.1|  PREDICTED: probably inactive leucine-rich re...    132   2e-31   Glycine max [soybeans]
ref|XP_008233886.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    132   2e-31   Prunus mume [ume]
ref|XP_006486161.1|  PREDICTED: probably inactive leucine-rich re...    131   2e-31   Citrus sinensis [apfelsine]
ref|XP_006435929.1|  hypothetical protein CICLE_v10030625mg             132   2e-31   
gb|KDO67528.1|  hypothetical protein CISIN_1g002321mg                   131   3e-31   Citrus sinensis [apfelsine]
ref|XP_004137674.1|  PREDICTED: probably inactive leucine-rich re...    131   3e-31   Cucumis sativus [cucumbers]
gb|KJB73018.1|  hypothetical protein B456_011G209800                    131   3e-31   Gossypium raimondii
ref|XP_009416321.1|  PREDICTED: probably inactive leucine-rich re...    131   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002323672.2|  hypothetical protein POPTR_0016s14410g             131   4e-31   Populus trichocarpa [western balsam poplar]
ref|XP_002309183.1|  hypothetical protein POPTR_0006s10910g             131   4e-31   
ref|XP_011019006.1|  PREDICTED: probably inactive leucine-rich re...    130   5e-31   Populus euphratica
ref|XP_011019007.1|  PREDICTED: probably inactive leucine-rich re...    130   6e-31   Populus euphratica
ref|XP_010929848.1|  PREDICTED: probably inactive leucine-rich re...    130   7e-31   Elaeis guineensis
ref|XP_008442319.1|  PREDICTED: probably inactive leucine-rich re...    130   9e-31   Cucumis melo [Oriental melon]
ref|XP_002267737.3|  PREDICTED: probably inactive leucine-rich re...    130   1e-30   Vitis vinifera
ref|NP_191196.1|  leucine-rich repeat protein kinase-like protein       130   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010253067.1|  PREDICTED: probably inactive leucine-rich re...    129   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010253073.1|  PREDICTED: probably inactive leucine-rich re...    129   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_002878081.1|  hypothetical protein ARALYDRAFT_907079             129   2e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_009757206.1|  PREDICTED: probably inactive leucine-rich re...    129   2e-30   Nicotiana sylvestris
ref|XP_002520879.1|  ATP binding protein, putative                      129   2e-30   Ricinus communis
ref|XP_008456960.1|  PREDICTED: probably inactive leucine-rich re...    128   3e-30   Cucumis melo [Oriental melon]
ref|XP_008672259.1|  PREDICTED: uncharacterized protein LOC100216...    129   3e-30   
ref|XP_009116341.1|  PREDICTED: probably inactive leucine-rich re...    128   3e-30   Brassica rapa
ref|XP_009623562.1|  PREDICTED: probably inactive leucine-rich re...    128   3e-30   Nicotiana tomentosiformis
gb|ACN33819.1|  unknown                                                 128   3e-30   Zea mays [maize]
ref|XP_006290555.1|  hypothetical protein CARUB_v10016642mg             128   4e-30   
ref|XP_008788529.1|  PREDICTED: probably inactive leucine-rich re...    128   4e-30   Phoenix dactylifera
ref|XP_008792235.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    128   4e-30   
ref|XP_006290556.1|  hypothetical protein CARUB_v10016642mg             128   5e-30   Capsella rubella
ref|XP_002459131.1|  hypothetical protein SORBIDRAFT_03g046350          128   5e-30   
ref|XP_006357297.1|  PREDICTED: probably inactive leucine-rich re...    127   5e-30   Solanum tuberosum [potatoes]
ref|XP_009406870.1|  PREDICTED: probably inactive leucine-rich re...    127   7e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007011288.1|  Leucine-rich repeat protein kinase family pr...    127   7e-30   
gb|KFK34877.1|  Leucine-rich repeat protein kinase family protein       127   8e-30   Arabis alpina [alpine rockcress]
ref|XP_002528692.1|  Brassinosteroid LRR receptor kinase precurso...    127   9e-30   Ricinus communis
ref|XP_004146470.1|  PREDICTED: probably inactive leucine-rich re...    127   9e-30   Cucumis sativus [cucumbers]
ref|XP_002972654.1|  hypothetical protein SELMODRAFT_98598              127   9e-30   Selaginella moellendorffii
ref|XP_010921155.1|  PREDICTED: probably inactive leucine-rich re...    127   1e-29   
ref|XP_010922754.1|  PREDICTED: probably inactive leucine-rich re...    127   1e-29   Elaeis guineensis
ref|XP_006429586.1|  hypothetical protein CICLE_v10010994mg             127   1e-29   
gb|KDO64103.1|  hypothetical protein CISIN_1g002094mg                   127   1e-29   Citrus sinensis [apfelsine]
gb|AAL49790.1|  unknown protein                                         127   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb|EAY77289.1|  hypothetical protein OsI_05265                          127   1e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_010921154.1|  PREDICTED: probably inactive leucine-rich re...    127   1e-29   
dbj|BAB92869.1|  putative receptor-like protein kinase                  127   1e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006481196.1|  PREDICTED: probably inactive leucine-rich re...    127   1e-29   Citrus sinensis [apfelsine]
ref|XP_009402208.1|  PREDICTED: probably inactive leucine-rich re...    126   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004246289.1|  PREDICTED: probably inactive leucine-rich re...    126   2e-29   Solanum lycopersicum
ref|XP_004971314.1|  PREDICTED: probably inactive leucine-rich re...    126   2e-29   Setaria italica
ref|XP_010067617.1|  PREDICTED: probably inactive leucine-rich re...    126   2e-29   Eucalyptus grandis [rose gum]
ref|NP_001170194.1|  uncharacterized protein LOC100384143 precursor     123   2e-29   
ref|NP_001239730.1|  probably inactive leucine-rich repeat recept...    126   2e-29   Glycine max [soybeans]
ref|XP_004241084.1|  PREDICTED: probably inactive leucine-rich re...    126   2e-29   Solanum lycopersicum
ref|XP_010427454.1|  PREDICTED: probably inactive leucine-rich re...    126   2e-29   
ref|NP_001290509.1|  probably inactive leucine-rich repeat recept...    125   2e-29   Elaeis guineensis
ref|XP_001771841.1|  predicted protein                                  125   3e-29   
ref|XP_006358746.1|  PREDICTED: probably inactive leucine-rich re...    125   3e-29   Solanum tuberosum [potatoes]
ref|XP_008388889.1|  PREDICTED: probably inactive leucine-rich re...    123   3e-29   
ref|XP_004502826.1|  PREDICTED: probably inactive leucine-rich re...    125   5e-29   Cicer arietinum [garbanzo]
ref|XP_004240861.1|  PREDICTED: probably inactive leucine-rich re...    125   5e-29   Solanum lycopersicum
ref|XP_009614707.1|  PREDICTED: probably inactive leucine-rich re...    125   5e-29   Nicotiana tomentosiformis
gb|EYU42026.1|  hypothetical protein MIMGU_mgv1a000905mg                125   6e-29   Erythranthe guttata [common monkey flower]
ref|XP_003522510.2|  PREDICTED: probably inactive leucine-rich re...    124   7e-29   Glycine max [soybeans]
ref|XP_010043193.1|  PREDICTED: probably inactive leucine-rich re...    124   7e-29   Eucalyptus grandis [rose gum]
ref|XP_006402993.1|  hypothetical protein EUTSA_v10005773mg             124   7e-29   Eutrema salsugineum [saltwater cress]
ref|XP_007136420.1|  hypothetical protein PHAVU_009G043600g             124   7e-29   Phaseolus vulgaris [French bean]
ref|XP_009793754.1|  PREDICTED: probably inactive leucine-rich re...    124   7e-29   Nicotiana sylvestris
gb|KHN11868.1|  Probably inactive leucine-rich repeat receptor-li...    124   8e-29   Glycine soja [wild soybean]
ref|XP_011001391.1|  PREDICTED: probably inactive leucine-rich re...    124   8e-29   Populus euphratica
ref|XP_010103654.1|  Probably inactive leucine-rich repeat recept...    124   1e-28   Morus notabilis
ref|XP_002325929.2|  leucine-rich repeat transmembrane protein ki...    124   1e-28   
ref|XP_011010876.1|  PREDICTED: probably inactive leucine-rich re...    124   1e-28   Populus euphratica
ref|XP_011010875.1|  PREDICTED: probably inactive leucine-rich re...    124   1e-28   Populus euphratica
ref|XP_003516434.1|  PREDICTED: probably inactive leucine-rich re...    124   1e-28   Glycine max [soybeans]
ref|XP_002988156.1|  hypothetical protein SELMODRAFT_40688              124   1e-28   
ref|XP_007134721.1|  hypothetical protein PHAVU_010G070400g             124   1e-28   Phaseolus vulgaris [French bean]
ref|XP_010525412.1|  PREDICTED: probably inactive leucine-rich re...    124   1e-28   Tarenaya hassleriana [spider flower]
ref|XP_006842493.1|  hypothetical protein AMTR_s00077p00091370          124   1e-28   Amborella trichopoda
gb|EYU35201.1|  hypothetical protein MIMGU_mgv1a000839mg                123   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_006341303.1|  PREDICTED: probably inactive leucine-rich re...    123   2e-28   Solanum tuberosum [potatoes]
ref|XP_008370260.1|  PREDICTED: probably inactive leucine-rich re...    123   2e-28   
ref|XP_010504542.1|  PREDICTED: probably inactive leucine-rich re...    123   2e-28   Camelina sativa [gold-of-pleasure]
dbj|BAJ85468.1|  predicted protein                                      123   2e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009349085.1|  PREDICTED: probably inactive leucine-rich re...    123   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_010412798.1|  PREDICTED: probably inactive leucine-rich re...    123   2e-28   
ref|XP_009362809.1|  PREDICTED: probably inactive leucine-rich re...    123   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_011084816.1|  PREDICTED: probably inactive leucine-rich re...    123   2e-28   Sesamum indicum [beniseed]
ref|XP_002467905.1|  hypothetical protein SORBIDRAFT_01g036160          123   2e-28   Sorghum bicolor [broomcorn]
ref|XP_010683484.1|  PREDICTED: probably inactive leucine-rich re...    123   3e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004514781.1|  PREDICTED: probably inactive leucine-rich re...    123   3e-28   
ref|XP_004984462.1|  PREDICTED: probably inactive leucine-rich re...    122   3e-28   Setaria italica
ref|XP_002319878.2|  leucine-rich repeat transmembrane protein ki...    122   3e-28   Populus trichocarpa [western balsam poplar]
ref|XP_008782666.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    122   3e-28   
gb|KDP21644.1|  hypothetical protein JCGZ_03315                         122   4e-28   Jatropha curcas
ref|XP_004492560.1|  PREDICTED: probably inactive leucine-rich re...    122   5e-28   Cicer arietinum [garbanzo]
ref|XP_008808300.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    122   5e-28   
ref|XP_008655312.1|  PREDICTED: uncharacterized protein LOC100384...    122   6e-28   Zea mays [maize]
ref|XP_008681357.1|  PREDICTED: uncharacterized protein LOC100304...    122   7e-28   
ref|XP_004305081.1|  PREDICTED: probably inactive leucine-rich re...    121   7e-28   Fragaria vesca subsp. vesca
gb|KJB71525.1|  hypothetical protein B456_011G127000                    121   8e-28   Gossypium raimondii
ref|XP_007140080.1|  hypothetical protein PHAVU_008G082500g             121   9e-28   Phaseolus vulgaris [French bean]
ref|XP_010553156.1|  PREDICTED: probably inactive leucine-rich re...    121   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_008369373.1|  PREDICTED: probably inactive leucine-rich re...    120   2e-27   
ref|XP_009363794.1|  PREDICTED: probably inactive leucine-rich re...    120   3e-27   Pyrus x bretschneideri [bai li]
ref|XP_004308984.1|  PREDICTED: probably inactive leucine-rich re...    120   3e-27   Fragaria vesca subsp. vesca
ref|XP_007033525.1|  Leucine-rich receptor-like protein kinase fa...    119   5e-27   
ref|XP_003533657.2|  PREDICTED: probably inactive leucine-rich re...    119   7e-27   Glycine max [soybeans]
ref|XP_004173348.1|  PREDICTED: probably inactive leucine-rich re...    118   1e-26   
ref|XP_004138394.1|  PREDICTED: probably inactive leucine-rich re...    118   1e-26   Cucumis sativus [cucumbers]
gb|EPS70735.1|  hypothetical protein M569_04020                         117   2e-26   Genlisea aurea
emb|CBI25352.3|  unnamed protein product                                117   2e-26   Vitis vinifera
ref|XP_003605286.1|  Receptor-like protein kinase                       117   2e-26   Medicago truncatula
ref|XP_008456780.1|  PREDICTED: probably inactive leucine-rich re...    117   2e-26   Cucumis melo [Oriental melon]
gb|AES79844.2|  LRR receptor-like kinase family protein                 117   2e-26   Medicago truncatula
ref|XP_003623626.1|  Receptor-like protein kinase                       117   2e-26   
ref|XP_010092789.1|  Probably inactive leucine-rich repeat recept...    116   5e-26   Morus notabilis
ref|XP_009406353.1|  PREDICTED: probably inactive leucine-rich re...    116   6e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011095143.1|  PREDICTED: probably inactive leucine-rich re...    115   8e-26   Sesamum indicum [beniseed]
ref|XP_002990527.1|  hypothetical protein SELMODRAFT_131809             108   1e-25   
emb|CBI18033.3|  unnamed protein product                                115   1e-25   Vitis vinifera
gb|KEH35536.1|  leucine-rich receptor-like kinase family protein        115   1e-25   Medicago truncatula
ref|XP_009125388.1|  PREDICTED: probably inactive leucine-rich re...    114   2e-25   Brassica rapa
ref|XP_002870895.1|  hypothetical protein ARALYDRAFT_486880             114   2e-25   
ref|XP_006398567.1|  hypothetical protein EUTSA_v10012579mg             114   3e-25   Eutrema salsugineum [saltwater cress]
dbj|BAF79960.1|  receptor-like kinase                                   114   4e-25   Marchantia polymorpha
gb|EEC75203.1|  hypothetical protein OsI_11455                          114   4e-25   Oryza sativa Indica Group [Indian rice]
ref|NP_195809.1|  leucine-rich receptor-like protein kinase             113   8e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KFK24685.1|  hypothetical protein AALP_AA8G011600                    113   8e-25   Arabis alpina [alpine rockcress]
ref|XP_009589224.1|  PREDICTED: probably inactive leucine-rich re...    112   1e-24   
gb|EMT18823.1|  Putative LRR receptor-like serine/threonine-prote...    112   1e-24   
ref|XP_003557968.1|  PREDICTED: probably inactive leucine-rich re...    111   2e-24   Brachypodium distachyon [annual false brome]
ref|XP_006279331.1|  hypothetical protein CARUB_v10012717mg             110   5e-24   Capsella rubella
ref|XP_009415955.1|  PREDICTED: probably inactive leucine-rich re...    110   6e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003567498.1|  PREDICTED: probably inactive leucine-rich re...    110   8e-24   Brachypodium distachyon [annual false brome]
ref|XP_008776998.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    109   1e-23   
ref|NP_001050035.1|  Os03g0335500                                       109   1e-23   
ref|XP_006650049.1|  PREDICTED: probably inactive leucine-rich re...    109   1e-23   Oryza brachyantha
ref|XP_010451924.1|  PREDICTED: probably inactive leucine-rich re...    108   2e-23   
ref|XP_010424006.1|  PREDICTED: probably inactive leucine-rich re...    107   4e-23   
ref|XP_010424007.1|  PREDICTED: probably inactive leucine-rich re...    107   5e-23   
ref|XP_010490496.1|  PREDICTED: probably inactive leucine-rich re...    107   5e-23   
dbj|BAK06250.1|  predicted protein                                      107   6e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP13903.1|  unnamed protein product                                107   7e-23   Coffea canephora [robusta coffee]
emb|CDY04822.1|  BnaAnng00040D                                          107   8e-23   
gb|EAZ26832.1|  hypothetical protein OsJ_10748                          106   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010670069.1|  PREDICTED: probably inactive leucine-rich re...    105   2e-22   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY27220.1|  BnaA09g35820D                                          105   3e-22   Brassica napus [oilseed rape]
ref|XP_001769840.1|  predicted protein                                  105   3e-22   
emb|CDX85183.1|  BnaC07g24940D                                          105   3e-22   
emb|CDX72142.1|  BnaC08g27320D                                          104   7e-22   
ref|XP_011076585.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    103   2e-21   Sesamum indicum [beniseed]
gb|EAY76307.1|  hypothetical protein OsI_04242                          102   2e-21   Oryza sativa Indica Group [Indian rice]
dbj|BAB85306.1|  putative receptor-like protein kinase                  102   2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002990711.1|  hypothetical protein SELMODRAFT_132189             102   3e-21   
ref|XP_009789234.1|  PREDICTED: probably inactive leucine-rich re...    102   3e-21   Nicotiana sylvestris
ref|XP_002439964.1|  hypothetical protein SORBIDRAFT_09g023480          101   8e-21   Sorghum bicolor [broomcorn]
ref|XP_001759642.1|  predicted protein                                  101   9e-21   
ref|XP_004961741.1|  PREDICTED: probably inactive leucine-rich re...  97.8    1e-19   
emb|CDY14823.1|  BnaC04g48200D                                        97.1    1e-19   Brassica napus [oilseed rape]
emb|CDY47962.1|  BnaA04g24400D                                        96.3    3e-19   Brassica napus [oilseed rape]
ref|XP_009142052.1|  PREDICTED: probable inactive leucine-rich re...  96.3    3e-19   Brassica rapa
ref|XP_002458686.1|  hypothetical protein SORBIDRAFT_03g038240        95.9    5e-19   Sorghum bicolor [broomcorn]
ref|XP_008649763.1|  PREDICTED: probably inactive leucine-rich re...  95.1    1e-18   Zea mays [maize]
ref|NP_001055847.2|  Os05g0478300                                     94.7    1e-18   
ref|XP_004970391.1|  PREDICTED: probably inactive leucine-rich re...  94.7    2e-18   Setaria italica
ref|NP_001055909.1|  Os05g0491400                                     90.5    2e-18   
ref|XP_008659447.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  89.7    2e-18   Zea mays [maize]
gb|EAY98521.1|  hypothetical protein OsI_20433                        89.4    4e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_004491185.1|  PREDICTED: somatic embryogenesis receptor ki...  88.6    7e-18   Cicer arietinum [garbanzo]
ref|NP_181758.1|  leucine-rich repeat protein kinase family protein   92.0    8e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KHG13399.1|  hypothetical protein F383_10003                       92.0    8e-18   Gossypium arboreum [tree cotton]
ref|XP_006293827.1|  hypothetical protein CARUB_v10022811mg           91.7    1e-17   Capsella rubella
ref|XP_006293826.1|  hypothetical protein CARUB_v10022811mg           91.3    1e-17   
ref|XP_004246027.1|  PREDICTED: LRR receptor-like serine/threonin...  91.3    1e-17   Solanum lycopersicum
ref|XP_010517745.1|  PREDICTED: probable inactive leucine-rich re...  91.3    1e-17   Camelina sativa [gold-of-pleasure]
ref|NP_001241394.1|  somatic embryogenesis receptor kinase 1-like...  87.8    1e-17   Glycine max [soybeans]
dbj|BAK02926.1|  predicted protein                                    92.0    1e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN38434.1|  BRASSINOSTEROID INSENSITIVE 1-associated receptor...  87.4    1e-17   Glycine soja [wild soybean]
gb|ACU19288.1|  unknown                                               87.8    1e-17   Glycine max [soybeans]
ref|XP_010506042.1|  PREDICTED: probable inactive leucine-rich re...  91.3    1e-17   Camelina sativa [gold-of-pleasure]
gb|ACU22741.1|  unknown                                               87.8    1e-17   Glycine max [soybeans]
dbj|BAJ86449.1|  predicted protein                                    91.7    1e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA57062.1|  TPA: putative leucine-rich repeat receptor-like ...  91.7    1e-17   
ref|XP_003519488.1|  PREDICTED: somatic embryogenesis receptor ki...  87.4    2e-17   Glycine max [soybeans]
ref|XP_007141567.1|  hypothetical protein PHAVU_008G206700g           88.2    2e-17   Phaseolus vulgaris [French bean]
gb|AEW49518.1|  putative LRR-RLK protein XIAO                         91.7    2e-17   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66725.1|  H0404F02.1                                           91.7    2e-17   Oryza sativa [red rice]
ref|XP_001763904.1|  predicted protein                                90.9    2e-17   
gb|EEE61543.1|  hypothetical protein OsJ_15867                        91.3    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001775671.1|  predicted protein                                90.5    3e-17   
ref|XP_004508778.1|  PREDICTED: LRR receptor-like serine/threonin...  90.1    3e-17   Cicer arietinum [garbanzo]
ref|XP_004508779.1|  PREDICTED: LRR receptor-like serine/threonin...  90.1    3e-17   
ref|XP_006394359.1|  hypothetical protein EUTSA_v10003855mg           89.7    4e-17   Eutrema salsugineum [saltwater cress]
ref|NP_001047431.1|  Os02g0615500                                     90.5    4e-17   
emb|CDP14870.1|  unnamed protein product                              89.4    5e-17   Coffea canephora [robusta coffee]
gb|EEE57372.1|  hypothetical protein OsJ_07527                        90.1    5e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006428061.1|  hypothetical protein CICLE_v10027485mg           89.0    6e-17   
ref|XP_009343456.1|  PREDICTED: LRR receptor-like serine/threonin...  89.0    7e-17   Pyrus x bretschneideri [bai li]
ref|XP_001777608.1|  predicted protein                                89.0    7e-17   
gb|KHG04550.1|  hypothetical protein F383_29256                       89.0    7e-17   Gossypium arboreum [tree cotton]
gb|AFW85540.1|  putative leucine-rich repeat receptor-like protei...  89.7    7e-17   
gb|KJB16403.1|  hypothetical protein B456_002G229000                  89.0    8e-17   Gossypium raimondii
ref|NP_001239788.1|  LRR receptor-like serine/threonine-protein k...  88.6    8e-17   Glycine max [soybeans]
ref|XP_006586717.1|  PREDICTED: LRR receptor-like serine/threonin...  88.6    9e-17   Glycine max [soybeans]
ref|XP_009416848.1|  PREDICTED: somatic embryogenesis receptor ki...  85.5    1e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB47371.1|  hypothetical protein B456_008G023200                  89.0    1e-16   Gossypium raimondii
ref|XP_002864814.1|  leucine-rich repeat family protein               88.6    1e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_010235160.1|  PREDICTED: probable LRR receptor-like serine...  87.8    1e-16   
ref|XP_008453173.1|  PREDICTED: LRR receptor-like serine/threonin...  88.2    1e-16   Cucumis melo [Oriental melon]
gb|KHN41747.1|  LRR receptor-like serine/threonine-protein kinase...  88.2    1e-16   
ref|XP_009769350.1|  PREDICTED: probable inactive leucine-rich re...  88.6    1e-16   
ref|XP_002301998.2|  leucine-rich repeat family protein               89.0    1e-16   
ref|XP_004138149.1|  PREDICTED: LRR receptor-like serine/threonin...  87.8    2e-16   
ref|XP_007028918.1|  Leucine-rich repeat protein kinase family pr...  88.2    2e-16   
ref|XP_009407942.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  87.8    2e-16   
ref|XP_009421476.1|  PREDICTED: receptor-like protein kinase HSL1     88.6    2e-16   
ref|XP_007210873.1|  hypothetical protein PRUPE_ppa003105mg           87.8    2e-16   
ref|XP_003617091.1|  Somatic embryogenesis receptor kinase            84.7    2e-16   
gb|KDO59946.1|  hypothetical protein CISIN_1g0130042mg                86.7    2e-16   
ref|XP_009614181.1|  PREDICTED: LRR receptor-like serine/threonin...  87.8    2e-16   
gb|EEE64100.1|  hypothetical protein OsJ_18931                        88.2    2e-16   
ref|XP_008239850.1|  PREDICTED: LRR receptor-like serine/threonin...  87.4    2e-16   
ref|XP_004299405.1|  PREDICTED: LRR receptor-like serine/threonin...  87.4    2e-16   
gb|EPS73511.1|  hypothetical protein M569_01245                       87.8    2e-16   
gb|ACJ85954.1|  unknown                                               84.3    2e-16   
gb|KHG29212.1|  LRR receptor-like serine/threonine-protein kinase...  87.4    2e-16   
ref|XP_010242337.1|  PREDICTED: LRR receptor-like serine/threonin...  87.4    2e-16   
ref|XP_010420958.1|  PREDICTED: somatic embryogenesis receptor ki...  84.3    2e-16   
emb|CDP18612.1|  unnamed protein product                              87.4    3e-16   
gb|EPS73860.1|  hypothetical protein M569_00895                       84.0    3e-16   
ref|XP_011028955.1|  PREDICTED: probable LRR receptor-like serine...  88.2    3e-16   
ref|XP_008646984.1|  PREDICTED: uncharacterized protein LOC100501...  87.4    3e-16   
gb|ACI95776.1|  PAN1                                                  87.4    3e-16   
ref|XP_008664634.1|  PREDICTED: probable LRR receptor-like serine...  87.8    3e-16   
ref|XP_008664637.1|  PREDICTED: probable LRR receptor-like serine...  87.4    3e-16   
gb|KJB25051.1|  hypothetical protein B456_004G175500                  85.9    3e-16   
ref|XP_006377415.1|  hypothetical protein POPTR_0011s05710g           87.8    3e-16   
gb|KCW51007.1|  hypothetical protein EUGRSUZ_J00633                   83.6    3e-16   
gb|KCW78418.1|  hypothetical protein EUGRSUZ_D02582                   86.7    3e-16   
ref|XP_009607517.1|  PREDICTED: LRR receptor-like serine/threonin...  87.0    3e-16   
ref|XP_011025618.1|  PREDICTED: somatic embryogenesis receptor ki...  84.0    3e-16   
ref|XP_008669002.1|  PREDICTED: probable LRR receptor-like serine...  87.8    3e-16   
ref|XP_006579547.1|  PREDICTED: LRR receptor-like serine/threonin...  87.0    3e-16   
ref|XP_010054034.1|  PREDICTED: LRR receptor-like serine/threonin...  87.0    3e-16   
ref|XP_009596436.1|  PREDICTED: LRR receptor-like serine/threonin...  86.3    3e-16   
ref|XP_004973571.1|  PREDICTED: probable LRR receptor-like serine...  87.0    4e-16   
ref|XP_002965655.1|  hypothetical protein SELMODRAFT_167872           87.0    4e-16   
ref|XP_009780720.1|  PREDICTED: LRR receptor-like serine/threonin...  86.7    4e-16   
ref|XP_011086853.1|  PREDICTED: somatic embryogenesis receptor ki...  83.6    4e-16   
ref|XP_002437981.1|  hypothetical protein SORBIDRAFT_10g005850        87.4    4e-16   
ref|XP_002519895.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  86.7    4e-16   
ref|XP_010325645.1|  PREDICTED: LRR receptor-like serine/threonin...  86.7    4e-16   
ref|XP_007158112.1|  hypothetical protein PHAVU_002G125100g           86.7    4e-16   
emb|CDX84346.1|  BnaC03g51540D                                        86.7    4e-16   
emb|CDY00321.1|  BnaA06g22220D                                        86.7    4e-16   
ref|XP_004512361.1|  PREDICTED: LRR receptor-like serine/threonin...  86.7    4e-16   
ref|XP_010454429.1|  PREDICTED: somatic embryogenesis receptor ki...  83.6    5e-16   
gb|AFK45363.1|  unknown                                               83.2    5e-16   
gb|EYU29140.1|  hypothetical protein MIMGU_mgv1a022602mg              86.3    5e-16   
ref|XP_009596435.1|  PREDICTED: LRR receptor-like serine/threonin...  86.3    5e-16   
ref|XP_009151389.1|  PREDICTED: LRR receptor-like serine/threonin...  86.3    5e-16   
ref|XP_006493852.1|  PREDICTED: somatic embryogenesis receptor ki...  86.3    5e-16   
ref|XP_002303477.2|  hypothetical protein POPTR_0003s10410g           86.3    6e-16   
gb|KJB25050.1|  hypothetical protein B456_004G175500                  85.9    6e-16   
ref|XP_009773743.1|  PREDICTED: LRR receptor-like serine/threonin...  86.3    7e-16   
ref|XP_002445573.1|  hypothetical protein SORBIDRAFT_07g021820        86.3    7e-16   
ref|XP_004961662.1|  PREDICTED: somatic embryogenesis receptor ki...  82.8    7e-16   
ref|XP_009793727.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    7e-16   
ref|XP_001785654.1|  predicted protein                                85.9    7e-16   
ref|XP_007040925.1|  Leucine-rich repeat protein kinase family pr...  85.5    8e-16   
ref|XP_011028007.1|  PREDICTED: LRR receptor-like serine/threonin...  85.5    8e-16   
gb|KJB25049.1|  hypothetical protein B456_004G175500                  85.9    8e-16   
ref|XP_007037206.1|  Leucine-rich repeat protein kinase family pr...  85.5    9e-16   
ref|XP_011091153.1|  PREDICTED: polygalacturonase inhibitor-like      83.6    9e-16   
ref|XP_006493855.1|  PREDICTED: somatic embryogenesis receptor ki...  85.9    9e-16   
gb|KDP39728.1|  hypothetical protein JCGZ_02748                       85.5    9e-16   
gb|EPS65172.1|  hypothetical protein M569_09607                       81.3    9e-16   
ref|XP_007023499.1|  Serine-threonine protein kinase, plant-type,...  83.2    9e-16   
ref|XP_002881831.1|  leucine-rich repeat family protein               85.9    1e-15   
ref|XP_009343197.1|  PREDICTED: LRR receptor-like serine/threonin...  85.5    1e-15   
ref|XP_007040924.1|  Leucine-rich repeat protein kinase family pr...  85.5    1e-15   
ref|XP_006411490.1|  hypothetical protein EUTSA_v10017834mg           85.5    1e-15   
ref|XP_006365392.1|  PREDICTED: LRR receptor-like serine/threonin...  85.5    1e-15   
ref|XP_011028003.1|  PREDICTED: LRR receptor-like serine/threonin...  85.5    1e-15   
ref|XP_006428060.1|  hypothetical protein CICLE_v10027231mg           85.5    1e-15   
ref|XP_008373495.1|  PREDICTED: LRR receptor-like serine/threonin...  85.5    1e-15   
tpg|DAA47958.1|  TPA: putative leucine-rich repat protein kinase ...  84.7    1e-15   
ref|XP_002451097.1|  hypothetical protein SORBIDRAFT_05g024090        85.5    1e-15   
ref|XP_010493229.1|  PREDICTED: somatic embryogenesis receptor ki...  82.4    1e-15   
gb|EYU35887.1|  hypothetical protein MIMGU_mgv1a003189mg              85.5    1e-15   
ref|XP_002462033.1|  hypothetical protein SORBIDRAFT_02g013100        85.9    1e-15   
ref|XP_006288424.1|  hypothetical protein CARUB_v10001683mg           82.8    1e-15   
gb|KHN48658.1|  LRR receptor-like serine/threonine-protein kinase...  85.1    1e-15   
ref|XP_011001223.1|  PREDICTED: receptor-like protein kinase HSL1     85.9    1e-15   
ref|XP_007037205.1|  Leucine-rich repeat protein kinase family pr...  85.1    1e-15   
ref|XP_011071715.1|  PREDICTED: LRR receptor-like serine/threonin...  85.1    1e-15   
ref|XP_011072724.1|  PREDICTED: receptor-like protein kinase isof...  85.9    2e-15   
ref|XP_011072726.1|  PREDICTED: receptor-like protein kinase isof...  85.5    2e-15   
ref|XP_011071714.1|  PREDICTED: LRR receptor-like serine/threonin...  85.1    2e-15   
ref|XP_002971685.1|  hypothetical protein SELMODRAFT_172211           85.1    2e-15   
ref|XP_010550651.1|  PREDICTED: LRR receptor-like serine/threonin...  84.7    2e-15   
ref|XP_010904696.1|  PREDICTED: somatic embryogenesis receptor ki...  81.6    2e-15   
ref|XP_002318612.2|  hypothetical protein POPTR_0012s07290g           84.3    2e-15   
ref|XP_002436858.1|  hypothetical protein SORBIDRAFT_10g010020        81.3    2e-15   
ref|XP_006854236.1|  hypothetical protein AMTR_s00048p00228530        84.7    2e-15   
dbj|BAJ91470.1|  predicted protein                                    84.7    2e-15   
ref|XP_007016687.1|  Leucine-rich repeat (LRR) family protein iso...  81.6    2e-15   
ref|XP_007210869.1|  hypothetical protein PRUPE_ppa003168mg           84.7    2e-15   
ref|XP_010092461.1|  putative LRR receptor-like serine/threonine-...  85.1    2e-15   
ref|XP_009403261.1|  PREDICTED: probable inactive leucine-rich re...  84.7    2e-15   
ref|XP_002511511.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  84.7    2e-15   
ref|XP_006603947.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...  84.3    2e-15   
ref|XP_004976562.1|  PREDICTED: probable LRR receptor-like serine...  85.1    2e-15   
ref|XP_011042612.1|  PREDICTED: LRR receptor-like serine/threonin...  84.3    2e-15   
ref|XP_010265781.1|  PREDICTED: probable inactive leucine-rich re...  84.3    3e-15   
ref|XP_009624197.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  81.3    3e-15   
ref|XP_004145576.1|  PREDICTED: LRR receptor-like serine/threonin...  84.3    3e-15   
ref|XP_004964648.1|  PREDICTED: putative leucine-rich repeat rece...  84.7    3e-15   
ref|XP_003555046.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...  84.3    3e-15   
ref|XP_002533978.1|  lrr receptor protein kinase, putative            84.0    3e-15   
ref|XP_002975503.1|  hypothetical protein SELMODRAFT_103488           84.0    3e-15   
gb|KHN30771.1|  Protein NSP-INTERACTING KINASE 1                      84.3    3e-15   
ref|XP_009369360.1|  PREDICTED: LRR receptor-like serine/threonin...  84.3    3e-15   
ref|XP_002978742.1|  hypothetical protein SELMODRAFT_109609           84.0    3e-15   
gb|ABK93925.1|  unknown                                               84.3    3e-15   
ref|XP_007025532.1|  HAESA-like 1 isoform 1                           84.7    3e-15   
ref|XP_007025533.1|  HAESA-like 1 isoform 2                           84.7    3e-15   
ref|XP_009391272.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.3    3e-15   
emb|CDX87267.1|  BnaC09g05820D                                        84.0    3e-15   
ref|XP_008356494.1|  PREDICTED: probable inactive leucine-rich re...  83.2    3e-15   
ref|XP_010256230.1|  PREDICTED: LRR receptor-like serine/threonin...  84.0    3e-15   
ref|XP_009391273.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.0    4e-15   
ref|XP_008374516.1|  PREDICTED: LRR receptor-like serine/threonin...  84.0    4e-15   
ref|XP_008238033.1|  PREDICTED: LRR receptor-like serine/threonin...  84.0    4e-15   
ref|XP_010256225.1|  PREDICTED: LRR receptor-like serine/threonin...  84.0    4e-15   
ref|XP_010528022.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      84.0    4e-15   
ref|XP_008225155.1|  PREDICTED: receptor-like protein kinase HSL1     84.3    4e-15   
gb|EYU37463.1|  hypothetical protein MIMGU_mgv1a003320mg              84.0    4e-15   
gb|EEC68243.1|  hypothetical protein OsI_36258                        80.9    4e-15   
ref|XP_011027770.1|  PREDICTED: receptor-like protein kinase HSL1     84.3    4e-15   
ref|XP_007047392.1|  Leucine-rich repeat protein kinase family pr...  84.3    4e-15   
emb|CDY16762.1|  BnaA09g06200D                                        83.6    4e-15   
ref|XP_002305776.1|  leucine-rich repeat receptor-like protein ki...  84.3    4e-15   
ref|XP_007047393.1|  Leucine-rich repeat protein kinase family pr...  84.0    4e-15   
ref|NP_201077.2|  leucine-rich repeat protein kinase-like protein     83.6    4e-15   
gb|KDP31199.1|  hypothetical protein JCGZ_11575                       83.6    4e-15   
ref|XP_009112029.1|  PREDICTED: LRR receptor-like serine/threonin...  83.6    4e-15   
ref|XP_007042511.1|  Leucine-rich repeat (LRR) family protein         82.4    4e-15   
emb|CDX92412.1|  BnaA10g14510D                                        80.5    4e-15   
ref|XP_007023498.1|  Serine-threonine protein kinase, plant-type,...  83.6    5e-15   
ref|XP_002994468.1|  hypothetical protein SELMODRAFT_432388           81.3    5e-15   
gb|KFK26321.1|  hypothetical protein AALP_AA8G232500                  80.5    5e-15   
ref|XP_006493854.1|  PREDICTED: somatic embryogenesis receptor ki...  83.6    5e-15   
ref|XP_007016686.1|  Leucine-rich repeat family protein isoform 1     80.9    5e-15   
ref|XP_009120732.1|  PREDICTED: somatic embryogenesis receptor ki...  80.5    5e-15   
ref|XP_007138218.1|  hypothetical protein PHAVU_009G190400g           83.6    5e-15   
ref|XP_007138217.1|  hypothetical protein PHAVU_009G190400g           83.6    5e-15   
ref|XP_004974753.1|  PREDICTED: leucine-rich repeat receptor-like...  83.2    5e-15   
ref|XP_009390422.1|  PREDICTED: probable LRR receptor-like serine...  83.6    5e-15   
ref|XP_006493856.1|  PREDICTED: somatic embryogenesis receptor ki...  83.2    6e-15   
ref|XP_010248541.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  83.6    6e-15   
ref|XP_001768500.1|  predicted protein                                83.2    6e-15   
gb|AFO67894.1|  leucine-rich repeat receptor-like kinase              83.2    6e-15   
ref|XP_006339232.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  80.1    6e-15   
ref|XP_004300401.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    6e-15   
ref|XP_010502426.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      83.2    6e-15   
emb|CDY16593.1|  BnaC09g36800D                                        80.1    6e-15   
ref|XP_007213694.1|  hypothetical protein PRUPE_ppa000813mg           84.0    6e-15   
ref|XP_009777835.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  80.1    6e-15   
dbj|BAP56822.1|  receptor protein kinase-like protein                 84.0    6e-15   
ref|XP_008444265.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    7e-15   
ref|XP_002876917.1|  nsp-interacting kinase 2                         83.2    7e-15   
emb|CDX70962.1|  BnaC03g10460D                                        80.1    7e-15   
gb|KDP34452.1|  hypothetical protein JCGZ_11923                       83.6    7e-15   
ref|XP_009348212.1|  PREDICTED: probable inactive leucine-rich re...  82.4    7e-15   
emb|CDX93126.1|  BnaA03g38480D                                        83.2    7e-15   
ref|XP_010999778.1|  PREDICTED: probable LRR receptor-like serine...  83.6    7e-15   
ref|XP_003602344.1|  Kinase-like protein                              83.6    7e-15   
ref|XP_010525796.1|  PREDICTED: putative leucine-rich repeat rece...  83.6    7e-15   
ref|XP_010232495.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...  83.6    7e-15   
ref|XP_011025617.1|  PREDICTED: somatic embryogenesis receptor ki...  80.1    8e-15   
ref|XP_010244265.1|  PREDICTED: probable LRR receptor-like serine...  83.2    8e-15   
ref|XP_003554189.2|  PREDICTED: probable inactive leucine-rich re...  83.2    8e-15   
ref|XP_006400679.1|  hypothetical protein EUTSA_v10014631mg           79.7    8e-15   
ref|XP_009136223.1|  PREDICTED: somatic embryogenesis receptor ki...  82.8    8e-15   
ref|XP_011079162.1|  PREDICTED: somatic embryogenesis receptor ki...  79.7    9e-15   
gb|KDP38737.1|  hypothetical protein JCGZ_04090                       82.8    1e-14   
gb|KHN19373.1|  LRR receptor-like serine/threonine-protein kinase...  82.8    1e-14   
gb|EPS72631.1|  hypothetical protein M569_02128                       82.8    1e-14   
ref|XP_003527058.1|  PREDICTED: LRR receptor-like serine/threonin...  82.4    1e-14   
ref|XP_008222348.1|  PREDICTED: somatic embryogenesis receptor ki...  80.1    1e-14   
emb|CDY46500.1|  BnaA02g27500D                                        80.1    1e-14   
ref|XP_011018089.1|  PREDICTED: probable LRR receptor-like serine...  82.4    1e-14   
ref|XP_006581953.1|  PREDICTED: LRR receptor-like serine/threonin...  82.4    1e-14   
ref|XP_009136222.1|  PREDICTED: somatic embryogenesis receptor ki...  82.4    1e-14   
emb|CDX89615.1|  BnaC03g45290D                                        82.4    1e-14   
ref|XP_004306158.1|  PREDICTED: probable inactive leucine-rich re...  82.4    1e-14   
ref|XP_002992346.1|  hypothetical protein SELMODRAFT_26650            78.6    1e-14   
ref|XP_007225784.1|  hypothetical protein PRUPE_ppa011206mg           79.3    1e-14   
ref|XP_007025138.1|  Leucine-rich receptor-like protein kinase fa...  82.8    1e-14   
ref|XP_010927978.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  82.4    1e-14   
ref|XP_002981408.1|  leucine rich repeat receptor kinase              82.0    1e-14   
emb|CDX99771.1|  BnaC02g35490D                                        79.7    1e-14   
gb|AEC46975.1|  somatic embryogenesis receptor-like kinase            82.4    1e-14   
gb|KHG18466.1|  Receptor-like protein kinase HSL1                     82.8    1e-14   
dbj|BAB10839.1|  receptor-like protein kinase                         82.0    1e-14   
ref|XP_002969939.1|  hypothetical protein SELMODRAFT_93043            82.0    1e-14   
ref|XP_010514169.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  82.0    2e-14   
ref|XP_009390537.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  82.0    2e-14   
ref|XP_002309372.1|  leucine-rich repeat family protein               82.0    2e-14   
ref|XP_002305701.2|  FLAGELLIN-SENSITIVE 2 family protein             82.4    2e-14   
ref|XP_006656945.1|  PREDICTED: LRR receptor-like serine/threonin...  82.4    2e-14   
gb|KHN08861.1|  LRR receptor-like serine/threonine-protein kinase...  81.6    2e-14   
ref|XP_006425530.1|  hypothetical protein CICLE_v10027574mg           82.4    2e-14   
ref|XP_009418103.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  81.6    2e-14   
ref|XP_010672728.1|  PREDICTED: probable inactive leucine-rich re...  82.0    2e-14   
ref|XP_010531560.1|  PREDICTED: polygalacturonase inhibitor 1         80.1    2e-14   
ref|XP_007225190.1|  hypothetical protein PRUPE_ppa002123mg           82.0    2e-14   
gb|KDO71127.1|  hypothetical protein CISIN_1g047739mg                 82.4    2e-14   
ref|XP_002991272.1|  hypothetical protein SELMODRAFT_236241           82.0    2e-14   
ref|XP_009418102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  81.6    2e-14   
emb|CDX88826.1|  BnaA03g08230D                                        78.6    2e-14   
ref|XP_002991210.1|  hypothetical protein SELMODRAFT_236225           82.0    2e-14   
ref|XP_008649805.1|  PREDICTED: somatic embryogenesis receptor ki...  78.6    2e-14   
ref|XP_008222077.1|  PREDICTED: probable inactive leucine-rich re...  81.6    2e-14   
gb|AFV33711.1|  leucine rich repeat protein                           78.6    2e-14   
ref|XP_009131837.1|  PREDICTED: somatic embryogenesis receptor ki...  78.6    2e-14   
gb|EMT29112.1|  Putative LRR receptor-like serine/threonine-prote...  80.9    2e-14   
ref|XP_010024065.1|  PREDICTED: receptor protein kinase-like prot...  82.0    2e-14   
ref|XP_010677519.1|  PREDICTED: LRR receptor-like serine/threonin...  81.6    2e-14   



>ref|XP_011073820.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=1009

 Score =   192 bits (489),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +1

Query  160  SGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  339
            +G  G E+LQLNDDVLGLIV KSG QDP   L +W+EDD+SPCAW F+KC+P N RVSEV
Sbjct  22   TGCFGGETLQLNDDVLGLIVLKSGFQDPFKSLDSWNEDDESPCAWKFIKCNPGNNRVSEV  81

Query  340  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  519
             L GLGLSGKIGRGLEKL+ L VLSL+SNN +G I P+L L+ NL+ LNLSKNS+SG VP
Sbjct  82   SLDGLGLSGKIGRGLEKLQSLKVLSLSSNNLTGSIIPELALIPNLERLNLSKNSLSGNVP  141

Query  520  DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
             SL ++SSLQFLDLS NSLSGP+ D M +N  SLR
Sbjct  142  SSLSDVSSLQFLDLSQNSLSGPLPDDMFQNCFSLR  176



>emb|CDP14623.1| unnamed protein product [Coffea canephora]
Length=1020

 Score =   190 bits (482),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +1

Query  172  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  351
              +SL LNDDVLGLIVFKS + DP SHL +WSEDD SPCAW FVKC+P NGRVSEV L G
Sbjct  35   AEDSLPLNDDVLGLIVFKSAIYDPFSHLESWSEDDSSPCAWEFVKCNPRNGRVSEVSLDG  94

Query  352  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  531
            LGLSGK+GRGLEKL+ L VLSL++NN +G ISP+  L+T L+ LNLS+N++ G +P S+ 
Sbjct  95   LGLSGKMGRGLEKLQDLKVLSLSNNNLTGSISPEFALITGLERLNLSQNNLRGNIPSSVA  154

Query  532  NMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            NMSS+QFLDLS N LSGP+SD + EN  SLR
Sbjct  155  NMSSIQFLDLSENLLSGPISDDIFENCQSLR  185



>ref|XP_009589223.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Nicotiana tomentosiformis]
Length=1012

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = +1

Query  163  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  342
            G+   E+LQLNDDVLGLIVFKS + DP S L +W+EDD+SPCAW F+KC+P NGRVSE++
Sbjct  24   GSLADETLQLNDDVLGLIVFKSALLDPNSKLLSWNEDDNSPCAWEFIKCNPMNGRVSELN  83

Query  343  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  522
            L+GL LSGKIGRGLEKL+ L VLSL++NNF+G ISP+LGLL NL+ LNLS+N +SG +P 
Sbjct  84   LNGLSLSGKIGRGLEKLQSLQVLSLSNNNFTGPISPELGLLINLENLNLSQNGLSGNIPA  143

Query  523  SLGNMSSLQFLDLSGNSLSGPVSDSMLENLG-SLR  624
            S+  M+SLQFLDLS NSLSGPVSD++ +N G SLR
Sbjct  144  SISKMTSLQFLDLSENSLSGPVSDTIFDNCGNSLR  178


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 52/92 (57%), Gaps = 0/92 (0%)
 Frame = +1

Query  325  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  504
            ++ E  L G   SG++   +    HLN L L+ N F+G I   +  L  L  L LS N I
Sbjct  250  QLKEFLLQGNQFSGELPSDIGFCPHLNKLDLSENLFTGAIPESVQKLNALSFLTLSNNMI  309

Query  505  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSM  600
            +G  P  + NMSSL++LD SGNSL G + DS+
Sbjct  310  NGDFPQWISNMSSLEYLDFSGNSLEGSLPDSI  341


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  507
            ++++DL     +G I   ++KL  L+ L+L++N  +G     +  +++L+ L+ S NS+ 
Sbjct  275  LNKLDLSENLFTGAIPESVQKLNALSFLTLSNNMINGDFPQWISNMSSLEYLDFSGNSLE  334

Query  508  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML  603
            G++PDS+G++  L++L LSGN LSG +  SM+
Sbjct  335  GSLPDSIGDLKMLKYLSLSGNKLSGNIPKSMV  366



>emb|CBI39439.3| unnamed protein product [Vitis vinifera]
Length=803

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  184  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  363
            +Q+NDDVLGLIVFKSG+ DP+S L +WSEDDDSPC+W FV+C+P+ GRVSEV + GLGLS
Sbjct  8    IQINDDVLGLIVFKSGLHDPSSRLDSWSEDDDSPCSWEFVQCNPSTGRVSEVSVDGLGLS  67

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  543
            GKIGRGLEKL++L VLSL+ NNFSG ISP+L L+T L+ LNLS NS+SG +P SL NM+S
Sbjct  68   GKIGRGLEKLQNLKVLSLSFNNFSGSISPELALITGLERLNLSHNSLSGRIPSSLSNMTS  127

Query  544  LQFLDLSGNSLSGPVSDSMLEN  609
            ++FLDLS NSL+GP+ D M EN
Sbjct  128  IRFLDLSHNSLAGPIPDEMFEN  149



>ref|XP_009765958.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=1012

 Score =   188 bits (477),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = +1

Query  163  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  342
            G+   E+LQLNDDVLGLIVFKS + DP S L +W+EDD+SPCAW F+KC+P NGRVSE++
Sbjct  24   GSLAGETLQLNDDVLGLIVFKSTLLDPNSKLLSWNEDDNSPCAWEFIKCNPMNGRVSELN  83

Query  343  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  522
            L+GL LSGKIGRGLEKL+ L VLSL++NNF+G ISP+L LLTNL+ LNLS+N ++G +P 
Sbjct  84   LNGLSLSGKIGRGLEKLQSLQVLSLSNNNFTGPISPELALLTNLENLNLSQNGLTGNIPP  143

Query  523  SLGNMSSLQFLDLSGNSLSGPVSDSMLENLG-SLR  624
            S+  ++SLQFLDLS NSLSGPVSD+M +N G SLR
Sbjct  144  SISKITSLQFLDLSQNSLSGPVSDTMFDNCGNSLR  178


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = +1

Query  325  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  504
            ++ E+ L G   SGK+   +    HLN L L+ N F+G I   +  L  L  L+LS N I
Sbjct  250  QLKELLLQGNQFSGKLPSDIGYCPHLNKLDLSENLFTGAIPESVQKLNALSFLSLSNNMI  309

Query  505  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSM  600
            +G  P  + NMSSL++LD SGNS+ G + DS+
Sbjct  310  NGDFPQWISNMSSLEYLDFSGNSIEGTLPDSI  341


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  507
            ++++DL     +G I   ++KL  L+ LSL++N  +G     +  +++L+ L+ S NSI 
Sbjct  275  LNKLDLSENLFTGAIPESVQKLNALSFLSLSNNMINGDFPQWISNMSSLEYLDFSGNSIE  334

Query  508  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML  603
            GT+PDS+G++  L++L LSGN LSG +  SM+
Sbjct  335  GTLPDSIGDLKMLKYLSLSGNKLSGKIPKSMV  366



>ref|XP_006364689.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=1011

 Score =   187 bits (476),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 125/149 (84%), Gaps = 1/149 (1%)
 Frame = +1

Query  181  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  360
            ++QLNDDVLGLIVFKS + DP S L +WSEDD+SPCAW ++KC+P NGRV+E++L+GL L
Sbjct  27   TMQLNDDVLGLIVFKSALLDPYSKLLSWSEDDNSPCAWEYIKCNPMNGRVTELNLNGLSL  86

Query  361  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  540
            SGKIGRGLEKL+ L VLSL++NNF+G ISP+L LLTNL+ LN S N +SG +P S  NM+
Sbjct  87   SGKIGRGLEKLQSLKVLSLSNNNFTGAISPELALLTNLENLNFSHNGLSGNIPGSFSNMT  146

Query  541  SLQFLDLSGNSLSGPVSDSMLENLG-SLR  624
            SLQFLDLS N+LSGPVSD+M +N G SLR
Sbjct  147  SLQFLDLSENALSGPVSDTMFDNCGDSLR  175


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = +1

Query  325  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  504
            ++ E  L G   SG +   +    HLN L L++N F+G I   L  +  L  L+LS N I
Sbjct  247  QLKECLLQGNHFSGDLPADIGFCPHLNRLDLSNNQFTGQIPMSLQRVNVLSFLSLSNNMI  306

Query  505  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSM  600
            +G  P  + NMSSL++LDLSGNSL G + DS+
Sbjct  307  NGDFPQWISNMSSLEYLDLSGNSLEGALPDSI  338


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  507
            ++ +DL     +G+I   L+++  L+ LSL++N  +G     +  +++L+ L+LS NS+ 
Sbjct  272  LNRLDLSNNQFTGQIPMSLQRVNVLSFLSLSNNMINGDFPQWISNMSSLEYLDLSGNSLE  331

Query  508  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML  603
            G +PDS+G++  L++L LSGN LSG +  SM+
Sbjct  332  GALPDSIGDLKMLKYLSLSGNKLSGNIPKSMV  363



>ref|XP_002265846.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=1012

 Score =   187 bits (475),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  184  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  363
            +Q+NDDVLGLIVFKSG+ DP+S L +WSEDDDSPC+W FV+C+P+ GRVSEV + GLGLS
Sbjct  34   IQINDDVLGLIVFKSGLHDPSSRLDSWSEDDDSPCSWEFVQCNPSTGRVSEVSVDGLGLS  93

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  543
            GKIGRGLEKL++L VLSL+ NNFSG ISP+L L+T L+ LNLS NS+SG +P SL NM+S
Sbjct  94   GKIGRGLEKLQNLKVLSLSFNNFSGSISPELALITGLERLNLSHNSLSGRIPSSLSNMTS  153

Query  544  LQFLDLSGNSLSGPVSDSMLEN  609
            ++FLDLS NSL+GP+ D M EN
Sbjct  154  IRFLDLSHNSLAGPIPDEMFEN  175



>ref|XP_007034091.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY05017.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1011

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 142/177 (80%), Gaps = 1/177 (1%)
 Frame = +1

Query  97   IYIMGFRsmlllvflsvlsvTSGAGGAE-SLQLNDDVLGLIVFKSGVQDPASHLATWSED  273
            + +MGFR +++ + LS+  +    G  + S+QLNDDVLGLIVFKS ++DP+S+L +W+ED
Sbjct  4    MVVMGFRQLVVFLLLSMAVLHGCMGNDDASIQLNDDVLGLIVFKSDIKDPSSYLDSWNED  63

Query  274  DDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPq  453
            D+SPC+W F++C+P NGRVSEV L+GLGLSGKIG+GL+KL++L VLSL+ NNFSG ISP+
Sbjct  64   DNSPCSWRFIQCNPVNGRVSEVSLNGLGLSGKIGKGLQKLQYLKVLSLSHNNFSGSISPE  123

Query  454  lglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            LGL+ +L+ LNLS NS+SG +P S  NM+S++FLDLSGNSLSG V D + +   SLR
Sbjct  124  LGLIGSLERLNLSHNSLSGRIPSSFVNMNSIRFLDLSGNSLSGSVPDDLFQTCSSLR  180



>ref|XP_006840189.1| hypothetical protein AMTR_s00089p00108500 [Amborella trichopoda]
 gb|ERN01864.1| hypothetical protein AMTR_s00089p00108500 [Amborella trichopoda]
Length=975

 Score =   184 bits (467),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +1

Query  181  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  360
            SLQLNDDVLGLIVFK+G+QDP S L++WSEDDDSPC WNFV+C   +GRV+EV L GL L
Sbjct  33   SLQLNDDVLGLIVFKAGIQDPTSSLSSWSEDDDSPCHWNFVQCDRNSGRVTEVSLDGLSL  92

Query  361  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  540
            SGKIGRGLEKL++L  LSL++NNFSG I+P+L  + +L+ LNLS+NS+SG++P SLGNMS
Sbjct  93   SGKIGRGLEKLQNLQALSLSNNNFSGTINPELARIESLRRLNLSRNSLSGSIPPSLGNMS  152

Query  541  SLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            S+Q LD S NSLSG + D +  N  SLR
Sbjct  153  SIQVLDFSENSLSGTIPDYVFNNCFSLR  180



>ref|XP_004247993.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=1012

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +1

Query  181  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  360
            ++QLNDDVLGLIVFKS + DP S L +WSEDD+SPCAW ++KC+P NGRV+E++L+GL L
Sbjct  27   TMQLNDDVLGLIVFKSALLDPYSKLLSWSEDDNSPCAWEYIKCNPMNGRVNELNLNGLSL  86

Query  361  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  540
            SGKIGRGLEKL+ L VLSL++NNF+G ISP+L LLTNL+ LN S N +SG +P S   M+
Sbjct  87   SGKIGRGLEKLQSLKVLSLSNNNFTGAISPELALLTNLENLNFSHNGLSGNIPGSFSKMT  146

Query  541  SLQFLDLSGNSLSGPVSDSMLEN  609
            SLQFLDLS N+LSGPVSD+M +N
Sbjct  147  SLQFLDLSENALSGPVSDTMFDN  169


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = +1

Query  325  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  504
            ++ E  L G   SG +   +    HLN L L++N F+G I   L  +  L  L+LS N I
Sbjct  247  QLKECLLQGNHFSGDLPADIGYCPHLNRLDLSNNQFTGQIPMSLQKVNALSFLSLSNNMI  306

Query  505  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSM  600
            +G  P  + NMSSL++LDLSGNSL G + DS+
Sbjct  307  NGDFPQWISNMSSLEYLDLSGNSLEGALPDSI  338


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  507
            ++ +DL     +G+I   L+K+  L+ LSL++N  +G     +  +++L+ L+LS NS+ 
Sbjct  272  LNRLDLSNNQFTGQIPMSLQKVNALSFLSLSNNMINGDFPQWISNMSSLEYLDLSGNSLE  331

Query  508  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML  603
            G +PDS+G++  L++L LSGN LSG +  SM+
Sbjct  332  GALPDSIGDLKMLKYLSLSGNKLSGNIPKSMV  363



>ref|XP_010528265.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=1011

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = +1

Query  169  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  348
            G A S QLNDDVLGLIVFK+ + DP+SHL +W+EDD SPC+W ++KC+PA GRVSE+ L 
Sbjct  23   GDAGSFQLNDDVLGLIVFKADINDPSSHLESWNEDDYSPCSWKYIKCNPATGRVSEISLD  82

Query  349  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  528
            GLGLSGKIGRG++KL+HL VLSL+ NNF+G I PQ+GL+T LQ LNLS N +SG +P SL
Sbjct  83   GLGLSGKIGRGVQKLQHLKVLSLSDNNFTGNIIPQIGLITGLQKLNLSHNRLSGIIPSSL  142

Query  529  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            G++SSL+FLDLS NSLSG + D    N   LR
Sbjct  143  GSISSLKFLDLSENSLSGTIPDDFFRNNSPLR  174



>ref|XP_004156987.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040-like [Cucumis 
sativus]
Length=1007

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +1

Query  187  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  366
            QLNDD+LGLIVFKS +QDP+S L++WSEDDDSPC+W F+KC+P NGRVSEV + GLGLSG
Sbjct  31   QLNDDILGLIVFKSDLQDPSSVLSSWSEDDDSPCSWKFIKCNPINGRVSEVSIDGLGLSG  90

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  546
            +IGRGLEKL+HL VLSL+ NNF+G +SPQL L  +L  +N S NS+SG +P SL +MSS+
Sbjct  91   RIGRGLEKLQHLKVLSLSGNNFTGNLSPQLVLPPSLDRVNFSGNSLSGRIPVSLISMSSI  150

Query  547  QFLDLSGNSLSGPVSDSMLENLGSL  621
            +FLD S N LSGP+ D M  N  SL
Sbjct  151  RFLDFSDNLLSGPLPDEMFVNCSSL  175



>ref|XP_004152295.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN53091.1| Receptor protein kinase [Cucumis sativus]
Length=1007

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +1

Query  187  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  366
            QLNDD+LGLIVFKS +QDP+S L++WSEDDDSPC+W F+KC+P NGRVSEV + GLGLSG
Sbjct  31   QLNDDILGLIVFKSDLQDPSSVLSSWSEDDDSPCSWKFIKCNPINGRVSEVSIDGLGLSG  90

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  546
            +IGRGLEKL+HL VLSL+ NNF+G +SPQL L  +L  +N S NS+SG +P SL +MSS+
Sbjct  91   RIGRGLEKLQHLKVLSLSGNNFTGNLSPQLVLPPSLDRVNFSGNSLSGRIPVSLISMSSI  150

Query  547  QFLDLSGNSLSGPVSDSMLENLGSL  621
            +FLD S N LSGP+ D M  N  SL
Sbjct  151  RFLDFSDNLLSGPLPDEMFVNCSSL  175



>ref|XP_002518223.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF44166.1| receptor protein kinase, putative [Ricinus communis]
Length=1007

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +1

Query  181  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  360
            ++QLNDDVLGLIVFKS + DP+S L++WSEDDDSPC+W F++C+ ANGRVS V L GLGL
Sbjct  27   TIQLNDDVLGLIVFKSDLVDPSSTLSSWSEDDDSPCSWKFIECNSANGRVSHVSLDGLGL  86

Query  361  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  540
            SGK+G+GL+KL+HL VLSL+ NNFSG ISP L L+ +L++LNLS NS+SG +P S  NM+
Sbjct  87   SGKLGKGLQKLQHLKVLSLSHNNFSGEISPDLPLIPSLESLNLSHNSLSGLIPSSFVNMT  146

Query  541  SLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            +++FLDLS NSLSGP+ D++ +N  SLR
Sbjct  147  TVRFLDLSENSLSGPLPDNLFQNCLSLR  174



>ref|XP_008453972.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=1010

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +1

Query  181  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  360
            S QLNDD+LGLIVFKS + DP+S L++WSEDDDSPC+W F+KC+P NGRVSEV + GLGL
Sbjct  29   SPQLNDDILGLIVFKSDLHDPSSALSSWSEDDDSPCSWKFIKCNPINGRVSEVSIDGLGL  88

Query  361  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  540
            SG+IGRGLEKL+HL VLSL+ NNF+G ++PQL L  +L  +N S+NS+SG +P SL +MS
Sbjct  89   SGRIGRGLEKLQHLKVLSLSGNNFTGNLNPQLALPPSLDRVNFSRNSLSGRIPVSLISMS  148

Query  541  SLQFLDLSGNSLSGPVSDSMLENLGSL  621
            S++FLD S N LSGP+ D M  N  SL
Sbjct  149  SVRFLDFSDNLLSGPLPDEMFVNCSSL  175



>ref|XP_010268319.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=1009

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = +1

Query  181  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  360
            SLQLNDDVLGLIVFK+ + DP+S L +W+EDD++PC+W +V+C P++GRV+E+ L GLGL
Sbjct  32   SLQLNDDVLGLIVFKTDLHDPSSLLGSWNEDDNTPCSWKYVRCDPSSGRVTELSLDGLGL  91

Query  361  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  540
            SGKIGRGLEKL++L VLSL+ NNF+G ISP+L L+ +L TLNLS NS+SG +P  LGNMS
Sbjct  92   SGKIGRGLEKLQNLQVLSLSHNNFTGDISPELSLIGSLTTLNLSHNSLSGRIPVELGNMS  151

Query  541  SLQFLDLSGNSLSGPVSDSMLENLGSL  621
            +L+FLDLS NSLSGP+ D + +N  SL
Sbjct  152  ALRFLDLSENSLSGPLPDGLFQNCFSL  178



>gb|KJB37929.1| hypothetical protein B456_006G227000 [Gossypium raimondii]
Length=988

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +1

Query  163  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  342
            G   + S+QLNDDVLGLIVFKS ++DP+S+L +W+EDD+SPC+W F+KC+P NGRVSEV 
Sbjct  28   GDDESSSVQLNDDVLGLIVFKSDIKDPSSYLESWNEDDNSPCSWRFIKCNPNNGRVSEVS  87

Query  343  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  522
            L GLGLSGKIG+GL+KLE+L VLSL+ NNFSG+I    G+L +L+ L+LS N++SG++P 
Sbjct  88   LDGLGLSGKIGKGLQKLEYLKVLSLSRNNFSGIIGRAFGVLNSLERLDLSYNNLSGSIPS  147

Query  523  SLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            +  NM+S++FLDLS NSLSG + + + +   SLR
Sbjct  148  TFVNMNSIRFLDLSRNSLSGSIPEELFQTCSSLR  181



>gb|KHN27185.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=1007

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +1

Query  184  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  363
            +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLDDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  543
            GKIGRGLEKL+HL VLSL+ N+ SG ISP L L  +L+ LNLS N++SG++P S  NM+S
Sbjct  91   GKIGRGLEKLQHLTVLSLSHNSLSGSISPSLTLSNSLERLNLSHNALSGSIPTSFVNMNS  150

Query  544  LQFLDLSGNSLSGPVSDSMLENLGSLR  624
            ++FLDLS NS SGPV +S  E+  SL 
Sbjct  151  IRFLDLSENSFSGPVPESFFESCSSLH  177



>ref|XP_003518672.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=1007

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +1

Query  184  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  363
            +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLDDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  543
            GKIGRGLEKL+HL VLSL+ N+ SG ISP L L  +L+ LNLS N++SG++P S  NM+S
Sbjct  91   GKIGRGLEKLQHLTVLSLSHNSLSGSISPSLTLSNSLERLNLSHNALSGSIPTSFVNMNS  150

Query  544  LQFLDLSGNSLSGPVSDSMLENLGSLR  624
            ++FLDLS NS SGPV +S  E+  SL 
Sbjct  151  IRFLDLSENSFSGPVPESFFESCSSLH  177



>ref|XP_003552656.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=1007

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +1

Query  184  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  363
            +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLNDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  543
            GKIGRGLEKL+HL VLSL+ NN SG ISP L L  +L+ LNLS N +SG++P S  NM+S
Sbjct  91   GKIGRGLEKLQHLTVLSLSHNNLSGSISPSLTLSNSLERLNLSHNVLSGSIPTSFVNMNS  150

Query  544  LQFLDLSGNSLSGPVSDSMLENLGSLR  624
            ++FLDLS NS SGP+ +S  E+  SL 
Sbjct  151  IKFLDLSENSFSGPMPESFFESCSSLH  177



>gb|KHN13843.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=1007

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +1

Query  184  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  363
            +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLNDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  543
            GKIGRGLEKL+HL VLSL+ NN SG ISP L L  +L+ LNLS N +SG++P S  NM+S
Sbjct  91   GKIGRGLEKLQHLTVLSLSHNNLSGSISPSLTLSNSLERLNLSHNVLSGSIPTSFVNMNS  150

Query  544  LQFLDLSGNSLSGPVSDSMLENLGSLR  624
            ++FLDLS NS SGP+ +S  E+  SL 
Sbjct  151  IKFLDLSENSFSGPMPESFFESCSSLH  177



>ref|XP_007139297.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris]
 gb|ESW11291.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris]
Length=1018

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +1

Query  187  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  366
            QLNDDVLGLIVFKS +QDP+SHLA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLSG
Sbjct  43   QLNDDVLGLIVFKSDLQDPSSHLASWNEDDVNPCSWQFVQCNPESGRVSEVSLDGLGLSG  102

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  546
            KIGRGLEKL+HL VLSL+ NN SG ISP L L   LQ LNLS N++SG++P S  NM+S+
Sbjct  103  KIGRGLEKLQHLTVLSLSHNNLSGGISPSLTLSNTLQRLNLSHNALSGSIPTSFVNMNSI  162

Query  547  QFLDLSGNSLSGPVSDSMLENLGSL  621
            +FLDLS NS SG + ++  +   SL
Sbjct  163  KFLDLSENSFSGSIPETFFDTCSSL  187



>gb|EYU32740.1| hypothetical protein MIMGU_mgv1a000860mg [Erythranthe guttata]
Length=957

 Score =   176 bits (447),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 121/158 (77%), Gaps = 2/158 (1%)
 Frame = +1

Query  157  TSGAGGAES-LQLNDDVLGLIVFKSGVQ-DPASHLATWSEDDDSPCAWNFVKCHPANGRV  330
            T  AGGA + LQLNDDVLGLIVFKSG   DP   L +W+EDDDSPCAW FVKC+  N RV
Sbjct  19   TFPAGGATTTLQLNDDVLGLIVFKSGFHSDPLKSLDSWNEDDDSPCAWRFVKCNAGNSRV  78

Query  331  SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  510
            SEV L GL LSGKIGRGLEKL+ L VLSL++NN +G ++P L L+ NL+ LNLS+NS+SG
Sbjct  79   SEVSLDGLSLSGKIGRGLEKLQSLKVLSLSNNNLTGAVNPGLALIPNLERLNLSRNSLSG  138

Query  511  TVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
             VP S  + SSLQFLDLS N LSGP+ D++ +N  SLR
Sbjct  139  DVPSSFSDASSLQFLDLSQNLLSGPLPDNIFQNCSSLR  176


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 55/95 (58%), Gaps = 4/95 (4%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASN----NFSGVISPqlglltnlqtlnlSK  495
            +S +D      +G I   L+KL  LN L+L+ N    +F   I  Q       + ++ S 
Sbjct  225  LSRIDFSNNLFTGTIPASLQKLNSLNFLNLSFNFLTGDFPQWIGSQTTTAAAFEYIDFSN  284

Query  496  NSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSM  600
            N+++GT+P ++G++ SL+FL LS N LSGP+ +S+
Sbjct  285  NALTGTLPATIGDLKSLKFLSLSENKLSGPLPNSL  319



>gb|KHG00472.1| hypothetical protein F383_20103 [Gossypium arboreum]
Length=989

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +1

Query  163  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  342
            G   + S+QLNDDVLGLIVFKS ++DP+S+L +W+EDD+SPC+W F+KC+P NGRVSEV 
Sbjct  29   GDDESSSVQLNDDVLGLIVFKSDIKDPSSYLESWNEDDNSPCSWRFIKCNPNNGRVSEVS  88

Query  343  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  522
            L GLGLSGKIG+GL+KL +L VLSL+ N+FSG I    G+L +L+ L+LS N++SG++P 
Sbjct  89   LDGLGLSGKIGKGLQKLMYLKVLSLSRNDFSGTIGRAFGVLNSLERLDLSYNNLSGSIPS  148

Query  523  SLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            +  NM+S++FLDLSGNSLSG + + + +   SLR
Sbjct  149  TFVNMNSIRFLDLSGNSLSGSIPEELFQTCSSLR  182



>ref|XP_008337525.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=1009

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = +1

Query  187  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  366
            QLN+DVLGL+VFKS + DP+S+LA+W+ED++SPC+W +V+C+PA GRVS++ L GLGL G
Sbjct  32   QLNNDVLGLLVFKSDIHDPSSYLASWNEDENSPCSWEYVQCNPATGRVSQLSLEGLGLKG  91

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlgll-tnlqtlnlSKNSISGTVPDSLGNMSS  543
            KIG+GL+ L++L VLSL+SNNFSG ISP+   L  NL+ LNLS NS+SG +P +L NMSS
Sbjct  92   KIGKGLQNLQNLKVLSLSSNNFSGDISPEKLALPPNLEKLNLSHNSLSGLIPTNLFNMSS  151

Query  544  LQFLDLSGNSLSGPVSDSMLENLGSLR  624
            ++FLDLS NSLSGP+ D++ +N  SLR
Sbjct  152  IKFLDLSENSLSGPLPDNLFDNCFSLR  178



>ref|XP_011000023.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=1006

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 137/175 (78%), Gaps = 2/175 (1%)
 Frame = +1

Query  106  MGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDDD  279
            MGF  +LL   +S ++   G  G++S  +Q+NDDVLGLIVFKS ++DP+S+L++W+EDDD
Sbjct  1    MGFSHLLLYFLVSSVASLRGCTGSDSVPIQINDDVLGLIVFKSDLRDPSSYLSSWNEDDD  60

Query  280  SPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlg  459
            SPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+H+  LSL+ NNFSG  S + G
Sbjct  61   SPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHVKTLSLSHNNFSGDFSLEFG  120

Query  460  lltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            L+++L++LNLS NS+SG +P  L NMSS++FLDLS NS SGP+ D +  N  SLR
Sbjct  121  LISSLESLNLSHNSLSGLIPSFLDNMSSIKFLDLSENSFSGPLPDDLFRNSFSLR  175


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 60/99 (61%), Gaps = 1/99 (1%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  507
            + E+ L G   SG +   +    HLN L  +SN FSG +   L  L+++   + SKN ++
Sbjct  248  LKELQLQGNRFSGPLPVDIGLCPHLNRLDFSSNLFSGALPESLQRLSSINYFSSSKNMLT  307

Query  508  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            G  P  +G++S+L++LDLS N+L+G +S S + +L SLR
Sbjct  308  GEFPRWIGSLSNLEYLDLSSNALTGSISSS-IGDLKSLR  345



>ref|XP_003621730.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Medicago truncatula]
 gb|AES77948.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1016

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 116/156 (74%), Gaps = 0/156 (0%)
 Frame = +1

Query  157  TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  336
            T  A    ++QLNDDVLGLIVFKS +QDP+S+L++W+EDD +PC+W +VKC+P   RVSE
Sbjct  52   TCFANNDVTIQLNDDVLGLIVFKSDLQDPSSYLSSWNEDDINPCSWQYVKCNPQTQRVSE  111

Query  337  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  516
            + L GLGLSGK+GR LEKL+HL  LSL+ NNFSG ISP L L   LQ LNLS NS SG +
Sbjct  112  LSLDGLGLSGKLGRSLEKLQHLVTLSLSHNNFSGTISPSLTLSNTLQKLNLSHNSFSGPL  171

Query  517  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            P S  NMSS++F+DLS NS +G + D   EN  SLR
Sbjct  172  PLSFVNMSSIRFIDLSHNSFAGQMPDGFFENCFSLR  207



>ref|XP_011042759.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
 ref|XP_011042760.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=1012

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = +1

Query  103  IMGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDD  276
            +MG+  +LL + +SV+    G  G++S  +Q+NDDV GLIVFK+ + DP S+L++W+EDD
Sbjct  6    VMGYSHLLLYLLVSVVVSLKGCMGSDSGPIQMNDDVFGLIVFKADLIDPFSYLSSWNEDD  65

Query  277  DSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPql  456
            DSPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+HL  LSL+ NNFSG IS +L
Sbjct  66   DSPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHLKTLSLSQNNFSGGISHEL  125

Query  457  glltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            G L+NL+ LNLS NSISG +P  L NMSS++FLDLS NS SGP+ D++  N  SLR
Sbjct  126  GFLSNLERLNLSHNSISGLIPSFLDNMSSIKFLDLSENSFSGPLPDNLFRNSQSLR  181


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 61/99 (62%), Gaps = 1/99 (1%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  507
            + E+ L G   SG +   +    HLN L L+ N FSGV+   L  L+++   +LSKN ++
Sbjct  254  LKELQLQGNRFSGPLPGDIGLCPHLNRLDLSRNLFSGVLPESLRRLSSMSFFSLSKNMLA  313

Query  508  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            G  P  +G++++L++LDLS N+L+G +  S + +L SLR
Sbjct  314  GEFPRWIGSLTNLEYLDLSSNALTGSIPSS-IGDLKSLR  351



>ref|XP_009371148.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=1009

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = +1

Query  187  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  366
            QLN DVLGL+VFKS + DP+S+LA+W+ED++SPC+W +V+C+PA GRVS++ L GLGL G
Sbjct  32   QLNSDVLGLLVFKSDIHDPSSYLASWNEDENSPCSWEYVQCNPATGRVSQLSLEGLGLRG  91

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlgll-tnlqtlnlSKNSISGTVPDSLGNMSS  543
            KIG+GL+ L++L VLSL+SNNFSG ISP+   L +NL+ LNLS NS+SG +P +L NMSS
Sbjct  92   KIGKGLQNLQNLKVLSLSSNNFSGDISPEKLALPSNLEKLNLSHNSLSGIIPTNLFNMSS  151

Query  544  LQFLDLSGNSLSGPVSDSMLENLGSLR  624
            ++FLDLS NSLSGP+ D++ +N  SLR
Sbjct  152  IKFLDLSENSLSGPLPDNLFDNCFSLR  178



>ref|XP_002302895.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE82168.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1012

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 138/176 (78%), Gaps = 2/176 (1%)
 Frame = +1

Query  103  IMGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDD  276
            +MG+  +LL + +S++    G  G++S  +Q+NDDV GLIVFK+ + DP+S+L++W+EDD
Sbjct  6    VMGYSHLLLYLLVSIVVSLEGCMGSDSVPIQINDDVFGLIVFKADLIDPSSYLSSWNEDD  65

Query  277  DSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPql  456
            DSPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+HL  LSL+ NNFSG IS +L
Sbjct  66   DSPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHLKTLSLSQNNFSGGISLEL  125

Query  457  glltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            G L+NL+ LNLS NS+SG +P  L NMSS++FLDLS NS SGP+ D++  N  SLR
Sbjct  126  GFLSNLERLNLSHNSLSGLIPSFLDNMSSIKFLDLSENSFSGPLPDNLFRNSHSLR  181



>ref|XP_002321093.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE99408.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1006

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +1

Query  106  MGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDDD  279
            MGF  +LL   +S ++   G  G++S  +Q+NDDVLGLIVFKS + DP+S+L++W+EDDD
Sbjct  1    MGFSHLLLYFLVSSVASLRGCTGSDSVPIQINDDVLGLIVFKSDLSDPSSYLSSWNEDDD  60

Query  280  SPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlg  459
            SPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+H+  LSL+ NNFSG  S + G
Sbjct  61   SPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHVKTLSLSHNNFSGDFSLEFG  120

Query  460  lltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            L+++L++LNLS NS+SG +P  L NMSSL+FLDLS NS +GP+ D +  N  SLR
Sbjct  121  LISSLESLNLSHNSLSGLIPSFLDNMSSLKFLDLSENSFTGPLPDDLFRNSFSLR  175


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 62/99 (63%), Gaps = 1/99 (1%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  507
            + E+ L G   SG +   +    HLN L L+SN FSG +   L  L+++   +LSKN ++
Sbjct  248  LKELHLQGNRFSGPLPVDIGLCRHLNRLDLSSNLFSGALPESLQGLSSINYFSLSKNMLT  307

Query  508  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            G  P  +G++S+L++LDLS N+L+G +S S + +L SLR
Sbjct  308  GEFPRWIGSLSNLEYLDLSSNALTGSISSS-IGDLKSLR  345



>ref|XP_010514517.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = +1

Query  169  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  348
            G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  349  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  528
            GL L+GKIGRG++KL+HL VLSL++NNF+G I+  L    NL+ L+LS N++SG +P SL
Sbjct  87   GLALTGKIGRGIQKLQHLKVLSLSNNNFTGNIN-ALSTNNNLRKLDLSHNNLSGQIPSSL  145

Query  529  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            G++SSLQ LDL+GNS SG +SD    N  SLR
Sbjct  146  GSISSLQHLDLTGNSFSGTLSDDFFNNCSSLR  177



>gb|KFK33718.1| hypothetical protein AALP_AA5G051000 [Arabis alpina]
Length=1018

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 121/148 (82%), Gaps = 2/148 (1%)
 Frame = +1

Query  181  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  360
            S+QLNDDVLGLIVFKS +QDP+SHL++W+EDD+SPC+W++VKC+P   RV+E+ L+GL L
Sbjct  30   SIQLNDDVLGLIVFKSDLQDPSSHLSSWNEDDNSPCSWSYVKCNPKTSRVTELSLNGLSL  89

Query  361  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  540
            +GKIGRG++KL+HL VLSL++NNF+G I   L    NL+ L+LS N++SG++P S G++S
Sbjct  90   TGKIGRGIQKLQHLKVLSLSNNNFTGNII-ALSKNNNLKKLDLSNNNLSGSIP-SFGSIS  147

Query  541  SLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            SLQ+LDL+GNS SG +SD    N  SLR
Sbjct  148  SLQYLDLTGNSFSGTLSDEFFNNCSSLR  175



>ref|XP_010023583.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW59891.1| hypothetical protein EUGRSUZ_H02618 [Eucalyptus grandis]
Length=1012

 Score =   168 bits (425),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = +1

Query  169  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  348
            G   S QLNDDVLGLIVFKS + DP+S L +WSEDD SPC+W +V+C P  GRV++V L 
Sbjct  32   GDDVSAQLNDDVLGLIVFKSDLTDPSSSLVSWSEDDASPCSWRYVQCDPLTGRVAQVSLD  91

Query  349  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  528
            GLGLSGKIGRGLEKL+ L VLSL+ NNF+G ISPQL L + LQ LNLS+N +SG  P SL
Sbjct  92   GLGLSGKIGRGLEKLDRLKVLSLSRNNFTGSISPQLSLPSGLQRLNLSRNGLSGPFPTSL  151

Query  529  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSL  621
             N+SS++FLDLS NS SGP+ D +  +  SL
Sbjct  152  VNVSSIRFLDLSENSFSGPLPDGLFGSCSSL  182



>ref|XP_010107246.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXC14270.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=1023

 Score =   168 bits (425),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 116/149 (78%), Gaps = 2/149 (1%)
 Frame = +1

Query  181  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  360
            ++QLNDDVLGLIVFKS +QDP+SHL++W+EDDD+PC+W FV+C+P   RVSE+ L  LGL
Sbjct  34   AVQLNDDVLGLIVFKSDIQDPSSHLSSWNEDDDTPCSWKFVRCNPVTNRVSEISLDNLGL  93

Query  361  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlgl--ltnlqtlnlSKNSISGTVPDSLGN  534
            SG+IG+GLEKL+HL  LSL+ NNFSG ++P+       +L+ LNLS+N +SG +P SL  
Sbjct  94   SGRIGKGLEKLQHLKALSLSGNNFSGDVTPEKLALPTNSLEILNLSRNRLSGRIPSSLVK  153

Query  535  MSSLQFLDLSGNSLSGPVSDSMLENLGSL  621
            MS ++ LDLS N LSGPV D++ ++  SL
Sbjct  154  MSLIRVLDLSENLLSGPVPDNLFDSCFSL  182



>ref|XP_010425587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   167 bits (424),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = +1

Query  169  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  348
            G  +++QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDTIQLNDDVLGLIVFKSDLDDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  349  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  528
            GL L+GKIGRG++KL+HL VLSL++NNF+G ++  L    NL+ L+LS N++SG +P SL
Sbjct  87   GLALTGKIGRGIQKLQHLKVLSLSNNNFTGNLN-ALSTNNNLRKLDLSHNNLSGQIPSSL  145

Query  529  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            G++SSLQ LDL+GNS +G +SD    N  SLR
Sbjct  146  GSISSLQHLDLTGNSFTGTLSDDFFNNCSSLR  177



>ref|XP_006494521.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=1003

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 120/151 (79%), Gaps = 3/151 (2%)
 Frame = +1

Query  181  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  360
            S++LNDD+LGLIVFKS ++DP+S+L +W EDD+SPC+W F++C+P NGRVS V L GLGL
Sbjct  40   SIELNDDILGLIVFKSELKDPSSNLQSWKEDDNSPCSWKFIQCNPVNGRVSHVSLDGLGL  99

Query  361  SGKIG-RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL--G  531
            SGKIG RGL KL+HL VLSL+ N+F+G I+P+LGL+ +L+ LN S NS+SG +P SL   
Sbjct  100  SGKIGTRGLRKLQHLKVLSLSHNDFTGNINPELGLIASLERLNFSHNSLSGQIPPSLLNL  159

Query  532  NMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            NM +++FLDLS N LSGPV   + EN  SLR
Sbjct  160  NMMNMKFLDLSNNLLSGPVPYQLFENCASLR  190



>ref|XP_006421080.1| hypothetical protein CICLE_v10004238mg [Citrus clementina]
 gb|ESR34320.1| hypothetical protein CICLE_v10004238mg [Citrus clementina]
Length=1003

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 120/151 (79%), Gaps = 3/151 (2%)
 Frame = +1

Query  181  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  360
            S++LNDD+LGLIVFKS ++DP+S+L +W EDD+SPC+W F++C+P NGRVS V L GLGL
Sbjct  40   SIELNDDILGLIVFKSELKDPSSNLQSWKEDDNSPCSWKFIQCNPINGRVSHVSLDGLGL  99

Query  361  SGKIG-RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL--G  531
            SGKIG RGL KL+HL VLSL+ N+F+G I+P+LGL+ +L+ LN S NS+SG +P SL   
Sbjct  100  SGKIGTRGLRKLQHLKVLSLSHNDFTGNINPELGLIASLERLNFSHNSLSGQIPPSLLNL  159

Query  532  NMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            NM +++FLDLS N LSGPV   + EN  SLR
Sbjct  160  NMMNMKFLDLSNNLLSGPVPYQLFENCASLR  190



>ref|XP_006290541.1| hypothetical protein CARUB_v10016623mg [Capsella rubella]
 gb|EOA23439.1| hypothetical protein CARUB_v10016623mg [Capsella rubella]
Length=1017

 Score =   165 bits (417),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  169  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  348
            G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  349  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  528
            GL L+GKI RG++KL+HL VLSL++NNF+G I+  L    NL+ L+LS N++SG +  SL
Sbjct  87   GLALTGKINRGIQKLQHLKVLSLSNNNFTGNIN-ALSTNNNLRKLDLSHNNLSGQILSSL  145

Query  529  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            G+M+SLQ LDL+GNS SG +SD    N  SLR
Sbjct  146  GSMTSLQHLDLTGNSFSGTLSDDFFNNCSSLR  177



>ref|XP_002875419.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51678.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. 
lyrata]
Length=1014

 Score =   164 bits (416),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 117/149 (79%), Gaps = 1/149 (1%)
 Frame = +1

Query  178  ESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLG  357
            +S+QLNDDVLGLIVFKS + DP SHL +W+EDD++PC+W++VKC+P   RV+E+ L+GL 
Sbjct  29   DSIQLNDDVLGLIVFKSDLNDPFSHLQSWNEDDNTPCSWSYVKCNPKTSRVTELSLNGLA  88

Query  358  LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  537
            L+GKI RG++KL+ L VLSL++NNF+G I+  L    NLQ L+LS N++SG +P SLG++
Sbjct  89   LTGKINRGIQKLQRLKVLSLSNNNFTGNIN-ALSTNNNLQKLDLSHNNLSGQIPSSLGSI  147

Query  538  SSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            SSLQ LDL+GNS SG +SD    N  SLR
Sbjct  148  SSLQHLDLTGNSFSGTLSDDFFNNCSSLR  176



>ref|NP_189443.2| probably inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
 sp|Q9LRT1.1|Y3804_ARATH RecName: Full=Probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01126.1| receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59324.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE77394.1| probably inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
Length=1016

 Score =   164 bits (416),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = +1

Query  169  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  348
            G  +S+QLNDDVLGLIVFKS + DP SHL +W+EDD++PC+W++VKC+P   RV E+ L 
Sbjct  26   GDTDSIQLNDDVLGLIVFKSDLNDPFSHLESWTEDDNTPCSWSYVKCNPKTSRVIELSLD  85

Query  349  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  528
            GL L+GKI RG++KL+ L VLSL++NNF+G I+  L    +LQ L+LS N++SG +P SL
Sbjct  86   GLALTGKINRGIQKLQRLKVLSLSNNNFTGNIN-ALSNNNHLQKLDLSHNNLSGQIPSSL  144

Query  529  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            G+++SLQ LDL+GNS SG +SD +  N  SLR
Sbjct  145  GSITSLQHLDLTGNSFSGTLSDDLFNNCSSLR  176



>ref|XP_004296675.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=1006

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = +1

Query  184  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  363
            +QLN DVLGL+VFKS + DP+S+L++W+EDDDSPC+WNF++C+P+ GRVS+++L GLGL 
Sbjct  26   VQLNYDVLGLLVFKSDLHDPSSYLSSWNEDDDSPCSWNFIQCNPSTGRVSQLNLDGLGLK  85

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlgll-tnlqtlnlSKNSISGTVPDSLGNMS  540
            GK G+GL+ L+HL VLSL+ NNF+G +SP+   L  +LQTLNLS+NS SG VP +L N S
Sbjct  86   GKPGKGLQNLQHLKVLSLSGNNFTGELSPEKLALPPSLQTLNLSRNSFSGLVPTTLVNFS  145

Query  541  SLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            S++FLDLS NSLSG + DS+     SLR
Sbjct  146  SIRFLDLSQNSLSGSLPDSLFGACSSLR  173



>emb|CDY20032.1| BnaA09g02190D [Brassica napus]
Length=1014

 Score =   162 bits (409),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 115/151 (76%), Gaps = 4/151 (3%)
 Frame = +1

Query  169  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  348
            G   S+QLNDDVLGLIV KS + DP+SHLA+W+EDD SPC+W++VKC+P   RV+E+ L 
Sbjct  25   GDTNSIQLNDDVLGLIVLKSDLHDPSSHLASWNEDDASPCSWSYVKCNPKTSRVTELSLS  84

Query  349  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  528
            GLGL+GKIGRG++KL+HL  LSL++NNF+G I   L    NLQ L+LS N++SGT+P SL
Sbjct  85   GLGLTGKIGRGIQKLQHLKTLSLSNNNFTGNIM-SLSNNNNLQKLDLSHNNLSGTIPSSL  143

Query  529  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSL  621
            G   S ++LDL+GNS SG +SD +  N  SL
Sbjct  144  G---STKYLDLTGNSFSGTLSDDLFTNCSSL  171



>ref|XP_009111587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=1014

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 116/151 (77%), Gaps = 4/151 (3%)
 Frame = +1

Query  169  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  348
            G   S+QLNDDVLGLIV KS + DP+SHLA+W+EDD SPC+W++VKC+P   RV+E+ L 
Sbjct  25   GDTNSIQLNDDVLGLIVLKSDLHDPSSHLASWNEDDASPCSWSYVKCNPKTSRVTELSLS  84

Query  349  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  528
            GLGL+GKIGRG++KL+HL  LSL++NNF+G I   L    NLQ L+LS N++SGT+P SL
Sbjct  85   GLGLTGKIGRGIQKLQHLKTLSLSNNNFTGNIM-SLSNNNNLQKLDLSHNNLSGTIPSSL  143

Query  529  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSL  621
            G   S+++LDL+GNS SG +S+ +  N  SL
Sbjct  144  G---SIKYLDLTGNSFSGTLSNDLFTNCSSL  171



>ref|XP_010555905.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Tarenaya hassleriana]
Length=1017

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +1

Query  169  GGAESLQL-NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  345
            G   S+QL NDDVLGLIVFK+ ++DP+S+L +W+EDD SPC+W ++KC+P  GR+SEV L
Sbjct  24   GDVGSVQLLNDDVLGLIVFKADIEDPSSNLESWNEDDYSPCSWKYIKCNPVTGRISEVSL  83

Query  346  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  525
             GL LSGKIGRG++KL++L VLSL+ N+F+G + P++GLL+NLQ LNLS+N +SG +P S
Sbjct  84   DGLALSGKIGRGIQKLQYLKVLSLSDNDFTGNVIPEIGLLSNLQNLNLSQNRLSGIIPAS  143

Query  526  LGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            LG++SSL+FLDLS NS SG + D  L N  SLR
Sbjct  144  LGSISSLKFLDLSKNSFSGSLPDDFLTNCSSLR  176



>gb|EPS70115.1| hypothetical protein M569_04636, partial [Genlisea aurea]
Length=976

 Score =   159 bits (402),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 115/146 (79%), Gaps = 3/146 (2%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFKS V D  + LA+W+EDD+SPCAW FV+C P +GRV+ V L G+GLSGK
Sbjct  1    FNDDVLGLIVFKSAVVDARNRLASWNEDDESPCAWRFVECDPGSGRVTAVSLDGVGLSGK  60

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGLEKL++L  LSL+ NNFSG +SP+L LL NLQ LNLS N ++G++P S+  +S LQ
Sbjct  61   IGRGLEKLQYLRTLSLSGNNFSGSVSPELLLLPNLQKLNLSGNGLAGSLPPSV--VSKLQ  118

Query  550  FLDLSGNSLSGPVSD-SMLENLGSLR  624
            FLDLSGN+LSGP+ D + + N  SLR
Sbjct  119  FLDLSGNALSGPLPDTTFVNNCSSLR  144


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +1

Query  322  GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  501
             R+  VDL G  LSG I  G+  +  L  LSL  N FSG +   +G   +L  L+LSKN 
Sbjct  191  ARLRTVDLSGNLLSGSIPGGISVVRSLKQLSLHGNQFSGPLPEDIGFCPHLTHLDLSKNQ  250

Query  502  ISGTVPDSLGNM-SSLQFLDLSGNSLSG  582
             +GT+P+SL N+ ++LQ LDLS N L+G
Sbjct  251  FTGTIPESLQNLTTTLQHLDLSNNFLTG  278


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = +1

Query  337  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  516
            +DLH  G +G I   +     LN+L L  N+ +G I  ++G  ++L  L LS N++SGT+
Sbjct  440  LDLHAGGFTGSIPGDICDSGSLNILQLDGNSLTGAIPDEIGNCSSLHQLGLSNNNLSGTI  499

Query  517  PDSLGNMSSLQFLDLSGNSLSGPVSDSM--LENL  612
            P+SL  +S L+ L+L  N LSG +   +  LENL
Sbjct  500  PESLSRLSKLEVLELEMNQLSGEIPQRLADLENL  533



>ref|XP_006395381.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum]
 gb|ESQ32667.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum]
Length=1018

 Score =   159 bits (401),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  169  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  348
            G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDDDSPC+W++VKC+P   RV+E+ L 
Sbjct  25   GDIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDDSPCSWSYVKCNPKTSRVTELSLD  84

Query  349  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  528
            GL L+GKIGRG++KL+HL VLSL++NNF+G I   L    +LQ L+LS N++SG +P SL
Sbjct  85   GLALTGKIGRGIQKLQHLKVLSLSNNNFTGSII-DLSNNNDLQKLDLSHNNLSGQIPSSL  143

Query  529  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            G+ SSL++LDL+GNS SG +SD    N  SLR
Sbjct  144  GSRSSLRYLDLTGNSFSGRLSDDFFNNCSSLR  175



>ref|XP_009151898.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
 emb|CDX86452.1| BnaA06g31690D [Brassica napus]
Length=1011

 Score =   159 bits (401),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 114/152 (75%), Gaps = 4/152 (3%)
 Frame = +1

Query  169  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  348
            G  +S QLNDDVLGLIVFKS + DP+SHL++W+EDD SPC+W +VKC+P   RV+E+ L 
Sbjct  25   GDLDSTQLNDDVLGLIVFKSDLHDPSSHLSSWNEDDISPCSWTYVKCNPKTSRVTELSLS  84

Query  349  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  528
            GL L+GKIGRG++KL+HL VLSL++NN +G I+  L     LQ L+LS NS+SG +P SL
Sbjct  85   GLSLTGKIGRGIQKLQHLKVLSLSNNNLTGNIA-ALSNNNRLQKLDLSHNSLSGQIPSSL  143

Query  529  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
               +SL+ LDL+GNS SG +SD +  N  SLR
Sbjct  144  ---TSLRHLDLTGNSFSGTLSDDVFTNCSSLR  172



>ref|XP_004492049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=1011

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +1

Query  181  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  360
            ++QLNDDVLGLI+FKS + DP SHL++W+EDD +PC+W ++KC+P N RV EV L GL L
Sbjct  33   AIQLNDDVLGLILFKSDLHDPFSHLSSWNEDDANPCSWQYIKCNPQNTRVIEVSLDGLSL  92

Query  361  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  540
            SGK+GRG EKL+HL  LSL+ NN SG ISP L L   LQ LNLS NS  G +P S  NMS
Sbjct  93   SGKLGRGFEKLQHLVSLSLSHNNLSGNISPFLTLSNTLQKLNLSHNSFHGEIPISFINMS  152

Query  541  SLQFLDLSGNSLSGPVSDSMLEN  609
            S++ LDLS NS +G + ++  EN
Sbjct  153  SIRLLDLSHNSFNGQIHETFFEN  175



>ref|XP_010555906.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Tarenaya hassleriana]
Length=993

 Score =   153 bits (387),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 115/146 (79%), Gaps = 2/146 (1%)
 Frame = +1

Query  169  GGAESLQL-NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  345
            G   S+QL NDDVLGLIVFK+ ++DP+S+L +W+EDD SPC+W ++KC+P  GR+SEV L
Sbjct  24   GDVGSVQLLNDDVLGLIVFKADIEDPSSNLESWNEDDYSPCSWKYIKCNPVTGRISEVSL  83

Query  346  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  525
             GL LSGKIGRG++KL++L VLSL+ N+F+G+I   LG +++L+ L+LSKNS SG++PD 
Sbjct  84   DGLALSGKIGRGIQKLQYLKVLSLSDNDFTGIIPASLGSISSLKFLDLSKNSFSGSLPDD  143

Query  526  -LGNMSSLQFLDLSGNSLSGPVSDSM  600
             L N SSL++L L+ N L GP+  S+
Sbjct  144  FLTNCSSLRYLSLAKNMLDGPIPSSL  169



>gb|KDP37890.1| hypothetical protein JCGZ_05772 [Jatropha curcas]
Length=1001

 Score =   153 bits (386),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 112/155 (72%), Gaps = 2/155 (1%)
 Frame = +1

Query  160  SGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  339
            + A     ++LNDDVLGLIVFK  + DP S L +W+EDDDSPC+W F+ C+P  GRVS V
Sbjct  22   AKANDEVPIKLNDDVLGLIVFKYDLIDPFSSLTSWNEDDDSPCSWKFISCNPVTGRVSHV  81

Query  340  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  519
             L  L LSGK+ +GL+KL+HL VLSL+ NNFSG I     ++  L+ LNLS NS+SG +P
Sbjct  82   LLDNLSLSGKLSKGLQKLQHLEVLSLSYNNFSGEIITDFPVIPTLENLNLSHNSLSGQLP  141

Query  520  DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
             S+  M+S++FLDLS NSLSGP+ D++ +N  SLR
Sbjct  142  LSV--MTSIKFLDLSYNSLSGPLPDNLFQNCLSLR  174



>ref|XP_010502811.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = +1

Query  169  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  348
            G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDSIQLNDDVLGLIVFKSDLDDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  349  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  528
            GL L+GKIGRG++KL+HL VLSL++NNF+G ++  L    NL+ L+LS N++SG +P SL
Sbjct  87   GLALTGKIGRGIQKLQHLKVLSLSNNNFNGNLN-ALSTNNNLRKLDLSHNNLSGQIPSSL  145

Query  529  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            G++SSLQ LDL+GNS SG +SD    N  SLR
Sbjct  146  GSISSLQHLDLTGNSFSGTLSDDFFNNCSSLR  177



>emb|CDY00141.1| BnaC09g01600D [Brassica napus]
Length=1013

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 113/151 (75%), Gaps = 4/151 (3%)
 Frame = +1

Query  169  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  348
            G   S+QLNDDVLGLIV KS + DP+SHLA+W+EDD SPC+W++VKC+P   RV+++ L 
Sbjct  25   GDNNSIQLNDDVLGLIVLKSDLHDPSSHLASWNEDDASPCSWSYVKCNPKTSRVTDLSLS  84

Query  349  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  528
            GLGL+G IGRG++KL+HL  LSL++NNF+G I   L    NLQ L+LS N++SGT+P SL
Sbjct  85   GLGLTGTIGRGIQKLQHLKTLSLSNNNFTGNIM-SLSNNNNLQRLDLSHNNLSGTIPFSL  143

Query  529  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSL  621
            G   S + LDL+GNS SG +S+ +  N  SL
Sbjct  144  G---SAKHLDLTGNSFSGSLSNDLFTNCSSL  171



>ref|XP_008244427.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Prunus mume]
Length=1009

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = +1

Query  187  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  366
            QLN+DVLGL+VFKS + DP+S+LA+W+EDDDSPC+W+FV+C+PA GRVS++ L GLGL G
Sbjct  32   QLNNDVLGLLVFKSDLHDPSSYLASWNEDDDSPCSWDFVQCNPATGRVSQLSLEGLGLLG  91

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlgll-tnlqtlnlSKNSISGTVPDSLGNMSS  543
            +IG+GL+ L+HL VLSL++NNFSG IS +   L  NL++LNLS+NS+SG +P +L NMSS
Sbjct  92   RIGKGLQNLQHLKVLSLSNNNFSGDISTEKLALPPNLESLNLSRNSLSGLLPTALVNMSS  151

Query  544  LQFLDLSGNSLSGPVSDSMLENLGSLR  624
            ++FLDLS NSLSGP+ D++ +N  SLR
Sbjct  152  IKFLDLSENSLSGPLPDNLFDNCFSLR  178



>ref|XP_007225370.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica]
 gb|EMJ26569.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica]
Length=986

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = +1

Query  187  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  366
            QLN+DVLGL+VFKS + DP+S+LA+W+EDDDSPC+W+FV+C+PA GRVS++ L GLGL G
Sbjct  9    QLNNDVLGLLVFKSDLHDPSSYLASWNEDDDSPCSWDFVQCNPATGRVSQLSLEGLGLLG  68

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlgll-tnlqtlnlSKNSISGTVPDSLGNMSS  543
            +IG+GL+ L+HL VLSL++NNFSG IS +   L  NL++LNLS+NS+SG +P +L NMSS
Sbjct  69   RIGKGLQNLQHLKVLSLSNNNFSGDISTEKLALPPNLESLNLSRNSLSGLLPTALVNMSS  128

Query  544  LQFLDLSGNSLSGPVSDSMLENLGSLR  624
            ++FLDLS NSLSGP+ D++ +N  SLR
Sbjct  129  IKFLDLSENSLSGPLPDNLFDNCFSLR  155



>ref|XP_010673272.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 107/145 (74%), Gaps = 2/145 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFKS + DP + L++W+EDD S C+W +++C+P+ GRV  + L GLGLSG+
Sbjct  33   LNDDVLGLIVFKSDLHDPPA-LSSWTEDDGSSCSWKYIQCNPSTGRVIGLSLTGLGLSGR  91

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM-SSL  546
            +G+GL+KL+ L VLSLA NN +G ISP+L  L  L TL+LS N  +G +P S  N+ SSL
Sbjct  92   LGKGLQKLQELKVLSLAKNNLTGEISPELAQLPKLHTLDLSFNKFTGQIPTSFSNLGSSL  151

Query  547  QFLDLSGNSLSGPVSDSMLENLGSL  621
            ++LDL+ N LSGP+ D + +   SL
Sbjct  152  RYLDLTQNVLSGPLPDDIFQTFQSL  176



>gb|KJB67930.1| hypothetical protein B456_010G218400 [Gossypium raimondii]
Length=698

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 100/138 (72%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP   L++W+EDDD+PC W  +KC+P + RV+E++L G  LSG+
Sbjct  38   LNDDVLGLIVFKADIQDPTQKLSSWNEDDDTPCNWKGIKCNPRSNRVTELNLDGFSLSGR  97

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +LE L  LSLA+NN SG ISP +  L +L  ++LS+NS++G++PD       SL
Sbjct  98   IGRGLLQLEFLRKLSLANNNLSGTISPNMVKLESLIAIDLSENSLTGSIPDDFFKQCGSL  157

Query  547  QFLDLSGNSLSGPVSDSM  600
            +++ L+ N  SG +  S+
Sbjct  158  RYISLANNHFSGKIPGSL  175



>gb|KJB67929.1| hypothetical protein B456_010G218400 [Gossypium raimondii]
Length=983

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 100/138 (72%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP   L++W+EDDD+PC W  +KC+P + RV+E++L G  LSG+
Sbjct  40   LNDDVLGLIVFKADIQDPTQKLSSWNEDDDTPCNWKGIKCNPRSNRVTELNLDGFSLSGR  99

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +LE L  LSLA+NN SG ISP +  L +L  ++LS+NS++G++PD       SL
Sbjct  100  IGRGLLQLEFLRKLSLANNNLSGTISPNMVKLESLIAIDLSENSLTGSIPDDFFKQCGSL  159

Query  547  QFLDLSGNSLSGPVSDSM  600
            +++ L+ N  SG +  S+
Sbjct  160  RYISLANNHFSGKIPGSL  177



>gb|KHG03607.1| hypothetical protein F383_26757 [Gossypium arboreum]
Length=987

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ + DP   L++W+EDDD+PC W  +KC+P + RV+E++L G  LSG+
Sbjct  44   LNDDVLGLIVFKADILDPTQKLSSWNEDDDTPCNWKGIKCNPRSNRVTELNLDGFSLSGR  103

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +LE L  LSLA+NN SG ISP +  L +L  ++LS+NS++G++PD       SL
Sbjct  104  IGRGLLQLEFLRKLSLANNNLSGTISPNMVKLESLIAIDLSENSLTGSIPDEFFKQCGSL  163

Query  547  QFLDLSGNSLSGPVSDSM  600
            +++ L+ N  SG +  S+
Sbjct  164  RYISLANNQFSGKIPGSL  181



>ref|XP_009403616.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 105/147 (71%), Gaps = 2/147 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LND+VLGLIVFK+ ++DP + LA+W+EDD +PC+W  V+C PA  RVS + L  L LSG 
Sbjct  30   LNDEVLGLIVFKAALEDPTAALASWNEDDSTPCSWAHVECDPATSRVSRLALDSLSLSGP  89

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            + RGL++L  L  LSL++NN SG I P L LL  L++L+LS+N+ SG +PD L  + S++
Sbjct  90   LPRGLDRLPALVALSLSNNNLSGPIPPGLSLLPALRSLDLSRNAFSGGLPDDLARLPSIR  149

Query  550  FLDLSGNSLSGPVSDSMLEN--LGSLR  624
             LDLS N+LSGP+  S+  N   G+LR
Sbjct  150  SLDLSSNALSGPLLSSIFSNATCGTLR  176



>ref|XP_008350571.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=485

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 99/137 (72%), Gaps = 1/137 (1%)
 Frame = +1

Query  193  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  372
            NDDVLGLIVFK+G+ DP + LA+WSEDD SPC W  VKC P  GRV+EV L G  LSG I
Sbjct  24   NDDVLGLIVFKAGLSDPEAKLASWSEDDGSPCNWAGVKCDPTTGRVAEVVLDGFSLSGHI  83

Query  373  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  549
            GRGL +L++L  LSL+ NNF+G I+P L  L +LQ ++LS+NS+SG++P+       SL 
Sbjct  84   GRGLLRLQNLKKLSLSDNNFTGFINPDLPHLGSLQVIDLSRNSLSGSIPEEFFKQCGSLG  143

Query  550  FLDLSGNSLSGPVSDSM  600
             +  +GN+L+G + +S+
Sbjct  144  VVSFAGNNLTGRIPESL  160



>ref|XP_009372024.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=965

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 100/138 (72%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+ DP + LA+WSEDD SPC W  VKC P  GRV+EV L G  LSG 
Sbjct  23   FNDDVLGLIVFKAGLSDPEAKLASWSEDDGSPCNWAGVKCDPTTGRVAEVVLDGFSLSGH  82

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L++L  LSL+ NNF+G I+P L  L +L+ ++LS+NS+SG++P+       SL
Sbjct  83   IGRGLLRLQNLQKLSLSDNNFTGFINPDLPHLGSLRVIDLSRNSLSGSIPEEFFKQCGSL  142

Query  547  QFLDLSGNSLSGPVSDSM  600
            + +  +GN+L+G + +S+
Sbjct  143  RVVSFAGNNLTGRIPESL  160



>ref|XP_007207150.1| hypothetical protein PRUPE_ppa000904mg [Prunus persica]
 gb|EMJ08349.1| hypothetical protein PRUPE_ppa000904mg [Prunus persica]
Length=965

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 90/145 (62%), Gaps = 24/145 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G++DP + L +WSEDD++PC+W  VKC P   RVSE+ L G  LSG 
Sbjct  23   FNDDVLGLIVFKAGLRDPKAKLTSWSEDDNNPCSWVGVKCDPRTNRVSELVLDGFSLSGH  82

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            +GRGL +L+ L +LSLA+NNF+G I+P                         L ++ SLQ
Sbjct  83   VGRGLLRLQFLQILSLANNNFTGTINP------------------------DLPHLGSLQ  118

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +DLS NSLSGP+ D      GSLR
Sbjct  119  VIDLSQNSLSGPIPDEFFMQCGSLR  143



>ref|XP_008244834.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Prunus mume]
Length=965

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 90/145 (62%), Gaps = 24/145 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G++DP + L +WSEDD++PC+W  VKC P   RVSE+ L G  LSG 
Sbjct  23   FNDDVLGLIVFKAGLRDPKAKLTSWSEDDNNPCSWVGVKCDPRTNRVSELVLDGFSLSGH  82

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            +GRGL +L+ L +LSLA+NNF+G I+P                         L ++ SLQ
Sbjct  83   VGRGLLRLQFLQILSLANNNFTGTINP------------------------DLPHLGSLQ  118

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +DLS NSLSGP+ D      GSLR
Sbjct  119  VIDLSQNSLSGPIPDEFFMQCGSLR  143



>ref|XP_002275275.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=969

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 98/138 (71%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP S LA+W+EDDDSPC W  VKC+P + RV+++ L G  LSGK
Sbjct  26   LNDDVLGLIVFKADIQDPNSKLASWNEDDDSPCNWVGVKCNPRSNRVTDLVLDGFSLSGK  85

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L  LSLA NN +G I P L  L NL+ ++LS+NS+SGT+PD       SL
Sbjct  86   IGRGLLQLQFLRKLSLAKNNITGSIGPNLARLQNLRFIDLSENSLSGTIPDDFFKQCGSL  145

Query  547  QFLDLSGNSLSGPVSDSM  600
              + L+ N  SG + +S+
Sbjct  146  HAISLAKNKFSGKIPESV  163



>ref|XP_010931370.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=968

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +1

Query  175  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  354
            A S  LNDDVLGLIVFK+ +QDPAS LA+W+EDDD PC W  VKC P   RV+E++L G 
Sbjct  19   ATSGALNDDVLGLIVFKADLQDPASKLASWNEDDDDPCGWTGVKCSPRTNRVTELNLDGF  78

Query  355  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LG  531
             LSGKIGRGL +L+ L  LSL+ NNFSG ++P L  L +L +++LS+N +SG++PD    
Sbjct  79   SLSGKIGRGLLQLQSLRKLSLSRNNFSGSLNPNLSHLESLWSVDLSENHLSGSIPDEFFR  138

Query  532  NMSSLQFLDLSGNSLSGPV  588
               SL+ + L+ N  SG +
Sbjct  139  QCRSLRSVSLANNDFSGEI  157



>ref|XP_011002596.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 89/145 (61%), Gaps = 24/145 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            +NDDVLGLIVFK+G+QDP S L++W+EDDDSPC W  VKC P   RV+E+ L G  LSG 
Sbjct  23   INDDVLGLIVFKAGLQDPESKLSSWNEDDDSPCNWVGVKCDPNTHRVTELVLDGFSLSGH  82

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +L+ L VLSLA+NNF+G I+P                         L  +  LQ
Sbjct  83   IGRGLLRLQFLQVLSLANNNFNGTINP------------------------DLPRLGGLQ  118

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +DLS NSLSG + D   +  GSLR
Sbjct  119  VIDLSENSLSGSIPDGFFQQCGSLR  143



>ref|XP_007220278.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica]
 gb|EMJ21477.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica]
Length=969

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP   LATWSEDDDSPC W+ VKCHP + RV E+ L    LSG 
Sbjct  25   LNDDVLGLIVFKADIQDPKGKLATWSEDDDSPCKWDGVKCHPRSNRVIELSLDDFSLSGH  84

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  546
            IGRGL +L+ L  LSL+ NN +G ++P +  + NL+ L+LS+NS SG VP D      SL
Sbjct  85   IGRGLLQLQSLRKLSLSKNNLTGSLTPNIAHIDNLRALDLSENSFSGPVPEDFFRQCGSL  144

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N +SG + +S+
Sbjct  145  RTISLAKNKISGKIPESL  162



>gb|KHG09451.1| hypothetical protein F383_09289 [Gossypium arboreum]
Length=975

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP+  L++W+EDDD+PC W  VKC+P + RV+E++L G  LSG+
Sbjct  31   LNDDVLGLIVFKADIQDPSQKLSSWNEDDDTPCNWFGVKCNPRSSRVTELNLDGFTLSGR  90

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L  LSLA NN SG ISP L  L +L+ ++LS+NS+SG +PD       SL
Sbjct  91   IGRGLLQLKFLRKLSLARNNLSGTISPNLAKLESLRIIDLSENSLSGFIPDDFFKQCGSL  150

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N  SG +  S+
Sbjct  151  RSISLANNRFSGKIPGSL  168



>ref|XP_003521989.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=970

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 98/140 (70%), Gaps = 1/140 (1%)
 Frame = +1

Query  184  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  363
            L  NDDVLGLI+FK+G+QDP   L+TW+EDD SPC W  VKC PAN RVS + L G  LS
Sbjct  28   LSFNDDVLGLIMFKAGLQDPKGKLSTWNEDDYSPCHWVGVKCDPANNRVSSLVLDGFSLS  87

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS-  540
            G I RGL +L+ L +LSL+ NNF+G I+P L  + +L  ++LS+N++SG +PD +     
Sbjct  88   GHIDRGLLRLQFLQILSLSRNNFTGTIAPDLLTIGDLLVVDLSENNLSGPIPDGIFQQCW  147

Query  541  SLQFLDLSGNSLSGPVSDSM  600
            SL+ +  + N+L+G V DS+
Sbjct  148  SLRVVSFANNNLTGKVPDSL  167



>ref|XP_008233886.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Prunus mume]
Length=975

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP   LATWSEDDDSPC W+ VKCHP + RV E+ L    LSG 
Sbjct  31   LNDDVLGLIVFKADIQDPKGKLATWSEDDDSPCKWDGVKCHPRSNRVIELSLDDFSLSGH  90

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  546
            +GRGL +L+ L  LSL+ NN +G ++P +  + NL+ L+LS+NS SG VP D      SL
Sbjct  91   VGRGLLQLQSLRKLSLSKNNLTGSLTPNIAHIDNLRALDLSENSFSGPVPEDFFRQCGSL  150

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N +SG + +S+
Sbjct  151  RTISLAKNKISGKIPESL  168



>ref|XP_006486161.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=975

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 91/145 (63%), Gaps = 24/145 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP   L++WSEDDD+PC W  VKC P + RV E+ L+GL L+G+
Sbjct  32   LNDDVLGLIVFKADIQDPNGKLSSWSEDDDTPCNWFGVKCSPRSNRVIELTLNGLSLTGR  91

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +L+ L  LSL+SNN +G ISP                        +L  + +L+
Sbjct  92   IGRGLLQLQFLRKLSLSSNNLTGSISP------------------------NLAKLQNLR  127

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +DLSGNSLSG + D   +  GSLR
Sbjct  128  VIDLSGNSLSGSIPDEFFKQCGSLR  152



>ref|XP_006435929.1| hypothetical protein CICLE_v10030625mg [Citrus clementina]
 gb|ESR49169.1| hypothetical protein CICLE_v10030625mg [Citrus clementina]
Length=997

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 91/145 (63%), Gaps = 24/145 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP   L++WSEDDD+PC W  VKC P + RV E+ L+GL L+G+
Sbjct  54   LNDDVLGLIVFKADIQDPNGKLSSWSEDDDTPCNWFGVKCSPRSNRVIELTLNGLSLTGR  113

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +L+ L  LSL+SNN +G ISP                        +L  + +L+
Sbjct  114  IGRGLLQLQFLRKLSLSSNNLTGSISP------------------------NLAKLQNLR  149

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +DLSGNSLSG + D   +  GSLR
Sbjct  150  VIDLSGNSLSGSIPDEFFKQCGSLR  174



>gb|KDO67528.1| hypothetical protein CISIN_1g002321mg [Citrus sinensis]
Length=936

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 91/145 (63%), Gaps = 24/145 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP   L++WSEDDD+PC W  VKC P + RV E+ L+GL L+G+
Sbjct  32   LNDDVLGLIVFKADIQDPNGKLSSWSEDDDTPCNWFGVKCSPRSNRVIELTLNGLSLTGR  91

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +L+ L  LSL+SNN +G ISP                        +L  + +L+
Sbjct  92   IGRGLLQLQFLRKLSLSSNNLTGSISP------------------------NLAKLQNLR  127

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +DLSGNSLSG + D   +  GSLR
Sbjct  128  VIDLSGNSLSGSIPDEFFKQCGSLR  152



>ref|XP_004137674.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 ref|XP_004160330.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN58686.1| hypothetical protein Csa_3G728030 [Cucumis sativus]
Length=959

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 90/145 (62%), Gaps = 24/145 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+QDP   L TW+EDD++PC W  VKC+P   RVSE+ L G  LSG 
Sbjct  23   FNDDVLGLIVFKAGLQDPMGKLVTWNEDDETPCNWFGVKCNPKTNRVSELVLDGFSLSGH  82

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +L+ L +LSLA+NNF                        +GT+  +L ++ +LQ
Sbjct  83   IGRGLLRLQFLQILSLANNNF------------------------TGTINSALSHLGNLQ  118

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +DLS NSLSGP+ + +    GS+R
Sbjct  119  VIDLSDNSLSGPIPEQLFLQCGSIR  143



>gb|KJB73018.1| hypothetical protein B456_011G209800 [Gossypium raimondii]
Length=975

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP+  L++W+EDDD+PC W  VKC+P + RV+E++L G  LSG+
Sbjct  31   LNDDVLGLIVFKADIQDPSQKLSSWNEDDDTPCNWFGVKCNPRSSRVTELNLDGFTLSGR  90

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L  LSLA NN SG ISP L  L +L+ ++LS+NS+SG +PD       SL
Sbjct  91   IGRGLLQLKFLRKLSLARNNLSGTISPNLAKLESLRIIDLSENSLSGFIPDDFFKQCGSL  150

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N  SG +  S+
Sbjct  151  RSISLANNRFSGKIPVSL  168



>ref|XP_009416321.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=969

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLI FK+G++DP S LA+W+E+D+ PC W+ +KC P + RV+ V L G  LSGK
Sbjct  26   LNDDVLGLIAFKAGIEDPRSKLASWNENDNDPCNWDGIKCDPKSNRVAVVALDGFALSGK  85

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            +GRGL +L+ L+ LSL+ NNFSG ++P    L +L+TL+LS N++SGT+PD   G   S+
Sbjct  86   LGRGLLRLQFLDTLSLSVNNFSGSVTPAFLRLESLRTLDLSANNLSGTIPDGFFGQCRSI  145

Query  547  QFLDLSGNSLSGPV  588
            + + L+ NS+SG +
Sbjct  146  RDISLAKNSISGKI  159



>ref|XP_002323672.2| hypothetical protein POPTR_0016s14410g [Populus trichocarpa]
 gb|EEF05433.2| hypothetical protein POPTR_0016s14410g [Populus trichocarpa]
Length=965

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 88/145 (61%), Gaps = 24/145 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            +NDDVLGLIVFK+G+QDP S L++W+EDDDSPC W  VKC P   RV+E+ L G  LSG 
Sbjct  23   INDDVLGLIVFKAGLQDPESKLSSWNEDDDSPCNWVGVKCDPNTHRVTELVLDGFSLSGH  82

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +L+ L VLSLA+NNF+G I+P                         L  +  LQ
Sbjct  83   IGRGLLRLQFLQVLSLANNNFNGTINP------------------------DLPRLGGLQ  118

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +DLS N LSG + D   +  GSLR
Sbjct  119  VIDLSENGLSGSIPDGFFQQCGSLR  143



>ref|XP_002309183.1| hypothetical protein POPTR_0006s10910g [Populus trichocarpa]
 gb|EEE92706.1| hypothetical protein POPTR_0006s10910g [Populus trichocarpa]
Length=965

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 88/145 (61%), Gaps = 24/145 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+QDP S L++W+EDDDSPC+W  VKC P   RV+E+ L G  LSG 
Sbjct  24   FNDDVLGLIVFKAGLQDPESKLSSWNEDDDSPCSWVGVKCEPNTHRVTELFLDGFSLSGH  83

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +L+ L VLSLA+N F+G I+P                         L  +  LQ
Sbjct  84   IGRGLLRLQFLQVLSLANNKFNGTINP------------------------DLPRLGGLQ  119

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +DLS NSLSG + D   +  GSLR
Sbjct  120  VIDLSDNSLSGSIPDGFFQQCGSLR  144



>ref|XP_011019006.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 89/145 (61%), Gaps = 24/145 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGL+VFK+G+QDP S L++W+EDDDSPC+W  VKC P   RV+E+ L G  LSG 
Sbjct  24   LNDDVLGLMVFKAGLQDPESKLSSWNEDDDSPCSWVGVKCEPNTHRVTELFLDGFSLSGH  83

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +L+ L VLSLA+N F+G ++P                         L  +  LQ
Sbjct  84   IGRGLLRLQFLQVLSLANNKFNGTVNP------------------------DLPRLGGLQ  119

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +DLS NSLSG + D   +  GSLR
Sbjct  120  VIDLSDNSLSGSIPDGFFQQCGSLR  144



>ref|XP_011019007.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 89/145 (61%), Gaps = 24/145 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGL+VFK+G+QDP S L++W+EDDDSPC+W  VKC P   RV+E+ L G  LSG 
Sbjct  24   LNDDVLGLMVFKAGLQDPESKLSSWNEDDDSPCSWVGVKCEPNTHRVTELFLDGFSLSGH  83

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +L+ L VLSLA+N F+G ++P                         L  +  LQ
Sbjct  84   IGRGLLRLQFLQVLSLANNKFNGTVNP------------------------DLPRLGGLQ  119

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +DLS NSLSG + D   +  GSLR
Sbjct  120  VIDLSDNSLSGSIPDGFFQQCGSLR  144



>ref|XP_010929848.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=1011

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 100/145 (69%), Gaps = 0/145 (0%)
 Frame = +1

Query  166  AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  345
            A G     LND+VLGLIVFKS ++DP + LA+WSE D +PC W  V+C PA   V  + L
Sbjct  27   ADGDLPTPLNDEVLGLIVFKSALEDPTAALASWSETDANPCGWAHVECDPATSHVLRLYL  86

Query  346  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  525
              L LSG + RGL++L +L  LS+++NN SG++   L LL  L +L+LS+N+ SG +P  
Sbjct  87   DSLSLSGPLPRGLDRLPYLETLSISNNNLSGLLPAGLSLLPRLHSLDLSRNAFSGRLPQD  146

Query  526  LGNMSSLQFLDLSGNSLSGPVSDSM  600
            LGN+ SL+ +DLS NSLSGP+ DS+
Sbjct  147  LGNIPSLRSVDLSSNSLSGPIPDSL  171



>ref|XP_008442319.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=958

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 90/143 (63%), Gaps = 24/143 (17%)
 Frame = +1

Query  196  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  375
            DDVLGLIVFK+G+QDP   L TW+EDD++PC W  VKC+P   RVSE+ L G  LSG IG
Sbjct  25   DDVLGLIVFKAGLQDPMGKLVTWNEDDETPCNWFGVKCNPKTNRVSELVLDGFSLSGHIG  84

Query  376  RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFL  555
            RGL +L+ L +LSLA+NNF                        +GT+  +L ++ +LQ +
Sbjct  85   RGLLRLQFLQILSLANNNF------------------------TGTINSALSHLGNLQVI  120

Query  556  DLSGNSLSGPVSDSMLENLGSLR  624
            DLS N+LSGP+ + + +  GS+R
Sbjct  121  DLSDNNLSGPIPEQLFQQCGSIR  143



>ref|XP_002267737.3| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=993

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+QDP S L +W+EDD++PC W  VKC     RVSE+ L    LSG+
Sbjct  50   FNDDVLGLIVFKAGLQDPESKLISWNEDDNNPCNWAGVKCDRQTNRVSELLLDNFSLSGR  109

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L +LSL+ NNF+G I+P L  + +L+ ++LS+N++SG +PD       SL
Sbjct  110  IGRGLLRLQFLRILSLSKNNFTGTINPSLARIASLRVIDLSENNLSGPIPDEFFRQCGSL  169

Query  547  QFLDLSGNSLSGPVSDSM  600
              + L+GN LSG + D++
Sbjct  170  IVVSLAGNKLSGQIPDTL  187



>ref|NP_191196.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 emb|CAB88040.1| putative protein [Arabidopsis thaliana]
 dbj|BAB85646.1| inflorescence and root apices receptor-like kinase [Arabidopsis 
thaliana]
 dbj|BAB85647.1| inflorescence and root apices receptor-like kinase [Arabidopsis 
thaliana]
 gb|ACN59335.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE79514.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=964

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 102/148 (69%), Gaps = 4/148 (3%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+WN VKCHP   RV+E++L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFSLSGR  84

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtln-lSKNSISGTVPDS-LGNMSS  543
            IGRGL +L+ L+ LSL++NN +G+I+P + L      +  LS N +SG++PD       S
Sbjct  85   IGRGLLQLQFLHKLSLSNNNLTGIINPNMLLSLVNLKVVDLSSNGLSGSLPDEFFRQCGS  144

Query  544  LQFLDLSGNSLSG--PVSDSMLENLGSL  621
            L+ L L+ N L+G  PVS S   +L +L
Sbjct  145  LRVLSLAKNKLTGKIPVSISSCSSLAAL  172



>ref|XP_010253067.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=970

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 97/139 (70%), Gaps = 1/139 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP S L +W+EDDDSPC W  VKC P   RVSE+ L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLQDPESKLISWNEDDDSPCNWVGVKCDPRTNRVSELVLDGFSLSGR  84

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG-NMSSL  546
            IGRGL +L+ L  LSL++NNF+G I+P L  L  L+ ++LS NS+SG+ PD       SL
Sbjct  85   IGRGLLQLQFLRKLSLSNNNFTGSINPNLARLEGLRIIDLSDNSLSGSTPDDFFLQCGSL  144

Query  547  QFLDLSGNSLSGPVSDSML  603
            + +  + N+LSG +  S++
Sbjct  145  RAISFAKNNLSGQIPQSLI  163



>ref|XP_010253073.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=970

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 87/145 (60%), Gaps = 24/145 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP S L +W+EDDDSPC W  VKC P   RVSE+ L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLQDPDSKLISWNEDDDSPCNWVGVKCDPKTNRVSELVLEGFSLSGR  84

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRG+ +L+ L  LSL++NNF+G I+P                        +L  +  L+
Sbjct  85   IGRGVLQLKFLRKLSLSNNNFTGTINP------------------------NLARLEGLR  120

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +DLS N LSGP+ D      GSLR
Sbjct  121  VIDLSDNRLSGPIPDDFFRQCGSLR  145


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 0/88 (0%)
 Frame = +1

Query  337  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  516
            +D     LSG +   + KL   + LSL  N FSG +   +G +  L+TL+LS+N  SG +
Sbjct  243  IDFSENSLSGSLPDSMRKLTMCSSLSLHGNLFSGELPAMIGEMRGLETLDLSRNIFSGGI  302

Query  517  PDSLGNMSSLQFLDLSGNSLSGPVSDSM  600
            PDSLGN+ SL+ L+LS N  +G V DS+
Sbjct  303  PDSLGNLQSLKLLNLSSNGFTGVVPDSL  330



>ref|XP_002878081.1| hypothetical protein ARALYDRAFT_907079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54340.1| hypothetical protein ARALYDRAFT_907079 [Arabidopsis lyrata subsp. 
lyrata]
Length=964

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 102/148 (69%), Gaps = 4/148 (3%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+WN VKCHP   RV+E++L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFSLSGR  84

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtln-lSKNSISGTVPDS-LGNMSS  543
            IGRGL +L+ L+ LSL++NN +G+I+P L L      +  LS N +SG++PD       S
Sbjct  85   IGRGLLQLQFLHKLSLSNNNLTGIINPNLLLSLVNLKVVDLSSNGLSGSLPDGFFRQCGS  144

Query  544  LQFLDLSGNSLSG--PVSDSMLENLGSL  621
            L+ L L+ N L+G  PVS S   +L +L
Sbjct  145  LRVLSLAKNKLTGKIPVSISSCSSLAAL  172



>ref|XP_009757206.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=894

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 91/151 (60%), Gaps = 23/151 (15%)
 Frame = +1

Query  172  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  351
            GA +  LNDDVLGLIVFKS VQDP   L +W+E+DDSPC WN + C+P + RVS+V L G
Sbjct  19   GALNPSLNDDVLGLIVFKSDVQDPDGKLKSWNEEDDSPCNWNGINCNPRSNRVSDVVLDG  78

Query  352  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  531
             GLSG+I RGL +L+ L  LSLA+NN +G IS                         SL 
Sbjct  79   FGLSGRISRGLLRLQFLYKLSLANNNLTGSISVV-----------------------SLS  115

Query  532  NMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
             +++L+ LDLS NSLSGP+     E  G LR
Sbjct  116  QLANLKILDLSENSLSGPIPGDYFEKCGPLR  146


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +1

Query  358  LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  537
            LSG I   LEKLE L VL+L+ N  SG +   +    NL TL++S N+++GTVP ++G +
Sbjct  299  LSGTIPTSLEKLESLKVLNLSQNAISGSLPESISSCVNLLTLDVSHNNLTGTVPKTVGQL  358

Query  538  SSLQFLDLSGNSLSGPV  588
              L  LDLS N L G V
Sbjct  359  KLLGILDLSENRLYGTV  375



>ref|XP_002520879.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF41588.1| ATP binding protein, putative [Ricinus communis]
Length=963

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 94/151 (62%), Gaps = 24/151 (16%)
 Frame = +1

Query  172  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  351
            G+ +  LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L  
Sbjct  22   GSLTPSLNDDVLGLIVFKADLQDPKGKLSSWNQDDDTPCNWVGVKCNPRSNRVTELTLDD  81

Query  352  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  531
              LSG+IGRGL +L+ L+ LSLA NN SG ISP                        +L 
Sbjct  82   FSLSGRIGRGLLQLQFLHKLSLARNNLSGNISP------------------------NLA  117

Query  532  NMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
             +++L+ +DLS NSLSGP+ D   +  GSLR
Sbjct  118  RLANLRIIDLSENSLSGPIPDDFFQQCGSLR  148


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 61/95 (64%), Gaps = 1/95 (1%)
 Frame = +1

Query  337  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  516
            +DL G  LSG+    ++KL   N +SL++N  +G +   +G +  L+TL++S N ISG +
Sbjct  246  IDLSGNSLSGEFPETIQKLSLCNFMSLSNNLLTGEVPNWIGEMKRLETLDISGNKISGQI  305

Query  517  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSL  621
            P S+GN+ SL+ L+ S N LSG + +SM  N GSL
Sbjct  306  PTSIGNLQSLKVLNFSSNDLSGSLPESM-ANCGSL  339



>ref|XP_008456960.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=925

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 97/141 (69%), Gaps = 1/141 (1%)
 Frame = +1

Query  181  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  360
            +L LN DVLGLIVFK+ VQDP   LA+W+EDDDSPC W  V+C P + RV E++L+G  L
Sbjct  28   NLSLNGDVLGLIVFKAAVQDPKLKLASWNEDDDSPCNWTGVQCSPRSKRVIELNLNGFSL  87

Query  361  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNM  537
            SG++GRGL +LE L  LSL++NN SG ISP    + NLQ ++LS N+ SG V D      
Sbjct  88   SGRLGRGLFQLEFLQRLSLSNNNLSGNISPNFARVENLQMIDLSGNNFSGAVSDDFFRQC  147

Query  538  SSLQFLDLSGNSLSGPVSDSM  600
             SL+ + L+ N+ SG + DS+
Sbjct  148  RSLRVISLANNNFSGKIPDSL  168



>ref|XP_008672259.1| PREDICTED: uncharacterized protein LOC100216746 isoform X1 [Zea 
mays]
Length=1150

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 99/143 (69%), Gaps = 0/143 (0%)
 Frame = +1

Query  184  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  363
            + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  141  MAVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWARVECDPATSRVLRLALDGLALS  200

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  543
            G++ RGL++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++S
Sbjct  201  GRMPRGLDRLGALQDLSLARNNLSGPLPPGLSLLGSLRSLDLSYNAFSGPLPDDVARLAS  260

Query  544  LQFLDLSGNSLSGPVSDSMLENL  612
            L++LDL+GN+ SGP+  +    L
Sbjct  261  LRYLDLTGNAFSGPLPPAFPRTL  283


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = +1

Query  325  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  504
            R+  +DL     SG +  G+ +L +L  LSL+ N F G +   +G   +L T++LS N+ 
Sbjct  333  RLRTLDLSHNLFSGPVTDGIARLHNLKTLSLSGNRFFGAVPADIGRCPHLSTIDLSSNAF  392

Query  505  SGTVPDSLGNMSSLQFLDLSGNSLSGPV  588
             G +PDS+G ++SL +L  SGN LSG V
Sbjct  393  DGHLPDSIGQLASLVYLSASGNRLSGDV  420



>ref|XP_009116341.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=959

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 92/145 (63%), Gaps = 23/145 (16%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGL+ FKS ++DP   LA+W+EDD +PCAWN VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLVAFKSDLRDPDQKLASWNEDDYTPCAWNGVKCHPRTNRVTELTLDGFSLSGR  88

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +L+ L+ LSL++NN +G ++P               N IS     SLG   SL+
Sbjct  89   IGRGLLQLQSLHKLSLSNNNLTGTVNP---------------NLIS-----SLG---SLK  125

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +DLSGN LSG + D      GSLR
Sbjct  126  VVDLSGNGLSGSLPDGFFRQCGSLR  150



>ref|XP_009623562.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana tomentosiformis]
Length=893

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 92/151 (61%), Gaps = 24/151 (16%)
 Frame = +1

Query  172  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  351
            GA +  LNDDVLGLIVFKS V+DP   L +W+E+DDSPC WN + C+P + RVS+V L G
Sbjct  19   GALNPSLNDDVLGLIVFKSDVEDPDGKLKSWNEEDDSPCNWNGINCNPRSNRVSDVVLDG  78

Query  352  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  531
             GLSG+I RGL +L+ L+ LSLA+NN +G IS                         SL 
Sbjct  79   FGLSGRISRGLLRLKFLHKLSLANNNLTGSISV------------------------SLS  114

Query  532  NMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
             +++L+ LDLS NSLSGP+     E  G LR
Sbjct  115  QLANLKILDLSQNSLSGPIPGDYFEKCGPLR  145



>gb|ACN33819.1| unknown [Zea mays]
 tpg|DAA55768.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1043

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 99/143 (69%), Gaps = 0/143 (0%)
 Frame = +1

Query  184  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  363
            + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  34   MAVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWARVECDPATSRVLRLALDGLALS  93

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  543
            G++ RGL++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++S
Sbjct  94   GRMPRGLDRLGALQDLSLARNNLSGPLPPGLSLLGSLRSLDLSYNAFSGPLPDDVARLAS  153

Query  544  LQFLDLSGNSLSGPVSDSMLENL  612
            L++LDL+GN+ SGP+  +    L
Sbjct  154  LRYLDLTGNAFSGPLPPAFPRTL  176


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = +1

Query  325  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  504
            R+  +DL     SG +  G+ +L +L  LSL+ N F G +   +G   +L T++LS N+ 
Sbjct  226  RLRTLDLSHNLFSGPVTDGIARLHNLKTLSLSGNRFFGAVPADIGRCPHLSTIDLSSNAF  285

Query  505  SGTVPDSLGNMSSLQFLDLSGNSLSGPV  588
             G +PDS+G ++SL +L  SGN LSG V
Sbjct  286  DGHLPDSIGQLASLVYLSASGNRLSGDV  313



>ref|XP_006290555.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
 gb|EOA23453.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
Length=939

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 93/145 (64%), Gaps = 23/145 (16%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E++L G  LSG+
Sbjct  27   LNDDVLGLIVFKADLRDPQQKLASWNEDDYTPCSWTGVKCHPRTNRVTELNLDGFSLSGR  86

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +LE L+ LSL++NN +G+I+                       P+ L ++ +L+
Sbjct  87   IGRGLLQLEFLHKLSLSNNNLTGIIN-----------------------PNLLLSLVNLK  123

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +DLS N+LSG +SD      GSLR
Sbjct  124  VVDLSSNALSGSLSDGFFRQCGSLR  148



>ref|XP_008788529.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Phoenix dactylifera]
Length=968

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIV K+ ++DPAS LA+W+EDDD PC W  V C P   RV+E++L G  LSGK
Sbjct  24   LNDDVLGLIVLKADLEDPASKLASWNEDDDDPCGWVGVTCSPRTNRVTELNLDGFSLSGK  83

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L  LSL+ NNFSG ++P L  L +L +++LS+N++SG++PD       SL
Sbjct  84   IGRGLLQLQSLRKLSLSKNNFSGSLNPNLSQLESLSSVDLSENNLSGSIPDEFFRQCRSL  143

Query  547  QFLDLSGNSLSGPVSDSM  600
              + L+ N+ SG +  S+
Sbjct  144  SSISLANNAFSGEIPPSV  161


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 61/103 (59%), Gaps = 9/103 (9%)
 Frame = +1

Query  340  DLHGL--------GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSK  495
            ++HGL         LSG +   L +L+ L VL L+ N  +G I P++G   +L  LNL K
Sbjct  402  NIHGLQFLNLSWNSLSGSMPASLGELKSLQVLDLSGNRLNGSIPPEIGEAVSLNELNLHK  461

Query  496  NSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            NS++G +P  +GN SSL  L LS N+L+GPV  S   N+ +L+
Sbjct  462  NSLTGGIPTQIGNCSSLASLILSQNNLTGPVP-STFSNITNLQ  503



>ref|XP_008792235.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=968

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIV K+ +QDP S L +WSEDDD PC W  VKC+P   RV+E++L G  LSGK
Sbjct  24   LNDDVLGLIVLKADLQDPTSKLLSWSEDDDDPCGWIGVKCNPRTNRVTELNLDGFSLSGK  83

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L  LSL+ NNFSG ++P L  L +L +++LS+N++SG++PD       SL
Sbjct  84   IGRGLLQLQSLRKLSLSRNNFSGSLNPNLSQLESLWSVDLSENNLSGSIPDVFFRQCRSL  143

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N  SG +  S+
Sbjct  144  RSISLANNDFSGEIPPSV  161



>ref|XP_006290556.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
 gb|EOA23454.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
Length=966

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 93/145 (64%), Gaps = 23/145 (16%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E++L G  LSG+
Sbjct  27   LNDDVLGLIVFKADLRDPQQKLASWNEDDYTPCSWTGVKCHPRTNRVTELNLDGFSLSGR  86

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +LE L+ LSL++NN +G+I+                       P+ L ++ +L+
Sbjct  87   IGRGLLQLEFLHKLSLSNNNLTGIIN-----------------------PNLLLSLVNLK  123

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +DLS N+LSG +SD      GSLR
Sbjct  124  VVDLSSNALSGSLSDGFFRQCGSLR  148



>ref|XP_002459131.1| hypothetical protein SORBIDRAFT_03g046350 [Sorghum bicolor]
 gb|EES04251.1| hypothetical protein SORBIDRAFT_03g046350 [Sorghum bicolor]
Length=1059

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 98/143 (69%), Gaps = 0/143 (0%)
 Frame = +1

Query  184  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  363
            + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  33   MAVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWARVECDPATSRVLRLALDGLALS  92

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  543
            G + RGL++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++S
Sbjct  93   GSMPRGLDRLPALQDLSLARNNLSGPLPPGLSLLGSLRSLDLSYNAFSGPLPDDVARLAS  152

Query  544  LQFLDLSGNSLSGPVSDSMLENL  612
            L++LDL+GN+ SGP+  +    L
Sbjct  153  LRYLDLTGNAFSGPLPPAFPRTL  175


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 0/88 (0%)
 Frame = +1

Query  325  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  504
            R+  +DL     SG +  G+ +L +L  LSL+ N FSG +   +GL  +L T++LS N+ 
Sbjct  225  RLRTLDLSRNQFSGPVTDGIARLHNLKTLSLSGNRFSGAVPADIGLCPHLSTIDLSSNAF  284

Query  505  SGTVPDSLGNMSSLQFLDLSGNSLSGPV  588
             G +PDS+G + SL +L  SGN LSG V
Sbjct  285  DGHLPDSIGQLGSLVYLSASGNRLSGDV  312



>ref|XP_006357297.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=971

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 97/143 (68%), Gaps = 1/143 (1%)
 Frame = +1

Query  175  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  354
            A +L  NDD+LGL+VFK+ VQDP   L +W+E+DDSPC WN + C+P + RVS++ L G 
Sbjct  23   ALNLSFNDDILGLMVFKADVQDPQGKLVSWNEEDDSPCGWNGIHCNPRSNRVSQIVLDGF  82

Query  355  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLG  531
            GLSGKI RGL +L+ L  LSLA NNF+G IS  +  L  L+ L+LS+N++ GT+P D   
Sbjct  83   GLSGKISRGLMRLQFLRKLSLAKNNFTGSISSSVVQLAYLRILDLSENNLFGTIPGDFFE  142

Query  532  NMSSLQFLDLSGNSLSGPVSDSM  600
                L+ + L+ N  SG V +S+
Sbjct  143  QCGPLRSISLAKNKFSGKVPESL  165



>ref|XP_009406870.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
 ref|XP_009406871.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=969

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+GV+DP S LA+W+EDD  PC W  V+C   + RV+E+ L G  LSGK
Sbjct  26   LNDDVLGLIVFKAGVEDPRSKLASWNEDDVDPCNWAGVRCDAKSNRVTELALDGFALSGK  85

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            +GRGL  L+ L  LSL+ NNFSG +SP L  L +L+TL+LS N +SGT+PD   G   S+
Sbjct  86   LGRGLLWLQFLETLSLSMNNFSGSLSPDLLRLESLRTLDLSANHLSGTIPDGFFGQCRSI  145

Query  547  QFLDLSGNSLSGPV  588
            + + L+ NS+SG +
Sbjct  146  RDISLAKNSISGKI  159



>ref|XP_007011288.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY20098.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=982

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ + DP   L++W+EDDD+PC W  VKC+P   RV+E++L G  LSG+
Sbjct  38   LNDDVLGLIVFKADILDPNQKLSSWNEDDDTPCNWFGVKCNPRLNRVTELNLDGFSLSGR  97

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +LE L  LSLA NN +G ISP L  L +L+ ++LS+NS+SG++PD       S+
Sbjct  98   IGRGLLQLEFLRKLSLAKNNLTGSISPNLAKLESLRIIDLSENSLSGSIPDDFFKQCGSV  157

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N  SG +  S+
Sbjct  158  RSISLANNRFSGKIPGSL  175



>gb|KFK34877.1| Leucine-rich repeat protein kinase family protein [Arabis alpina]
Length=964

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 99/148 (67%), Gaps = 4/148 (3%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ ++DP   LA+WSEDD SPC+WN VKCHP   RV+E+ L G  LSG+
Sbjct  26   LNDDVLGLIVFKADLRDPEQKLASWSEDDYSPCSWNGVKCHPRTNRVTELTLDGFSLSGR  85

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtln-lSKNSISGTVPDS-LGNMSS  543
            IGRGL +L+ L+ LS+++NN +G+I+P L L      +  LS N +SG++PD       S
Sbjct  86   IGRGLLQLQFLHKLSMSNNNLTGIINPNLLLSLVNLKVVDLSSNGLSGSLPDGFFRQCGS  145

Query  544  LQFLDLSGNSLSG--PVSDSMLENLGSL  621
            L+   L+ N L G  PVS S   +L +L
Sbjct  146  LRVFSLAKNELMGKIPVSISSCSSLAAL  173



>ref|XP_002528692.1| Brassinosteroid LRR receptor kinase precursor, putative [Ricinus 
communis]
 gb|EEF33681.1| Brassinosteroid LRR receptor kinase precursor, putative [Ricinus 
communis]
Length=968

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+QDP S L +W+ED ++PC W  VKC P   RV+E+ L G  LSG 
Sbjct  26   FNDDVLGLIVFKAGLQDPESKLTSWNEDSENPCNWVGVKCDPKTQRVTELALDGFFLSGH  85

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L +LSL++NNF+G I+P L  L  LQ ++LS+N +SG +PD       SL
Sbjct  86   IGRGLIRLQFLQILSLSNNNFTGTINPDLSQLGGLQVIDLSRNKLSGFIPDEFFKQCGSL  145

Query  547  QFLDLSGNSLSGPVSDSM  600
            + +  + N+LSG + +S+
Sbjct  146  RSVSFAKNNLSGQIPESL  163



>ref|XP_004146470.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN50740.1| hypothetical protein Csa_5G222990 [Cucumis sativus]
Length=925

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 96/141 (68%), Gaps = 1/141 (1%)
 Frame = +1

Query  181  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  360
            +L LN DVLGLIVFK+ VQDP   LA+W+EDDDSPC W  V+C P + RV E++L+G  L
Sbjct  28   NLSLNGDVLGLIVFKAAVQDPKLKLASWNEDDDSPCNWTGVQCSPRSKRVIELNLNGFSL  87

Query  361  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNM  537
            SG++GRGL +LE L  LSL++NN +G ISP    + NLQ ++LS N+ SG V D      
Sbjct  88   SGRLGRGLFQLEFLQRLSLSNNNLTGNISPNFARVDNLQVIDLSGNNFSGVVSDDFFRQC  147

Query  538  SSLQFLDLSGNSLSGPVSDSM  600
             SL+ + L+ N  SG + DS+
Sbjct  148  RSLRVVSLANNKFSGKIPDSL  168



>ref|XP_002972654.1| hypothetical protein SELMODRAFT_98598 [Selaginella moellendorffii]
 gb|EFJ25875.1| hypothetical protein SELMODRAFT_98598 [Selaginella moellendorffii]
Length=927

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 4/140 (3%)
 Frame = +1

Query  172  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  351
            G E++  NDDVLGL+VFK+G+QDP   LA+WSE D SPC W  ++C  A+GRV  V L G
Sbjct  40   GDETVSWNDDVLGLLVFKAGLQDPRGSLASWSEADSSPCNWTGIRCGSASGRVESVSLDG  99

Query  352  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  531
            L LSG IGRGL KLE L  LSL++NN SG + P   L   L  ++L KN +SG +P  +G
Sbjct  100  LALSGTIGRGLLKLERLKTLSLSANNLSGNVVP--ELFRMLDFVDLKKNRLSGELPSPMG  157

Query  532  NMSSLQFLDLSGNSLSGPVS  591
              +S++++DLS N+ +G ++
Sbjct  158  --ASIRYVDLSDNAFTGALA  175



>ref|XP_010921155.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Elaeis guineensis]
Length=945

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  +KC P   RV+E+ L+G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPDSKLVSWNEDDDDPCCWTGIKCDPKTNRVTELSLNGFSLSGK  85

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L  LSL+ NNFSG +S  L  L +L+ L+LS+N +SG +PD   G   S+
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGTLSSDLLRLESLRNLDLSENKLSGPIPDDFFGQCRSI  145

Query  547  QFLDLSGNSLSGPV  588
            + + L+ N+  G +
Sbjct  146  RAISLAKNAFFGAI  159



>ref|XP_010922754.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=968

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +1

Query  175  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  354
            A S  LNDDVLGLIVFK+ +QDP S L +W+EDD+ PC W  + C+P   RV+E++L G 
Sbjct  19   AMSGALNDDVLGLIVFKADLQDPTSKLTSWNEDDNDPCGWMGITCNPTTNRVTELNLDGF  78

Query  355  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LG  531
             LSGKIGRGL +L+ L  LSL+ NNFSG ++P L  L +L T++LS+N++SG++PD    
Sbjct  79   SLSGKIGRGLLQLQSLRKLSLSKNNFSGSLNPNLSRLESLWTVDLSENNLSGSIPDEFFQ  138

Query  532  NMSSLQFLDLSGNSLSGPV  588
               SL+ + L+ N+ SG +
Sbjct  139  QCRSLRTILLANNAFSGEI  157


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 59/91 (65%), Gaps = 0/91 (0%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  507
            +  +DL    L+GK+   L+KL   + LSL SN+FSG +   +G + +L+TLNLS N  S
Sbjct  239  LKSLDLSENLLTGKLPETLQKLSICSYLSLGSNSFSGEVPTWIGEMKSLETLNLSGNGFS  298

Query  508  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSM  600
            G VPDS+GN+  ++ LD S N+ +G + +S+
Sbjct  299  GQVPDSIGNLQVVKRLDFSQNNFTGSLPESI  329



>ref|XP_006429586.1| hypothetical protein CICLE_v10010994mg [Citrus clementina]
 gb|ESR42826.1| hypothetical protein CICLE_v10010994mg [Citrus clementina]
Length=969

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G++DP   L +WSEDDD+PC W  VKC P   RV  + L G  LSG 
Sbjct  27   FNDDVLGLIVFKAGLEDPKEKLTSWSEDDDNPCNWVGVKCDPKTKRVVGLTLDGFSLSGH  86

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L VLSL++NNF+G I+  L     LQ ++ S+N++SG +PD       SL
Sbjct  87   IGRGLLRLQFLQVLSLSNNNFTGTINADLASFGTLQVVDFSENNLSGLIPDEFFRQCGSL  146

Query  547  QFLDLSGNSLSGPVSDSM  600
            + +  + N+L+GP+ +S+
Sbjct  147  REVSFANNNLTGPIPESL  164



>gb|KDO64103.1| hypothetical protein CISIN_1g002094mg [Citrus sinensis]
Length=967

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G++DP   L +WSEDDD+PC W  VKC P   RV  + L G  LSG 
Sbjct  25   FNDDVLGLIVFKAGLEDPKEKLTSWSEDDDNPCNWVGVKCDPKTKRVVGLTLDGFSLSGH  84

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L VLSL++NNF+G I+  L     LQ ++ S+N++SG +PD       SL
Sbjct  85   IGRGLLRLQFLQVLSLSNNNFTGTINADLASFGTLQVVDFSENNLSGLIPDEFFRQCGSL  144

Query  547  QFLDLSGNSLSGPVSDSM  600
            + +  + N+L+GP+ +S+
Sbjct  145  REVSFANNNLTGPIPESL  162



>gb|AAL49790.1| unknown protein [Arabidopsis thaliana]
Length=964

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 101/148 (68%), Gaps = 4/148 (3%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LN DVLGLIVFK+ ++DP   LA+W+EDD +PC+WN VKCHP   RV+E++L G  LSG+
Sbjct  25   LNGDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFSLSGR  84

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtln-lSKNSISGTVPDS-LGNMSS  543
            IGRGL +L+ L+ LSL++NN +G+I+P + L      +  LS N +SG++PD       S
Sbjct  85   IGRGLLQLQFLHKLSLSNNNLTGIINPNMLLSLVNLKVVDLSSNGLSGSLPDEFFRQCGS  144

Query  544  LQFLDLSGNSLSG--PVSDSMLENLGSL  621
            L+ L L+ N L+G  PVS S   +L +L
Sbjct  145  LRVLSLAKNKLTGKIPVSISSCSSLAAL  172



>gb|EAY77289.1| hypothetical protein OsI_05265 [Oryza sativa Indica Group]
Length=1013

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 100/144 (69%), Gaps = 0/144 (0%)
 Frame = +1

Query  157  TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  336
             + A     + +N++VLGL+VFKS + DP+  LATW+E D +PC W  V+C PA  RV  
Sbjct  15   AAAADSTMPMPVNEEVLGLVVFKSALSDPSGALATWTESDATPCGWAHVECDPATSRVLR  74

Query  337  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  516
            + L GLGLSG++ RGL++L  L  LS+A NN SG + P L LL +L++++LS N+ SG +
Sbjct  75   LALDGLGLSGRMPRGLDRLAALQSLSVARNNLSGELPPGLSLLASLRSIDLSYNAFSGPL  134

Query  517  PDSLGNMSSLQFLDLSGNSLSGPV  588
            P  +  ++SL++LDL+GN+ SGP+
Sbjct  135  PGDVPLLASLRYLDLTGNAFSGPL  158



>ref|XP_010921154.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Elaeis guineensis]
Length=969

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  +KC P   RV+E+ L+G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPDSKLVSWNEDDDDPCCWTGIKCDPKTNRVTELSLNGFSLSGK  85

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L  LSL+ NNFSG +S  L  L +L+ L+LS+N +SG +PD   G   S+
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGTLSSDLLRLESLRNLDLSENKLSGPIPDDFFGQCRSI  145

Query  547  QFLDLSGNSLSGPV  588
            + + L+ N+  G +
Sbjct  146  RAISLAKNAFFGAI  159


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  397  HLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSL  576
            +L VL L+SN FSG I P +  + +LQ LNLS NS SG++P+ LG + SL+ LDLSGN L
Sbjct  383  NLQVLVLSSNAFSGKIPPPVSNVRSLQFLNLSWNSFSGSIPEGLGKLKSLEVLDLSGNRL  442

Query  577  SGPV  588
            +G +
Sbjct  443  NGSI  446



>dbj|BAB92869.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 gb|EAZ14887.1| hypothetical protein OsJ_04818 [Oryza sativa Japonica Group]
Length=1013

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 100/144 (69%), Gaps = 0/144 (0%)
 Frame = +1

Query  157  TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  336
             + A     + +N++VLGL+VFKS + DP+  LATW+E D +PC W  V+C PA  RV  
Sbjct  15   AAAADSTMPMPVNEEVLGLVVFKSALSDPSGALATWTESDATPCGWAHVECDPATSRVLR  74

Query  337  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  516
            + L GLGLSG++ RGL++L  L  LS+A NN SG + P L LL +L++++LS N+ SG +
Sbjct  75   LALDGLGLSGRMPRGLDRLAALQSLSVARNNLSGELPPGLSLLASLRSIDLSYNAFSGPL  134

Query  517  PDSLGNMSSLQFLDLSGNSLSGPV  588
            P  +  ++SL++LDL+GN+ SGP+
Sbjct  135  PGDVPLLASLRYLDLTGNAFSGPL  158



>ref|XP_006481196.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=967

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G++DP   L +WSEDDD+PC W  VKC P   RV  + L G  LSG 
Sbjct  25   FNDDVLGLIVFKAGLEDPKEKLTSWSEDDDNPCNWVGVKCDPKTKRVVGLTLDGFSLSGH  84

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L VLSL++NNF+G I+  L     LQ ++ S+N++SG +PD       SL
Sbjct  85   IGRGLLRLQFLQVLSLSNNNFTGTINADLASFGTLQVVDFSENNLSGLIPDEFFRQCGSL  144

Query  547  QFLDLSGNSLSGPVSDSM  600
            + +  + N+L+GP+ +S+
Sbjct  145  REVSFANNNLTGPIPESL  162



>ref|XP_009402208.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=974

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ + DP S LA+W+ED+D PC W  VKC+    RV+E+ L G  LSGK
Sbjct  32   LNDDVLGLIVFKADILDPLSKLASWNEDEDDPCGWTGVKCNAKTNRVTELSLVGFSLSGK  91

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ +  L L+ NNFSG ++P+L  L +L+ ++LS+N++SG +PD   G   SL
Sbjct  92   IGRGLLQLQSIQKLYLSKNNFSGSLNPKLSQLESLRVVDLSENNLSGVIPDEFFGQCRSL  151

Query  547  QFLDLSGNSLSGPVSDSM  600
            + L L+ N+ +G +  S+
Sbjct  152  RSLSLANNAFTGHIPPSL  169



>ref|XP_004246289.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=965

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDV+GLIVFK+G+ DP S LA+W+EDD +PC W  + C+P + RVSE+ L    LSG 
Sbjct  23   FNDDVMGLIVFKAGLTDPKSKLASWTEDDPTPCNWVGINCYPQSNRVSEILLDNFSLSGH  82

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGR L +L+ L VLSL+ NNF+G I+P L  + +L+ ++LS N++SG++PD  L   +SL
Sbjct  83   IGRSLLRLQFLKVLSLSHNNFTGNINPILSQIPSLRVIDLSHNTLSGSIPDEFLQQCTSL  142

Query  547  QFLDLSGNSLSGPVSDSM  600
            Q +  + N+L+G +  S+
Sbjct  143  QSVSFANNNLTGQIPQSL  160



>ref|XP_004971314.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=1029

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +1

Query  184  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  363
            + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  38   MPVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWRRVECDPATSRVLRLSLDGLALS  97

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  543
            G + RGL++L  L  L+LA NN SG + P L LLT+L++L+LS N+ SG +PD +  ++S
Sbjct  98   GPMPRGLDRLPALQELTLARNNLSGPLPPGLSLLTSLRSLDLSYNAFSGPLPDDVALLAS  157

Query  544  LQFLDLSGNSLSGPV  588
            L++LDL+GN+ SGP+
Sbjct  158  LRYLDLTGNAFSGPL  172



>ref|XP_010067617.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW65785.1| hypothetical protein EUGRSUZ_G03140 [Eucalyptus grandis]
Length=972

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ VQDP   LA+W EDDD+PC W   KC+P + RV E++L G  LSG 
Sbjct  27   LNDDVLGLIVFKADVQDPKGKLASWDEDDDNPCNWVGCKCNPRSNRVVELNLDGFSLSGH  86

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            +GRGL +L+ L  LSLA NN +G IS  +  + NL+ L+LS+NS+SGT+PD       SL
Sbjct  87   LGRGLLQLQFLRKLSLAKNNLTGSISSSIARIDNLRVLDLSENSLSGTIPDEFFRQCGSL  146

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N  SG + +++
Sbjct  147  RSVSLASNKFSGKIPETL  164



>ref|NP_001170194.1| uncharacterized protein LOC100384143 precursor [Zea mays]
 gb|ACN36181.1| unknown [Zea mays]
Length=403

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +1

Query  184  LQLNDDVLGLIVFKSGVQDPASHLATWS-EDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  360
            + +N++VLGL+VFKS + DP S LATW+  D  +PCAW  V+C PA  RV  + L GL L
Sbjct  33   MPVNEEVLGLVVFKSALSDPTSALATWTGSDATTPCAWARVECDPATSRVLRLALDGLAL  92

Query  361  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  540
            SG++ R L++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++
Sbjct  93   SGRMPRDLDRLPALQYLSLARNNISGPLPPGLSLLASLRSLDLSYNAFSGPLPDDIARLA  152

Query  541  SLQFLDLSGNSLSGPVSDSMLENL  612
            SL+ LDL+GN+ SGP+  +  E +
Sbjct  153  SLRSLDLTGNAFSGPLPPAFPETI  176



>ref|NP_001239730.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At3g28040-like precursor [Glycine max]
 gb|ACM89592.1| leucine-rich repeat transmembrane protein kinase [Glycine max]
 gb|KHN25807.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=971

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 93/147 (63%), Gaps = 26/147 (18%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGLS  363
            LNDDVLGLIVFK+ ++DP   LA+W+EDD+S C  +W  VKC+P + RV EV+L G  LS
Sbjct  25   LNDDVLGLIVFKADIRDPKGKLASWNEDDESACGGSWVGVKCNPRSNRVVEVNLDGFSLS  84

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  543
            G+IGRGL++L+ L  LSLA+NN +G I+P                        ++  + +
Sbjct  85   GRIGRGLQRLQFLRKLSLANNNLTGGINP------------------------NIARIDN  120

Query  544  LQFLDLSGNSLSGPVSDSMLENLGSLR  624
            L+ +DLSGNSLSG VSD +    GSLR
Sbjct  121  LRVIDLSGNSLSGEVSDDVFRQCGSLR  147



>ref|XP_004241084.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=971

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 97/143 (68%), Gaps = 1/143 (1%)
 Frame = +1

Query  175  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  354
            A +L  NDD+LGL+VFK+ VQDP   L +W+E+DDSPC W+ + C+P + RVS++ L G 
Sbjct  23   ALNLSFNDDILGLMVFKADVQDPQGKLVSWNEEDDSPCGWDGIHCNPRSNRVSQIVLDGF  82

Query  355  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLG  531
            GLSGKI RGL +L+ L  LSLA NNF+G IS  +  L  L+ L+LS+N++ GT+P D   
Sbjct  83   GLSGKISRGLMRLQFLRKLSLAKNNFTGSISSSVVQLAYLRILDLSENNLFGTIPGDFFE  142

Query  532  NMSSLQFLDLSGNSLSGPVSDSM  600
                L+ + L+ N  SG V +S+
Sbjct  143  QCGPLRSISLAKNKFSGKVPESL  165



>ref|XP_010427454.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Camelina sativa]
 ref|XP_010427455.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Camelina sativa]
Length=967

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+
Sbjct  28   LNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGR  87

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPq-lglltnlqtlnlSKNSISGTVPDS-LGNMSS  543
            IGRGL +L+ L+ LSL++NN +GVI+P  L  L NL+ ++LS N++SG++PD       S
Sbjct  88   IGRGLLQLQFLHKLSLSNNNLTGVINPNFLLSLVNLKVVDLSSNALSGSLPDEFFKQCGS  147

Query  544  LQFLDLSGNSLSGPV  588
            L+ L L+ N L+G +
Sbjct  148  LRVLSLAKNKLTGKI  162



>ref|NP_001290509.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At3g28040 precursor [Elaeis guineensis]
 gb|AAO26311.1| receptor-like protein kinase [Elaeis guineensis]
Length=938

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +++P S L +W+EDDD PC W  +KC P   RV+E+ L+G  LSGK
Sbjct  26   LNDDVLGLIVFKADLREPDSKLVSWNEDDDEPCCWTGIKCEPKTNRVTELSLNGFSLSGK  85

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L  LSL+ NNFSG +S  L  L +L+ L+LS+N +SG +PD   G   S+
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGTLSSDLLRLESLRNLDLSENKLSGPIPDDFFGQCRSI  145

Query  547  QFLDLSGNSLSGPV  588
            + + L+ N+  G +
Sbjct  146  RAISLAKNAFFGAI  159



>ref|XP_001771841.1| predicted protein [Physcomitrella patens]
 gb|EDQ63270.1| predicted protein [Physcomitrella patens]
Length=963

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            ++DDVLGL+ FK+G+ DP   L +W +DD SPCAW  + C    GRVSE++L GL L+G+
Sbjct  4    MSDDVLGLMAFKAGLSDPTGALHSWRQDDASPCAWVGIVCDRLTGRVSELNLVGLFLAGQ  63

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL KL+ L +L+L+SNNF+G I  ++  L  L+ LN+S N ++G +   L N SSL 
Sbjct  64   IGRGLAKLDELQILNLSSNNFTGSIDTEVAGLPMLRKLNVSNNQLNGVITPLLTNNSSLM  123

Query  550  FLDLSGNSLSGPVSDSMLENLGSL  621
             LDLS N+L+GP+++       SL
Sbjct  124  VLDLSSNALTGPMAEKFFTTCQSL  147



>ref|XP_006358746.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=894

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFKS VQDP   L +W+E+DDSPC W+ + C+P + RV+EV L G GLSG+
Sbjct  26   LNDDVLGLIVFKSDVQDPYGKLKSWNEEDDSPCNWDGINCNPRSNRVTEVVLDGFGLSGR  85

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  546
            I RGL +L+ L+ LSLA NN +G IS  L  L  L+ L+LS+N++SG +P D       L
Sbjct  86   ISRGLLRLQFLHRLSLAKNNLTGSISVSLAQLAYLKFLDLSENNLSGNIPGDYFQQCGPL  145

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N +SG + +S+
Sbjct  146  RSISLANNKISGQIPESL  163



>ref|XP_008388889.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=469

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP   L +WSEDDDS C+W  VKCHP + RV E++L    LSG 
Sbjct  31   LNDDVLGLIVFKANIQDPKGKLXSWSEDDDSACSWVGVKCHPRSNRVIELNLDDFSLSGH  90

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L  LSL+ NN +G ++P +  + NL+ L+LS+NS SG VP+       SL
Sbjct  91   IGRGLLQLQALRKLSLSKNNLTGSLTPNIAHIDNLRVLDLSENSFSGDVPEEFFRQCGSL  150

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N  SG + +S+
Sbjct  151  RXISLAKNKFSGKIPESL  168



>ref|XP_004502826.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=970

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 100/140 (71%), Gaps = 3/140 (2%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGLS  363
            LNDDVLGLIVFK+ +QDP   L +W+EDD+S C  +W  VKC+P + RV E++L+G  LS
Sbjct  23   LNDDVLGLIVFKADIQDPKGKLTSWNEDDESACGGSWVGVKCNPRSNRVVEINLNGFSLS  82

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMS  540
            G+IGRGL++L+ L  L LA+NN +G I+P + ++ NL+ L+LSKN++SG VPD       
Sbjct  83   GRIGRGLQRLQFLRRLYLANNNLTGNIAPNIAIIDNLRVLDLSKNNLSGVVPDDFFRQCG  142

Query  541  SLQFLDLSGNSLSGPVSDSM  600
            S++ + L+GN  SG +  S+
Sbjct  143  SMRVVSLAGNMFSGNIPSSL  162



>ref|XP_004240861.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=894

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFKS +QDP   L +W+E+DD+PC W+ + C+P + RV+EV L G GLSG+
Sbjct  26   LNDDVLGLIVFKSDIQDPYKKLKSWNEEDDTPCNWDGINCNPRSNRVTEVVLDGFGLSGR  85

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  546
            I RGL +L+ L+ LSLA NN +G IS  L  L  L+ L+LS+N++SG +P D       L
Sbjct  86   ISRGLLRLQFLHRLSLAKNNLTGSISVSLAQLAYLKFLDLSENNLSGNIPGDYFQQCGPL  145

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N +SG + +S+
Sbjct  146  RSISLANNKISGQIPESL  163



>ref|XP_009614707.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana tomentosiformis]
Length=980

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDV+GLIVFK+G  DP S L +W+EDD +PC W  +KC P + RVSE+ L    LSG 
Sbjct  38   FNDDVMGLIVFKAGFTDPKSKLTSWTEDDATPCNWVGIKCDPYSNRVSEILLDNFSLSGH  97

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGR L +L+ L VLSL+ NNF+G I+P L  + +L+ ++LS NS+SG +PD       SL
Sbjct  98   IGRSLLRLQFLRVLSLSKNNFTGNINPILAQIPSLRVIDLSDNSLSGPIPDEFFRQCGSL  157

Query  547  QFLDLSGNSLSGPVSDSM  600
            Q +  + N+L+G + DS+
Sbjct  158  QAVSFAKNNLTGQIPDSL  175



>gb|EYU42026.1| hypothetical protein MIMGU_mgv1a000905mg [Erythranthe guttata]
Length=946

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+ DP S L +W+E+DDS C W  VKC P + RVSE+ L G  LSG 
Sbjct  27   FNDDVLGLIVFKAGLTDPQSRLTSWNEEDDSACNWVGVKCDPTSNRVSELLLDGFSLSGH  86

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSL  546
            +GR L +L+ L VL L+ NNFSG I+P L  +  L+T++LS+NS+SG++P+ +     SL
Sbjct  87   LGRSLIRLQSLKVLQLSRNNFSGTINPILTQIPYLETIDLSQNSLSGSIPEEIFQQCGSL  146

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N+L+G +  S+
Sbjct  147  KEISLAKNNLTGLIPQSL  164



>ref|XP_003522510.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=978

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 93/147 (63%), Gaps = 26/147 (18%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGLS  363
            LNDDVLGLIVFK+ ++DP   LA+W+EDD+S C  +W  VKC+P + RV EV+L G  LS
Sbjct  32   LNDDVLGLIVFKADIRDPKGKLASWNEDDESACGGSWVGVKCNPRSNRVVEVNLDGFSLS  91

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  543
            G+IGRGL++L+ L  LSLA+NN +G I+P                        ++  + +
Sbjct  92   GRIGRGLQRLQFLRKLSLANNNLTGGINP------------------------NIARIDN  127

Query  544  LQFLDLSGNSLSGPVSDSMLENLGSLR  624
            L+ +DLSGNSLSG VS+ +    GSLR
Sbjct  128  LRVIDLSGNSLSGEVSEDVFRQCGSLR  154



>ref|XP_010043193.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW88339.1| hypothetical protein EUGRSUZ_A00726 [Eucalyptus grandis]
Length=962

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 86/145 (59%), Gaps = 24/145 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+ DP   L+TW+ED + PC W  +KC P + RV+EV L G  LSG 
Sbjct  23   FNDDVLGLIVFKAGLHDPKDKLSTWNEDAEYPCDWVGIKCDPRSKRVTEVALDGFSLSGH  82

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +L+ L VLSL+ NNFSG I+                         SL ++ +LQ
Sbjct  83   IGRGLLRLQFLQVLSLSKNNFSGPIN------------------------TSLTHIGTLQ  118

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             LDLS N+ +G + D M +  GSLR
Sbjct  119  VLDLSENNFTGAIPDEMFQQCGSLR  143



>ref|XP_006402993.1| hypothetical protein EUTSA_v10005773mg [Eutrema salsugineum]
 gb|ESQ44446.1| hypothetical protein EUTSA_v10005773mg [Eutrema salsugineum]
Length=967

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 100/148 (68%), Gaps = 4/148 (3%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ ++DP   LA+W+EDD SPC+WN VKCH    RV+E+ L G  LSG+
Sbjct  28   LNDDVLGLIVFKADLRDPEQKLASWNEDDYSPCSWNGVKCHTRTNRVTELTLDGFSLSGR  87

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtln-lSKNSISGTVPDS-LGNMSS  543
            IGRGL +L+ L+ LSL++NN +G+I+P L L      +  LS N +SG++PD       S
Sbjct  88   IGRGLLQLQFLHKLSLSNNNLTGIINPNLLLSLVNLKVVDLSSNGLSGSLPDGFFRQCGS  147

Query  544  LQFLDLSGNSLSG--PVSDSMLENLGSL  621
            L+   L+ N+L+G  PVS S   +L +L
Sbjct  148  LRAFSLAKNTLTGKIPVSISSCSSLAAL  175



>ref|XP_007136420.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris]
 gb|ESW08414.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris]
Length=954

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 91/147 (62%), Gaps = 26/147 (18%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCA--WNFVKCHPANGRVSEVDLHGLGLS  363
            LNDDVLGLIVFK+ ++DP   LA+WSEDD+S C   W  VKC+P + RV E++L G  LS
Sbjct  32   LNDDVLGLIVFKADIRDPKGKLASWSEDDESACGAGWVGVKCNPRSNRVVEINLDGFSLS  91

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  543
            G+IGRGL++L+ L  LSLA+NN +G I+                         ++  + S
Sbjct  92   GRIGRGLQRLQFLRKLSLANNNLTGGIN------------------------SNIARIDS  127

Query  544  LQFLDLSGNSLSGPVSDSMLENLGSLR  624
            L+ +DLSGNSLSG VSD +    GSLR
Sbjct  128  LRVIDLSGNSLSGQVSDDVFRQCGSLR  154



>ref|XP_009793754.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=965

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDV+GLIVFK+G  DP S L +W+EDD +PC W  +KC P + RVSE+ L    LSG 
Sbjct  23   FNDDVMGLIVFKAGFTDPKSKLTSWTEDDATPCNWVGIKCDPYSNRVSEILLDNFSLSGH  82

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGR L +L+ L VLSL++NNF+G I+P L  + +L+ ++LS NS+SG++PD       SL
Sbjct  83   IGRSLLRLQFLRVLSLSNNNFTGNINPILAQIPSLRVIDLSDNSLSGSLPDDFFRQCGSL  142

Query  547  QFLDLSGNSLSGPVSDSM  600
            Q +  + N+L+G + DS+
Sbjct  143  QAVSFAKNNLTGQIPDSL  160



>gb|KHN11868.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=969

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G++DP   L+TW+EDD SPC W  VKC  AN RVS + L G  LSG 
Sbjct  30   FNDDVLGLIVFKAGLEDPKGKLSTWNEDDYSPCNWVGVKCDLANNRVSSLVLDGFSLSGH  89

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS-SL  546
            I RGL +L+ L +LSL+ NNF+G I+P L  + +LQ ++LS+N++ G +PD +     SL
Sbjct  90   IDRGLLRLQFLQILSLSRNNFTGTIAPDLLSIGDLQVVDLSENNLYGPIPDGIFQQCWSL  149

Query  547  QFLDLSGNSLSGPVSDSM  600
            + +  + N+L+G V DS+
Sbjct  150  RVVSFANNNLTGKVPDSL  167


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 51/87 (59%), Gaps = 0/87 (0%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  507
            +  +DL    L G+I  G++ L  L  L L SN+F+G +   +G    L+ ++ S NSIS
Sbjct  197  LQSIDLSNNFLEGEIPEGIQNLIDLRELRLGSNHFTGRVPEHIGDCLLLKLVDFSDNSIS  256

Query  508  GTVPDSLGNMSSLQFLDLSGNSLSGPV  588
            G +P+S+  ++S  FL L GNS +G +
Sbjct  257  GRLPESMQKLTSCTFLSLQGNSFTGGI  283



>ref|XP_011001391.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=963

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L GL LSG+
Sbjct  28   LNDDVLGLIVFKADLQDPMRKLSSWNQDDDTPCNWFGVKCNPRSNRVAELTLDGLSLSGR  87

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSL  546
            IGRGL +L+ L+ LSL+ NN +G I P L  L NL+ ++LS+NS+SGT+ + L    ++L
Sbjct  88   IGRGLLQLQFLHKLSLSRNNLTGSIDPNLTRLENLRIIDLSENSLSGTISEDLFKECAAL  147

Query  547  QFLDLSGNSLSGPV  588
            + L L+ N  SG +
Sbjct  148  RDLSLANNKFSGKI  161



>ref|XP_010103654.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB96537.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=978

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ VQDP   LA+W+EDD+SPC W  V+C+P + RV+E++L G  LSG+
Sbjct  32   LNDDVLGLIVFKADVQDPKGMLASWNEDDNSPCGWMGVRCNPRSKRVTELNLDGFSLSGR  91

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  546
            +GRGL +L+ L  LSLA N+ +G IS  +  + NL+ L+L  NS SG +P D      SL
Sbjct  92   LGRGLLQLQFLRKLSLARNSLNGSISSNIARIDNLRVLDLRDNSFSGDIPEDFFRQCGSL  151

Query  547  QFLDLSGNSLSGPVSDSM  600
            + L L+ N  SG + DS+
Sbjct  152  RVLSLAKNKFSGKIPDSL  169



>ref|XP_002325929.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF00311.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=963

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L GL LSG+
Sbjct  28   LNDDVLGLIVFKADLQDPMRKLSSWNQDDDTPCNWFGVKCNPRSNRVAELTLDGLSLSGR  87

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV-PDSLGNMSSL  546
            IGRGL +L+ L+ LSL+ NN +G I+P L  L NL+ ++LS+NS+SGT+  D     ++L
Sbjct  88   IGRGLLQLQFLHKLSLSRNNLTGSINPNLTRLENLRIIDLSENSLSGTISEDFFKECAAL  147

Query  547  QFLDLSGNSLSGPV  588
            + L L+ N  SG +
Sbjct  148  RDLSLANNKFSGKI  161



>ref|XP_011010876.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Populus euphratica]
Length=941

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 98/138 (71%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P   RV+E+ L GL LSG+
Sbjct  30   LNDDVLGLIVFKADLQDPKRKLSSWNQDDDTPCNWFGVKCNPRTNRVTELSLDGLSLSGQ  89

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  546
            IGRGL +L+ L+ LSL+ N  +G I+P L  L NL  ++LS+NS+SGT+P D   +  +L
Sbjct  90   IGRGLMQLQFLDKLSLSRNCLTGSINPNLTRLENLGIIDLSENSLSGTIPEDFFEDCGTL  149

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N  SG +  ++
Sbjct  150  RDISLAKNKFSGKIPSTL  167


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 61/98 (62%), Gaps = 1/98 (1%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  507
            +S VD     LSG +   ++ L   N LSL++N F+G +   +G L  L+TL+LS N  S
Sbjct  245  LSSVDFSENMLSGTVPDTMQNLGLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFS  304

Query  508  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSL  621
            G VP S+GN+ SL+  +LS NSLSG + +SM  N G+L
Sbjct  305  GQVPTSIGNLQSLKVFNLSANSLSGNLPESM-TNCGNL  341



>ref|XP_011010875.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Populus euphratica]
Length=965

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 98/138 (71%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P   RV+E+ L GL LSG+
Sbjct  30   LNDDVLGLIVFKADLQDPKRKLSSWNQDDDTPCNWFGVKCNPRTNRVTELSLDGLSLSGQ  89

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  546
            IGRGL +L+ L+ LSL+ N  +G I+P L  L NL  ++LS+NS+SGT+P D   +  +L
Sbjct  90   IGRGLMQLQFLDKLSLSRNCLTGSINPNLTRLENLGIIDLSENSLSGTIPEDFFEDCGTL  149

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N  SG +  ++
Sbjct  150  RDISLAKNKFSGKIPSTL  167


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 61/98 (62%), Gaps = 1/98 (1%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  507
            +S VD     LSG +   ++ L   N LSL++N F+G +   +G L  L+TL+LS N  S
Sbjct  245  LSSVDFSENMLSGTVPDTMQNLGLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFS  304

Query  508  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSL  621
            G VP S+GN+ SL+  +LS NSLSG + +SM  N G+L
Sbjct  305  GQVPTSIGNLQSLKVFNLSANSLSGNLPESM-TNCGNL  341



>ref|XP_003516434.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like isoform X1 [Glycine max]
 ref|XP_006573410.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like isoform X2 [Glycine max]
Length=969

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G++DP   L+TW+EDD SPC W  VKC  AN RVS + L G  LSG 
Sbjct  30   FNDDVLGLIVFKAGLEDPKGKLSTWNEDDYSPCNWVGVKCDLANNRVSSLVLDGFSLSGH  89

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS-SL  546
            I RGL +L+ L +LSL+ NNF+G I+P L  + +LQ ++LS+N++ G +PD +     SL
Sbjct  90   IDRGLLRLQFLQILSLSRNNFTGTIAPDLLSIGDLQVVDLSENNLYGPIPDGIFQQCWSL  149

Query  547  QFLDLSGNSLSGPVSDSM  600
            + +  + N+L+G + DS+
Sbjct  150  RVVSFANNNLTGKIPDSL  167


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 51/87 (59%), Gaps = 0/87 (0%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  507
            +  +DL    L G+I  G++ L  L  L L SN+F+G +   +G    L+ ++ S NSIS
Sbjct  197  LQSIDLSNNFLEGEIPEGIQNLIDLRELRLGSNHFTGRVPEHIGDCLLLKLVDFSDNSIS  256

Query  508  GTVPDSLGNMSSLQFLDLSGNSLSGPV  588
            G +P+S+  ++S  FL L GNS +G +
Sbjct  257  GRLPESMQKLTSCTFLSLQGNSFTGGI  283



>ref|XP_002988156.1| hypothetical protein SELMODRAFT_40688, partial [Selaginella moellendorffii]
 gb|EFJ10948.1| hypothetical protein SELMODRAFT_40688, partial [Selaginella moellendorffii]
Length=864

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 92/133 (69%), Gaps = 4/133 (3%)
 Frame = +1

Query  193  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  372
            NDDVLGL+VFK+G+QDP   LA+WSE D SPC W  ++C  A+GRV  V L GL LSG I
Sbjct  1    NDDVLGLLVFKAGLQDPRGSLASWSEADSSPCNWTGIRCGSASGRVESVSLDGLALSGTI  60

Query  373  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  552
            GRGL KLE L  LSL++NN SG + P   L   L  ++L KN +SG +P  +G  +S+++
Sbjct  61   GRGLLKLERLKTLSLSANNLSGNVVP--ELFRMLDFVDLKKNRLSGELPSPMG--ASIRY  116

Query  553  LDLSGNSLSGPVS  591
            +DLS N+ +G ++
Sbjct  117  VDLSDNAFTGALA  129



>ref|XP_007134721.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
 gb|ESW06715.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
Length=982

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLI FK+G++DP   L+TW+ DD SPC W  VKC P N RVS + L G  LSG 
Sbjct  39   FNDDVLGLITFKAGLEDPKGKLSTWNADDYSPCNWVGVKCDPVNNRVSSLVLDGFSLSGH  98

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS-SL  546
            I RGL KL+ L +LSL+ NNF G I+P L  + +LQ ++LS+N++SG +P+ +     SL
Sbjct  99   IDRGLLKLQFLQILSLSRNNFKGTIAPDLLGIGDLQVVDLSENNLSGLIPNEIFQQCWSL  158

Query  547  QFLDLSGNSLSGPVSDSM  600
            + L  + N+L+G + DS+
Sbjct  159  RVLSFANNNLTGKIPDSL  176



>ref|XP_010525412.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=965

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 103/147 (70%), Gaps = 3/147 (2%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ ++DP   LA+W+EDD SPC W  +KC+P   RV+E++L G  LSG+
Sbjct  28   LNDDVLGLIVFKADLRDPEQKLASWNEDDYSPCNWVGLKCNPRTNRVTELNLDGFSLSGR  87

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L  LSL++NN +G I+P L  L +L+ ++LS N +SG++PD       SL
Sbjct  88   IGRGLLQLQFLRKLSLSNNNLTGNINPNLLSLQDLKIVDLSNNGLSGSIPDGFFRQCGSL  147

Query  547  QFLDLSGNSLSG--PVSDSMLENLGSL  621
            + + L+ N+LSG  PVS S   +L +L
Sbjct  148  RAISLANNNLSGKIPVSISSCSSLAAL  174


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +1

Query  337  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  516
            +DL G GL G+I  G++ L +L VL L+ N FSG++  ++G    L+ ++LS+NS+SG +
Sbjct  198  LDLSGNGLEGEIPEGIDSLNNLRVLDLSRNRFSGLVPSEIGNCLLLKYVDLSENSLSGNL  257

Query  517  PDSLGNMSSLQFLDLSGNSLSGPV  588
            PDSL  ++   FLDL  N+L G V
Sbjct  258  PDSLQKLNLCYFLDLGKNALEGDV  281



>ref|XP_006842493.1| hypothetical protein AMTR_s00077p00091370 [Amborella trichopoda]
 gb|ERN04168.1| hypothetical protein AMTR_s00077p00091370 [Amborella trichopoda]
Length=981

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK  + DP + L++WSEDD+SPC W  ++C+P   RV+E+ L+ L LSGK
Sbjct  29   LNDDVLGLIVFKFDLHDPKNVLSSWSEDDNSPCNWFGIQCNPRTQRVTEILLNDLSLSGK  88

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L  LSL++N FSG ISP L  + +L+ ++ S N+++G +PD       SL
Sbjct  89   IGRGLVRLQFLRKLSLSNNYFSGTISPDLATIQSLRAVDFSGNNLTGEIPDQFFKQCGSL  148

Query  547  QFLDLSGNSLSGPVSDSM  600
            +++  + N+  GPV  S+
Sbjct  149  RYVSFARNNFYGPVPRSL  166



>gb|EYU35201.1| hypothetical protein MIMGU_mgv1a000839mg [Erythranthe guttata]
Length=967

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 99/139 (71%), Gaps = 2/139 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCA-WNFVKCHPANGRVSEVDLHGLGLSG  366
            LNDDVLGLIVFK+ VQDP   LA+W+E+DDSPC  W  VKC+P + RVS++ L G GLSG
Sbjct  27   LNDDVLGLIVFKADVQDPDGKLASWNEEDDSPCNNWVGVKCNPRSNRVSDLVLDGFGLSG  86

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSS  543
            K+GRGL +L+ L  LSL+ NN +G ++     L++L+ L+LS+NS SG++P D      S
Sbjct  87   KLGRGLLQLQFLRKLSLSKNNLTGSVTLSFAQLSDLRVLDLSENSFSGSIPSDFFTQCGS  146

Query  544  LQFLDLSGNSLSGPVSDSM  600
            L+ + L+ N  SGP+ +S+
Sbjct  147  LRSISLARNKFSGPIPESL  165


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 59/88 (67%), Gaps = 0/88 (0%)
 Frame = +1

Query  337  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  516
            +DL G   SG++   ++KL   N L L  N F G +S  +G + +L++L+LS+N +SG +
Sbjct  227  IDLSGNSFSGRLPSTIQKLSLCNNLVLGKNGFEGDLSEWIGEMRSLESLDLSENGLSGRI  286

Query  517  PDSLGNMSSLQFLDLSGNSLSGPVSDSM  600
            PDSLG + SL+ L++S N+L+G + +SM
Sbjct  287  PDSLGKLQSLKVLNVSKNALNGSLPESM  314



>ref|XP_006341303.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=982

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDV+GLIV K+G  DP S LA+W+EDD +PC W  + C+P + RVSE+ L    LSG 
Sbjct  40   FNDDVMGLIVLKAGFTDPKSKLASWTEDDPTPCNWVGINCYPQSNRVSEILLDNFSLSGH  99

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGR L +L+ L VLSL++NNF+G I+P L  + +L+ ++LS N++SG++PD      SSL
Sbjct  100  IGRSLLRLQFLKVLSLSNNNFTGNINPILSQIPSLRVIDLSHNTLSGSIPDEFFQQCSSL  159

Query  547  QFLDLSGNSLSGPVSDSM  600
            Q +  + N+L+G +  S+
Sbjct  160  QSVSFANNNLTGEIPQSL  177



>ref|XP_008370260.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=965

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+ DP + LA+W+EDDDSPC+W  VKC P  GRV+EV L G  LSG 
Sbjct  23   FNDDVLGLIVFKAGLSDPEAKLASWNEDDDSPCSWVGVKCDPTTGRVAEVVLDGFSLSGH  82

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L++L  LSL+ NNF+G I+P L  L +LQ ++LS+NS+SG+VP+       SL
Sbjct  83   IGRGLLRLQNLQRLSLSDNNFTGFINPDLPHLGSLQVIDLSRNSLSGSVPEEFFMQCGSL  142

Query  547  QFLDLSGNSLSGPVSDSM  600
            + +  + N+L+G + +S+
Sbjct  143  RVVSFARNNLTGRIPESL  160



>ref|XP_010504542.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=968

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVF++ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLIVFEADLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGR  88

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPq-lglltnlqtlnlSKNSISGTVPDS-LGNMSS  543
            IGRGL +L+ L+ LSL++NN +G+I+P  L  L NL+ ++LS N++SG++PD       S
Sbjct  89   IGRGLLQLQFLHKLSLSNNNLTGIINPNFLLSLVNLKVVDLSSNALSGSLPDGFFKQCGS  148

Query  544  LQFLDLSGNSLSGPV  588
            L+ L L+ N L+G +
Sbjct  149  LRVLSLAKNKLTGKI  163



>dbj|BAJ85468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1052

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            +N++VLGL+VF+S + DP+  LA W+E D +PC W  V+C PA  RV  + L GLGLS  
Sbjct  30   VNEEVLGLVVFRSALTDPSGALAAWAESDATPCGWPHVECDPATSRVLRLALDGLGLSSD  89

Query  370  IG--RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  543
             G  RGL++L  L  LSLA NN SG + P L LL +L+ L+LS+N++SG +PD L  ++S
Sbjct  90   SGVPRGLDRLPRLQSLSLARNNLSGALRPGLSLLPSLRLLDLSRNALSGALPDDLPLLAS  149

Query  544  LQFLDLSGNSLSGPV  588
            L++LDLS N+LSGP+
Sbjct  150  LRYLDLSSNALSGPL  164



>ref|XP_009349085.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=952

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP   LA+WSEDDDS C+W  +KCHP + RV E++L    LSG 
Sbjct  31   LNDDVLGLIVFKANIQDPKGKLASWSEDDDSACSWVGIKCHPRSNRVIELNLDDFSLSGH  90

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L  LSL+ NN  G ++P +  + NL+ L+LS+NS SG VP+       SL
Sbjct  91   IGRGLLQLQALRKLSLSKNNLIGSLTPNIAHIDNLRVLDLSENSFSGDVPEEFFRQCGSL  150

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N  SG + +S+
Sbjct  151  RVISLAKNKFSGKLPESL  168



>ref|XP_010412798.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1231

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLI+FK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+
Sbjct  28   LNDDVLGLILFKADLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGR  87

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPq-lglltnlqtlnlSKNSISGTVPDS-LGNMSS  543
            IGRG+ +L+ L+ LSL++NN +G+I+P  L  L NL+ ++LS N++SG++PD       S
Sbjct  88   IGRGILQLQFLHKLSLSNNNLTGIINPNFLLSLVNLKVVDLSSNALSGSLPDEFFKQCGS  147

Query  544  LQFLDLSGNSLSGPV  588
            L+ L L+ N L+G +
Sbjct  148  LRVLSLAKNKLTGKI  162


 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 93/142 (65%), Gaps = 4/142 (3%)
 Frame = +1

Query  169  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  348
            G   SL+  D  L +  F   ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L 
Sbjct  287  GEMRSLETLD--LSMNKFSGQLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLD  344

Query  349  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPq-lglltnlqtlnlSKNSISGTVPDS  525
            G  LSG+IGRG+ +L+ L+ LSL++NN +G+I+P  L  L NL+ ++LS N++SG++PD 
Sbjct  345  GFSLSGRIGRGILQLQFLHKLSLSNNNLTGIINPNFLLSLVNLKVVDLSSNALSGSLPDG  404

Query  526  -LGNMSSLQFLDLSGNSLSGPV  588
                  SL+ L L+ N L+G +
Sbjct  405  FFKQCGSLRVLSLAKNKLTGKI  426



>ref|XP_009362809.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=952

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP   LA+WSEDDDS C+W  +KCHP + RV E++L    LSG 
Sbjct  31   LNDDVLGLIVFKANIQDPKGKLASWSEDDDSACSWVGIKCHPRSNRVIELNLDDFSLSGH  90

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L  LSL+ NN  G ++P +  + NL+ L+LS+NS SG VP+       SL
Sbjct  91   IGRGLLQLQALRKLSLSKNNLIGSLTPNIAHIDNLRVLDLSENSFSGDVPEEFFRQCGSL  150

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N  SG + +S+
Sbjct  151  RVISLAKNKFSGKLPESL  168



>ref|XP_011084816.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=972

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 98/139 (71%), Gaps = 2/139 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCA-WNFVKCHPANGRVSEVDLHGLGLSG  366
            LNDDVLGLIVFK+ +QDP   L++W+E+DDSPC  W  VKC+P + RVS++ L G GLSG
Sbjct  25   LNDDVLGLIVFKADIQDPDGKLSSWNEEDDSPCNNWVGVKCNPRSNRVSDLVLDGFGLSG  84

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSS  543
            K+GRGL +L+ L  LSLA NN +G IS     L++L+ L+LS+N  SG++P D      S
Sbjct  85   KLGRGLLQLQFLRKLSLAKNNLTGSISLSFSELSDLRVLDLSENGFSGSIPSDFFSQCGS  144

Query  544  LQFLDLSGNSLSGPVSDSM  600
            L+ + L+ N  SGP+ +S+
Sbjct  145  LRSISLAKNRFSGPIPESL  163



>ref|XP_002467905.1| hypothetical protein SORBIDRAFT_01g036160 [Sorghum bicolor]
 gb|EER94903.1| hypothetical protein SORBIDRAFT_01g036160 [Sorghum bicolor]
Length=972

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 89/130 (68%), Gaps = 1/130 (1%)
 Frame = +1

Query  196  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  375
            DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C    GRVS + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVSDPDGRLATWSEDDERPCAWGGVTCDARTGRVSALSLAGFGLSGKLG  91

Query  376  RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSLQF  552
            RGL +LE L  LSLA NN SG +  +L  L  LQTL+LS N+ +G +P+ L G   SL+ 
Sbjct  92   RGLLRLEALQSLSLARNNLSGDVPAELARLPALQTLDLSANAFAGAIPEGLFGRCRSLRD  151

Query  553  LDLSGNSLSG  582
            + L+GN+ SG
Sbjct  152  VSLAGNAFSG  161



>ref|XP_010683484.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=972

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+GV+DP + L +W+E DD PC WN VKC P   RV+E+ L G  LSG+
Sbjct  25   FNDDVLGLIVFKAGVKDPDAKLVSWNESDDKPCKWNGVKCDPTTNRVTEITLDGFSLSGQ  84

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSL  546
            I R L +L+ L  +SL++NN SG ++P+   L NLQ+++LS N++SG +P+ L     SL
Sbjct  85   ISRSLLRLQFLQKISLSNNNLSGTVNPEFAHLWNLQSIDLSGNNLSGFIPNELFQQCGSL  144

Query  547  QFLDLSGNSLSGPVSDSM  600
            + +  + N LSG + DS+
Sbjct  145  KSVSFANNVLSGELPDSL  162



>ref|XP_004514781.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=946

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 98/143 (69%), Gaps = 1/143 (1%)
 Frame = +1

Query  175  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  354
            +++   N+D+LGLIVFK+G++DP + L+TW+EDD SPC W+ VKC P+  RVS + L G 
Sbjct  23   SQNQPFNEDMLGLIVFKAGLEDPKNKLSTWNEDDYSPCNWDGVKCDPSTNRVSSLILDGF  82

Query  355  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  534
             L G I RGL +L+ L +LSL+ NNF+G I   L  L NL+ ++LS+N++ GT+PD    
Sbjct  83   SLYGHINRGLMRLQFLQILSLSRNNFTGTIKNDLLTLWNLKVVDLSENNLFGTIPDGFFQ  142

Query  535  MS-SLQFLDLSGNSLSGPVSDSM  600
               SL+ L  S N+L+G + DS+
Sbjct  143  QCWSLRVLSFSKNNLTGKIPDSL  165



>ref|XP_004984462.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=972

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +1

Query  196  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  375
            DDVLGLIVFK+ V DP   LATWSEDD+  CAW+ V C P  GRVS + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVSDPEGRLATWSEDDERACAWDGVTCEPRTGRVSALSLAGFGLSGKLG  91

Query  376  RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSLQF  552
            RGL +LE L  L+LA NN SG +  +L  L  LQTL+LS N+ +G +P+ L G   +L+ 
Sbjct  92   RGLLRLEALQSLNLAHNNLSGDVPAELARLPALQTLDLSANAFAGAIPEGLFGRCRALRD  151

Query  553  LDLSGNSLSGPV  588
            + L+GN+ SG +
Sbjct  152  VSLAGNAFSGDI  163



>ref|XP_002319878.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE95801.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=965

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDV GLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L GL LSG+
Sbjct  30   LNDDVFGLIVFKADLQDPKRKLSSWNQDDDTPCNWFGVKCNPRSNRVTELSLDGLSLSGQ  89

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  546
            IGRGL +L+ L+ LSL+ N  +G I+P L  L NL+ ++LS+NS+SGT+P D   +  +L
Sbjct  90   IGRGLMQLQFLHKLSLSRNCLTGSINPNLTRLENLRIIDLSENSLSGTIPEDFFKDCGAL  149

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N  SG +  ++
Sbjct  150  RDISLAKNKFSGKIPSTL  167


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = +1

Query  337  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  516
            VD     LSG +   ++ L   N LSL++N F+G +   +G L  L+TL+LS N  SG V
Sbjct  248  VDFSENMLSGTVPDTMQNLGLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFSGQV  307

Query  517  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSL  621
            P S+GN+ SL+  +LS NSLSG + +SM  N G+L
Sbjct  308  PTSIGNLQSLKVFNLSANSLSGNLPESM-TNCGNL  341



>ref|XP_008782666.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=938

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  VKC P   RV+E+ L G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPGSKLVSWNEDDDDPCHWLGVKCDPKTNRVTELSLVGFFLSGK  85

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L  LSL+ NNFSG +S  L  L +L+ L+LS+N +SG +PD   G   S+
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGTLSSDLLRLESLRNLDLSENKLSGPIPDDFFGQCRSI  145

Query  547  QFLDLSGNSLSGPV  588
            + + L+ N+  G +
Sbjct  146  RSISLAKNAFFGAI  159


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 58/96 (60%), Gaps = 1/96 (1%)
 Frame = +1

Query  337  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  516
            +DL     SG I  G+ KL+ L VL L+ N  +G I  Q+G   +L+ L L KNS+ G  
Sbjct  387  LDLSSNAFSGSIPEGVGKLKSLEVLDLSGNRLNGSIPSQIGGAASLKELRLGKNSLKGAX  446

Query  517  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            P  +GN SSL  LDLS N+L+GP+  + L NL +L+
Sbjct  447  PTQIGNCSSLTSLDLSQNNLTGPIPPT-LANLTNLQ  481



>gb|KDP21644.1| hypothetical protein JCGZ_03315 [Jatropha curcas]
Length=960

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 88/145 (61%), Gaps = 24/145 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+EV L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLQDPKGKLSSWNQDDDTPCNWVGVKCNPRSNRVTEVMLDGFSLSGR  84

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +L+ L+ LSLA NN +G IS                         +L  + +L+
Sbjct  85   IGRGLLQLQFLHKLSLARNNLTGSISL------------------------NLSRLENLR  120

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +DLS NSLSG + D      GSLR
Sbjct  121  IIDLSDNSLSGSIQDDFFAQCGSLR  145


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 57/91 (63%), Gaps = 0/91 (0%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  507
            +  +D     +SG +   ++KL   N LSL++N  +G +   +G +  L+TL+LS N  S
Sbjct  240  IRAIDFSENSISGYLPETMQKLSLCNYLSLSNNMLAGEVPNWIGEMKQLETLDLSGNKFS  299

Query  508  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSM  600
            G VP+S+GN+ SL+ L+LS N LSG + +SM
Sbjct  300  GQVPNSIGNLQSLKVLNLSANGLSGNLPESM  330



>ref|XP_004492560.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=958

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDD+LGLIVFK+G++DP   L++W+EDD++PC W  VKC P+N +V+ + L G  LSG 
Sbjct  30   FNDDILGLIVFKAGLKDPNHKLSSWNEDDNTPCNWEGVKCDPSNNKVTSLVLDGFSLSGH  89

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            + RGL +L+ L +LSL  NNF+G I+P L  L  LQ ++LS N++ GT+P+       SL
Sbjct  90   VDRGLLRLQFLQILSLKGNNFTGFINPDLPKLGTLQVVDLSDNNLQGTIPEEFFQQCGSL  149

Query  547  QFLDLSGNSLSGPVSDSM  600
            + +  + N+L+G + DS+
Sbjct  150  RTVSFAKNNLTGKIPDSI  167


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  507
            +  +DL G  LSG I   +++L   N LSL  N+ +G I   +G L +L+ L+LS N  S
Sbjct  245  LKSLDLSGNFLSGGIPNSMQRLSSCNSLSLQGNSLTGNIPDWIGELKDLEKLDLSSNRFS  304

Query  508  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML  603
            G +P SLGN+  LQ L+ S N L G V DSM+
Sbjct  305  GLIPKSLGNLDMLQILNFSRNQLVGNVPDSMI  336



>ref|XP_008808300.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=939

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 96/156 (62%), Gaps = 25/156 (16%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  VKC P   RV+E+ L G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPDSKLVSWNEDDDDPCHWIGVKCDPKTNRVAELSLDGFSLSGK  85

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD---------  522
            IGRGL +L+ L  LSL+ NNFSG +S  L  L +L+ L+LS+N +SG +PD         
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGSLSSDLLRLESLRNLDLSENKLSGPIPDDFFGQCRFI  145

Query  523  ----------------SLGNMSSLQFLDLSGNSLSG  582
                            ++G+ S+L  LDLS N LSG
Sbjct  146  GAISLAKNAFSGVIPPNVGSCSTLAALDLSSNRLSG  181


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 58/96 (60%), Gaps = 1/96 (1%)
 Frame = +1

Query  337  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  516
            +DL     SG I   + KL+ L  L L+ N  +G I  ++G   +L+ L L KNS+SG +
Sbjct  387  LDLSSNAFSGSIPESVGKLKSLEFLDLSGNRLNGSIPLEVGGAVSLKELRLEKNSLSGGI  446

Query  517  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            P  +GN SSL  LDLS N+L+GP+  S L NL +L+
Sbjct  447  PTQIGNCSSLATLDLSQNNLTGPIPPS-LANLTNLQ  481



>ref|XP_008655312.1| PREDICTED: uncharacterized protein LOC100384143 isoform X1 [Zea 
mays]
 gb|AFW83919.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1053

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +1

Query  184  LQLNDDVLGLIVFKSGVQDPASHLATWS-EDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  360
            + +N++VLGL+VFKS + DP S LATW+  D  +PCAW  V+C PA  RV  + L GL L
Sbjct  33   MPVNEEVLGLVVFKSALSDPTSALATWTGSDATTPCAWARVECDPATSRVLRLALDGLAL  92

Query  361  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  540
            SG++ R L++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++
Sbjct  93   SGRMPRDLDRLPALQYLSLARNNISGPLPPGLSLLASLRSLDLSYNAFSGPLPDDIARLA  152

Query  541  SLQFLDLSGNSLSGPVSDSMLENL  612
            SL+ LDL+GN+ SGP+  +  E +
Sbjct  153  SLRSLDLTGNAFSGPLPPAFPETI  176



>ref|XP_008681357.1| PREDICTED: uncharacterized protein LOC100304322 isoform X1 [Zea 
mays]
 tpg|DAA45233.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=972

 Score =   122 bits (305),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 88/130 (68%), Gaps = 1/130 (1%)
 Frame = +1

Query  196  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  375
            DDVLGLIVFK+ V DP   LATWSEDD+ PCAW+ V C    GRVS + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVSDPDGRLATWSEDDERPCAWDGVTCDARTGRVSALSLAGFGLSGKLG  91

Query  376  RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSLQF  552
            RGL +LE L  LSLA NN SG +   L  L  LQTL+LS N+ +G VP+ L G   SL+ 
Sbjct  92   RGLLRLEALQSLSLARNNLSGDVPADLARLPALQTLDLSANAFAGAVPEGLFGRCRSLRD  151

Query  553  LDLSGNSLSG  582
            + L+ N+ SG
Sbjct  152  VSLANNAFSG  161



>ref|XP_004305081.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
 ref|XP_011466417.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=956

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+ DP + L++W+E+DD+PC W  VKC   + RVSE+ L G GLSG 
Sbjct  26   FNDDVLGLIVFKAGLLDPEAKLSSWNEEDDTPCHWVGVKCDVRSNRVSELALDGFGLSGH  85

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            + RGL +L+ +  LSL++NNF+G I+P L  +  LQ ++LS+NS+SG++PD       SL
Sbjct  86   VNRGLLRLQVIQRLSLSNNNFTGSINPDLAHIGTLQVIDLSQNSLSGSIPDEFFQQCGSL  145

Query  547  QFLDLSGNSLSGPVSDSM  600
            + +  + N LSG + +S+
Sbjct  146  RVVSFAKNKLSGRIPESL  163



>gb|KJB71525.1| hypothetical protein B456_011G127000 [Gossypium raimondii]
Length=967

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 84/145 (58%), Gaps = 24/145 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLI FK+G++DP + L +WS DD+ PC W  VKC P   RV+E+ L GL LSG 
Sbjct  26   FNDDVLGLIFFKAGLKDPTAKLQSWSADDNDPCNWMGVKCDPTTYRVTELHLDGLSLSGH  85

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            +GRGL +L  L VLSL                        SKN+++GT+   L  + SL+
Sbjct  86   VGRGLLRLPFLQVLSL------------------------SKNNLTGTINSELSRIGSLR  121

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +DLSGNSLSG + D      GSLR
Sbjct  122  VIDLSGNSLSGSIPDDFFTQCGSLR  146



>ref|XP_007140080.1| hypothetical protein PHAVU_008G082500g [Phaseolus vulgaris]
 gb|ESW12074.1| hypothetical protein PHAVU_008G082500g [Phaseolus vulgaris]
Length=968

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G++DP   L++W+EDD+SPC W  VKC P++ RV+ + L G  LSG 
Sbjct  27   FNDDVLGLIVFKAGLEDPKRKLSSWNEDDNSPCNWEGVKCDPSSNRVTALVLDGFSLSGH  86

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            + RGL +L+ L +LSL+ NNF+G+I+P L  L +LQ ++ S N++SG +P+       SL
Sbjct  87   VDRGLLRLQFLQILSLSRNNFTGLINPDLPRLGSLQAVDFSDNNLSGEIPEGFFQQCGSL  146

Query  547  QFLDLSGNSLSGPVSDSM  600
            + +  + N+L+G + +S+
Sbjct  147  RTVSFAKNNLTGKIPESL  164


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  507
            +  +DL G  LSG++ + +++L     LSL  N+F+G I   +G L NL  L+LS NS S
Sbjct  242  LKSLDLSGNFLSGELPQSMQRLTSCTSLSLQGNSFTGGIPDWIGELKNLDMLDLSANSFS  301

Query  508  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML  603
            G +P SLGN+ SL  L+LS N L+G + DSML
Sbjct  302  GWIPKSLGNLDSLHRLNLSRNQLTGNLPDSML  333



>ref|XP_010553156.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=969

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 85/146 (58%), Gaps = 25/146 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCA-WNFVKCHPANGRVSEVDLHGLGLSG  366
             NDDVLGLIVFK+G+ DP S LA+W+E+D+ PC  W  V C PA+ RV+E+ L G  LSG
Sbjct  28   FNDDVLGLIVFKAGLHDPGSKLASWNEEDNDPCINWVGVSCDPASNRVTELRLDGFSLSG  87

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  546
             IGRGL +L+ L  L L++NN SG ++P                           +M SL
Sbjct  88   HIGRGLLRLQSLQTLVLSNNNLSGALNP------------------------EFPHMGSL  123

Query  547  QFLDLSGNSLSGPVSDSMLENLGSLR  624
            Q +D SGNSLSG + D   E  GSLR
Sbjct  124  QVVDFSGNSLSGRIPDGFFEQCGSLR  149



>ref|XP_008369373.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=973

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP   LA+WSE D+SPC W  VKC+P + RV E+ L    LSG 
Sbjct  31   LNDDVLGLIVFKADIQDPKGKLASWSEVDNSPCNWVGVKCNPRSNRVIELSLDDFSLSGH  90

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSL  546
            IGRGL +L+ L  LSL+ NN +G ++P    + NL+ L+LS+NS SG VP+ L     SL
Sbjct  91   IGRGLLQLQALRKLSLSKNNLTGSLTPNFTHIDNLRVLDLSENSFSGGVPEELFRQCGSL  150

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N  SG + +S+
Sbjct  151  RVISLAKNKFSGKIPESL  168



>ref|XP_009363794.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
 ref|XP_009363882.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=973

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 91/138 (66%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIV K+ +QDP   LA+WSE D SPC W  VKCHP + RV E+ L    LSG 
Sbjct  31   LNDDVLGLIVLKADIQDPKGKLASWSEVDSSPCNWVGVKCHPRSNRVIELSLDDFSLSGH  90

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSL  546
            IGRGL +L+ L  LSL+ NN +G ++P    + NL+ L+LS+NS SG VP+ L     SL
Sbjct  91   IGRGLLQLQALRKLSLSKNNLTGSLTPNFTHIDNLRVLDLSENSFSGGVPEELFRQCGSL  150

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N  SG + +S+
Sbjct  151  RVISLAKNKFSGKIPESL  168



>ref|XP_004308984.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=969

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP + L +W+EDDDSPC W  V C+P +  V E++L G  LSG 
Sbjct  26   LNDDVLGLIVFKADIQDPKAKLGSWNEDDDSPCGWVGVNCNPRSNAVVELNLDGFSLSGH  85

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L  LSL+ NN +G +S ++  + NL+ L+LS N  SG+VP+       SL
Sbjct  86   IGRGLLQLQSLRKLSLSKNNLTGSLSAKIAHIDNLRVLDLSGNGFSGSVPEEFFRQCGSL  145

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+GN  SG + +S+
Sbjct  146  RVVSLAGNKFSGKIPESL  163



>ref|XP_007033525.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY04451.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=965

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLI FK+G+ DP + L +WSEDD+ PC W  VKC P   RV+E+ L GL LSG 
Sbjct  23   FNDDVLGLIFFKAGLDDPNAKLQSWSEDDNDPCNWMGVKCDPTTYRVTELHLDGLSLSGH  82

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            +GRGL +L+ L VLSL++NN +G I+ +L  + +L+ ++LS NS+SG +PD       SL
Sbjct  83   VGRGLLRLQFLQVLSLSNNNLTGPINSELSHIGSLKVIDLSGNSLSGLIPDDFFAQCGSL  142

Query  547  QFLDLSGNSLSGPVSDSM  600
              +  + N+L+G + DS+
Sbjct  143  GSVSFARNNLTGQIPDSL  160



>ref|XP_003533657.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
 gb|KHN29502.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=967

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+ DP   L++W+EDD+SPC W  VKC P++ RV+ + L G  LSG 
Sbjct  27   FNDDVLGLIVFKAGLDDPKRKLSSWNEDDNSPCNWEGVKCDPSSNRVTALVLDGFSLSGH  86

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            + RGL +L+ L +LSL+ NNF+G I+P L LL +LQ ++LS N++SG +P+       SL
Sbjct  87   VDRGLLRLQSLQILSLSRNNFTGSINPDLPLLGSLQVVDLSDNNLSGEIPEGFFQQCGSL  146

Query  547  QFLDLSGNSLSGPVSDSM  600
            + +  + N+L+G + +S+
Sbjct  147  RTVSFAKNNLTGKIPESL  164



>ref|XP_004173348.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
Length=964

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 92/136 (68%), Gaps = 1/136 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LN+DVLGLIVFK+ ++DP   LA+W+EDDD+PC W  +KC+P + RV E++L G  L+G+
Sbjct  25   LNEDVLGLIVFKADIEDPEGKLASWNEDDDNPCNWVGLKCNPRSNRVVELNLDGFSLNGR  84

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            +GRGL +L+ L  LSLA+NN +G +SP      NL+ ++LS N   G +PD       SL
Sbjct  85   LGRGLLQLQFLRKLSLANNNLTGNLSPNNARFENLRVVDLSGNGFHGMIPDDFFRQCGSL  144

Query  547  QFLDLSGNSLSGPVSD  594
            + + L+ N +SG + +
Sbjct  145  RVISLANNKISGKIPE  160


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = +1

Query  340  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  519
            D+    LS  +G+ L  L+   VL L+ N FSG ISP +G+L++LQ LNL KNS  G +P
Sbjct  366  DIKRSSLSTTVGKALVNLQ---VLDLSHNAFSGEISPDIGILSSLQVLNLCKNSFVGAIP  422

Query  520  DSLGNMSSLQFLDLSGNSLSGPVSDSM  600
            +S+G + +L FLDLS N L+G + +++
Sbjct  423  ESIGGLKALVFLDLSENQLNGSIPETL  449



>ref|XP_004138394.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN45839.1| hypothetical protein Csa_6G014590 [Cucumis sativus]
Length=964

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 92/136 (68%), Gaps = 1/136 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LN+DVLGLIVFK+ ++DP   LA+W+EDDD+PC W  +KC+P + RV E++L G  L+G+
Sbjct  25   LNEDVLGLIVFKADIEDPEGKLASWNEDDDNPCNWVGLKCNPRSNRVVELNLDGFSLNGR  84

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            +GRGL +L+ L  LSLA+NN +G +SP      NL+ ++LS N   G +PD       SL
Sbjct  85   LGRGLLQLQFLRKLSLANNNLTGNLSPNNARFENLRVVDLSGNGFHGMIPDDFFRQCGSL  144

Query  547  QFLDLSGNSLSGPVSD  594
            + + L+ N +SG + +
Sbjct  145  RVISLANNKISGKIPE  160


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = +1

Query  340  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  519
            D+    LS  +G+ L  L+   VL L+ N FSG ISP +G+L++LQ LNL KNS  G +P
Sbjct  366  DIKRSSLSTTVGKALVNLQ---VLDLSHNAFSGEISPDIGILSSLQVLNLCKNSFVGAIP  422

Query  520  DSLGNMSSLQFLDLSGNSLSGPVSDSM  600
            +S+G + +L FLDLS N L+G + +++
Sbjct  423  ESIGGLKALVFLDLSENQLNGSIPETL  449



>gb|EPS70735.1| hypothetical protein M569_04020, partial [Genlisea aurea]
Length=954

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 97/144 (67%), Gaps = 1/144 (1%)
 Frame = +1

Query  172  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  351
            G+ +  LNDDVLGLIVFK+ +QDP   L++W+E+DDS C W  VKC P + RVSE+ L G
Sbjct  1    GSGTPSLNDDVLGLIVFKADIQDPEGKLSSWNEEDDSACNWVSVKCDPRSKRVSELSLDG  60

Query  352  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSL  528
              L+GK+GRGL +L+ L  LSLA NN +G +S  L  L NL+ L+LS N+ SG++P D  
Sbjct  61   FSLTGKLGRGLLQLQFLRKLSLAKNNLTGSLSLSLAQLPNLKFLDLSDNAFSGSIPNDFF  120

Query  529  GNMSSLQFLDLSGNSLSGPVSDSM  600
               +SL+ + L+ N  SG +  S+
Sbjct  121  TQCASLRSISLALNRFSGQIPGSL  144



>emb|CBI25352.3| unnamed protein product [Vitis vinifera]
Length=847

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 95/142 (67%), Gaps = 5/142 (4%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGLIVFK+ +QDP S LA+W+EDDDSPC W  VKC+P + RV+++ L G  LSGK
Sbjct  26   LNDDVLGLIVFKADIQDPNSKLASWNEDDDSPCNWVGVKCNPRSNRVTDLVLDGFSLSGK  85

Query  370  IGRGLEKLE-----HLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  534
            IGRGL +L       L  +  +SN FSG +   +  L  L++L+LS N + G +P  + +
Sbjct  86   IGRGLLQLHVGSCSTLAAIDFSSNQFSGPLPSGIWSLNGLRSLDLSDNLLEGDIPKGIDS  145

Query  535  MSSLQFLDLSGNSLSGPVSDSM  600
            + +L+ ++LS N  SGP+ D +
Sbjct  146  LYNLRAINLSKNRFSGPLPDGI  167



>ref|XP_003605286.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES87483.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=866

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 97/139 (70%), Gaps = 2/139 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             N+D+LGLIVFK+G++DP + L++W+EDD SPC W  VKC P+  RVS + L G  LSG 
Sbjct  27   FNEDMLGLIVFKAGLEDPKNKLSSWNEDDYSPCNWEGVKCDPSTNRVSSLVLDGFSLSGH  86

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlgllt-nlqtlnlSKNSISGTVPDSLGNMS-S  543
            IG+ L +L+ L +LSL+ NNF+G I+  L +   NL+ ++LS+N++ GT+PD L     S
Sbjct  87   IGKSLMRLQFLQILSLSRNNFTGRINHDLLITLWNLKVVDLSENNLVGTIPDELFKQCWS  146

Query  544  LQFLDLSGNSLSGPVSDSM  600
            L+ L  + N+L+G + DS+
Sbjct  147  LRVLSFAKNNLTGTIPDSL  165



>ref|XP_008456780.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=964

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 91/136 (67%), Gaps = 1/136 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LN+DVLGLIVFK+ ++DP   LA+W+EDDD+PC W  +KC+P + RV E+ L G  L+G+
Sbjct  25   LNEDVLGLIVFKADIEDPEGKLASWNEDDDNPCNWVGLKCNPRSNRVVELHLDGFALNGR  84

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            +GRGL +L+ L  LSLA+NN +G +SP      NL+ ++LS N   G +PD       SL
Sbjct  85   LGRGLLQLQFLRKLSLANNNLTGNLSPNNARFENLRVVDLSGNGFHGMIPDDFFRQCGSL  144

Query  547  QFLDLSGNSLSGPVSD  594
            + + L+ N +SG + +
Sbjct  145  RVISLANNKISGKIPE  160


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 59/87 (68%), Gaps = 3/87 (3%)
 Frame = +1

Query  340  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  519
            D+    LS  +G+ L  L+   VL L+ N FSG ISP +G+L++LQ LNL KNS  G +P
Sbjct  366  DIKRSSLSTTVGKALANLQ---VLDLSHNAFSGEISPDIGILSSLQVLNLCKNSFVGAIP  422

Query  520  DSLGNMSSLQFLDLSGNSLSGPVSDSM  600
            +S+G++ +L FLDLS N L+G + +++
Sbjct  423  ESIGDLKALVFLDLSENQLNGSIPETL  449



>gb|AES79844.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=954

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 92/137 (67%), Gaps = 3/137 (2%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDD+LGLIVFK+G+QDP   L +W+EDD +PC W  VKC  +N RV+ V L G  LSG 
Sbjct  36   FNDDILGLIVFKAGLQDPKHKLISWNEDDYTPCNWEGVKCDSSNNRVTSVILDGFSLSGH  95

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            I RGL +L+ L  LSL+ NNF+G I+P L  L +LQ ++ S N++ GT+P+       SL
Sbjct  96   IDRGLLRLQFLQTLSLSGNNFTGFINPDLPKLGSLQVVDFSDNNLKGTIPEGFFQQCGSL  155

Query  547  QFLDLSGNSLSG--PVS  591
            + ++ + N+L+G  PVS
Sbjct  156  KTVNFAKNNLTGNIPVS  172


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  507
            +  +DL G  LSG I + +++L   N LSL  N+F+G I   +G L +L+ L+LS N  S
Sbjct  251  LKSLDLSGNLLSGGIPQSMQRLNSCNSLSLQGNSFTGNIPDWIGELKDLENLDLSANRFS  310

Query  508  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML  603
            G +P SLGN++ LQ L+ S N L+G + DSM+
Sbjct  311  GWIPKSLGNLNMLQRLNFSRNQLTGNLPDSMM  342



>ref|XP_003623626.1| Receptor-like protein kinase [Medicago truncatula]
Length=948

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 92/137 (67%), Gaps = 3/137 (2%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDD+LGLIVFK+G+QDP   L +W+EDD +PC W  VKC  +N RV+ V L G  LSG 
Sbjct  30   FNDDILGLIVFKAGLQDPKHKLISWNEDDYTPCNWEGVKCDSSNNRVTSVILDGFSLSGH  89

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            I RGL +L+ L  LSL+ NNF+G I+P L  L +LQ ++ S N++ GT+P+       SL
Sbjct  90   IDRGLLRLQFLQTLSLSGNNFTGFINPDLPKLGSLQVVDFSDNNLKGTIPEGFFQQCGSL  149

Query  547  QFLDLSGNSLSG--PVS  591
            + ++ + N+L+G  PVS
Sbjct  150  KTVNFAKNNLTGNIPVS  166


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  507
            +  +DL G  LSG I + +++L   N LSL  N+F+G I   +G L +L+ L+LS N  S
Sbjct  245  LKSLDLSGNLLSGGIPQSMQRLNSCNSLSLQGNSFTGNIPDWIGELKDLENLDLSANRFS  304

Query  508  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML  603
            G +P SLGN++ LQ L+ S N L+G + DSM+
Sbjct  305  GWIPKSLGNLNMLQRLNFSRNQLTGNLPDSMM  336



>ref|XP_010092789.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB52375.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=957

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 90/138 (65%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDV GLIVFK+G+QDP   L +W+EDD++P  W  VKC     RVSE+ L G  LSG 
Sbjct  23   FNDDVWGLIVFKAGLQDPEEKLISWNEDDENPSKWVGVKCDSQTNRVSELSLDGFSLSGH  82

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            I +GL +L+ L  LSL+ NNFSG I+P L  L  LQ ++LS+N +SG +PD       SL
Sbjct  83   IDKGLLRLQFLQKLSLSKNNFSGTINPDLPHLGGLQVIDLSENRLSGQIPDEFFQQCGSL  142

Query  547  QFLDLSGNSLSGPVSDSM  600
            + +  +GN L+G + +S+
Sbjct  143  REVSFAGNGLTGQIPESI  160



>ref|XP_009406353.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1025

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = +1

Query  166  AGGAE-SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  342
            AGGA+    LND+VLGLIVFKS ++DPA  LATW+E D +PC W+ V+C  A+ RV  +D
Sbjct  31   AGGADLPTPLNDEVLGLIVFKSVLEDPAGALATWNEADATPCNWSHVECGVASSRVVRLD  90

Query  343  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  522
            L  L LSG + RGL++L  L  LSLA NN SG I P L LL +L++L+LS+N+ SG +PD
Sbjct  91   LASLSLSGPLPRGLDRLPALASLSLADNNLSGPIPPGLSLLPSLRSLDLSRNAFSGRLPD  150

Query  523  SLGNMSSLQFLDLSGNSLSGPVSD  594
             L  +SS++ LDLS NSL+GP+ D
Sbjct  151  DLSLLSSIRSLDLSSNSLAGPIPD  174



>ref|XP_011095143.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=979

 Score =   115 bits (289),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+ DP S L +W+E+DDS C W  V+C     RVSE+ L G  LSG 
Sbjct  38   FNDDVLGLIVFKAGLTDPLSRLTSWNEEDDSACNWVGVRCDQDTNRVSELILDGFSLSGH  97

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSL  546
            +GR L +L+ L VL L+ NNFSG ++P L  + +LQ ++L++NS+SG +P+ L     SL
Sbjct  98   LGRSLIRLQFLRVLQLSRNNFSGSVNPILAQIPSLQVIDLTENSLSGFIPEELFQQCGSL  157

Query  547  QFLDLSGNSLSGPVSDSM  600
              + L+ N+L+G +  S+
Sbjct  158  NSISLAKNNLTGSIPPSL  175



>ref|XP_002990527.1| hypothetical protein SELMODRAFT_131809 [Selaginella moellendorffii]
 gb|EFJ08404.1| hypothetical protein SELMODRAFT_131809 [Selaginella moellendorffii]
Length=193

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 92/147 (63%), Gaps = 4/147 (3%)
 Frame = +1

Query  193  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  372
            NDDVLGLIVFK+ + DP   LA+WSED  SP  W  ++C P +G V++V L GL LSG +
Sbjct  16   NDDVLGLIVFKADLHDPRRALASWSEDSASPRNWTGIQCSPQSGTVTQVTLDGLELSGPL  75

Query  373  GRGLEKLEHLN---VLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  543
            GRGL KL+HL     L  + N  SG I   +G L+ L +L+LS NS+SG +P  LG    
Sbjct  76   GRGLLKLDHLQSLEALGASENRLSGSIPAGVGSLSRLSSLDLSHNSLSGEIPPELGQCQM  135

Query  544  LQFLDLSGNSLSGPVSDSMLENLGSLR  624
            L  LDLS N LSG +  S LE+L  L 
Sbjct  136  LVSLDLSYNLLSGEIP-SFLESLSRLE  161



>emb|CBI18033.3| unnamed protein product [Vitis vinifera]
Length=808

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 93/140 (66%), Gaps = 3/140 (2%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+QDP S L +W+EDD++PC W  VKC     RVSE+ L    LSG+
Sbjct  23   FNDDVLGLIVFKAGLQDPESKLISWNEDDNNPCNWAGVKCDRQTNRVSELLLDNFSLSGR  82

Query  370  IGRGLEKLEHLNVLS---LASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  540
            IGRGL +L+ L +LS    +SN  SG +   +  L  L++L+LS N + G +P+ +G++ 
Sbjct  83   IGRGLLRLQFLRILSGVNFSSNQLSGQLPDGIWSLYGLRSLDLSNNFLEGEIPEGIGSLY  142

Query  541  SLQFLDLSGNSLSGPVSDSM  600
            SL+ ++L  N  SG + DS+
Sbjct  143  SLRAINLGKNKFSGRIPDSI  162



>gb|KEH35536.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=989

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 99/151 (66%), Gaps = 3/151 (2%)
 Frame = +1

Query  157  TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRV  330
            T  A  A +  LNDDVLGLIVFK+ ++DP   L +W+EDD+S C  +W  VKC+P + RV
Sbjct  28   TVTAVKAVNPSLNDDVLGLIVFKADIKDPKGKLTSWNEDDESACGGSWVGVKCNPRSNRV  87

Query  331  SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  510
             EV+L+G  LSG+IGRGL++L+ L  L L +NN +G I+  +  + NL+ L+LS N++SG
Sbjct  88   VEVNLNGFSLSGRIGRGLQRLQFLRRLYLGNNNLTGSINANIATIDNLRVLDLSNNNLSG  147

Query  511  TVPDS-LGNMSSLQFLDLSGNSLSGPVSDSM  600
             VPD       S++ + L+ N  SG V  S+
Sbjct  148  VVPDDFFRQCGSMRVVSLARNRFSGNVPSSL  178



>ref|XP_009125388.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=925

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 85/150 (57%), Gaps = 24/150 (16%)
 Frame = +1

Query  175  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  354
            AE    NDDVLGLIVFK+G+ DP S LA+W+ +D  PC+W    C PA  +V+E+ L G 
Sbjct  22   AEDPTFNDDVLGLIVFKAGLDDPFSKLASWNSEDYDPCSWVGCVCDPATNQVTELRLDGF  81

Query  355  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  534
             LSG IGRGL +L+ L+ L L++NN +G ++                          L +
Sbjct  82   SLSGHIGRGLLRLQSLHTLVLSNNNLTGALN------------------------SELTH  117

Query  535  MSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
              +LQ LD SGN+LSG + D + E  GSLR
Sbjct  118  RGTLQLLDFSGNNLSGRIPDGLFEQCGSLR  147



>ref|XP_002870895.1| hypothetical protein ARALYDRAFT_486880 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47154.1| hypothetical protein ARALYDRAFT_486880 [Arabidopsis lyrata subsp. 
lyrata]
Length=968

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 82/145 (57%), Gaps = 24/145 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFKSG+ DP S L++W+ +D  PC W    C PA+ RVSE+ L    LSG 
Sbjct  25   FNDDVLGLIVFKSGLDDPLSKLSSWNSEDYDPCNWVGCTCDPASNRVSELRLDSFSLSGH  84

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +L+ L+ L L++NN +G ++P                           ++ SLQ
Sbjct  85   IGRGLLRLQFLHTLVLSNNNLTGTLNP------------------------EFPHLGSLQ  120

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +D SGNSLSG + D   E  GSLR
Sbjct  121  VVDFSGNSLSGRIPDGFFEQCGSLR  145



>ref|XP_006398567.1| hypothetical protein EUTSA_v10012579mg [Eutrema salsugineum]
 gb|ESQ40020.1| hypothetical protein EUTSA_v10012579mg [Eutrema salsugineum]
Length=972

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 82/145 (57%), Gaps = 24/145 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C P + RV+E+ L G  LSG 
Sbjct  26   FNDDVLGLIVFKAGLDDPYSKLASWNAEDYDPCNWAGCVCDPGSNRVTELRLDGFSLSGH  85

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +L+ L+ L L++NN +G ++P                           ++ +LQ
Sbjct  86   IGRGLLRLQFLHTLVLSNNNLTGTLNP------------------------EFPHLGTLQ  121

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             LD SGN+LSG + D   E  GSLR
Sbjct  122  VLDFSGNNLSGRIPDGFFEQCGSLR  146



>dbj|BAF79960.1| receptor-like kinase [Marchantia polymorpha]
Length=979

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 99/147 (67%), Gaps = 1/147 (1%)
 Frame = +1

Query  187  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  366
            +++D+V+ L+VFK+GV DP S L++W++ D  PC W  + C  A GRV+++ L GL LSG
Sbjct  35   RISDEVMALLVFKAGVIDPNSVLSSWNDIDMDPCHWTGITCSSATGRVTDITLVGLSLSG  94

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  546
             I R L KLE L  L+LA+NNF+G ++ +L   ++L+ LN+S N++SG++P S G+  +L
Sbjct  95   TIARALVKLEELQTLTLANNNFTGPLNGELAEFSDLKVLNVSHNALSGSIPASFGSAGNL  154

Query  547  QFLDLSGNSLSGPVSDSMLE-NLGSLR  624
              LDLS N+ +G +   +   N  SLR
Sbjct  155  YALDLSNNAFTGTLPPELFSYNCQSLR  181



>gb|EEC75203.1| hypothetical protein OsI_11455 [Oryza sativa Indica Group]
Length=971

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 97/143 (68%), Gaps = 1/143 (1%)
 Frame = +1

Query  163  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  342
            G G A +  L+DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ + 
Sbjct  21   GGGPASAAALDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPLTGRVAGLS  80

Query  343  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  522
            L G GLSGK+GRGL +LE L  LSL+ NNFSG +   L  L +LQ+L+LS N+ SG +PD
Sbjct  81   LAGFGLSGKLGRGLLRLESLQSLSLSGNNFSGDLPADLARLPDLQSLDLSANAFSGAIPD  140

Query  523  S-LGNMSSLQFLDLSGNSLSGPV  588
               G+  +L+ + L+ N+ SG V
Sbjct  141  GFFGHCRNLRDVSLANNAFSGDV  163



>ref|NP_195809.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL11557.1|AF424563_1 AT5g01890/T20L15_160 [Arabidopsis thaliana]
 emb|CAB82759.1| putative protein [Arabidopsis thaliana]
 gb|AAO42766.1| At5g01890/T20L15_160 [Arabidopsis thaliana]
 gb|ACN59360.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED90406.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
Length=967

 Score =   113 bits (282),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 81/145 (56%), Gaps = 24/145 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+ DP S L++W+ +D  PC W    C PA  RVSE+ L    LSG 
Sbjct  24   FNDDVLGLIVFKAGLDDPLSKLSSWNSEDYDPCNWVGCTCDPATNRVSELRLDAFSLSGH  83

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +L+ L+ L L++NN +G ++P                           ++ SLQ
Sbjct  84   IGRGLLRLQFLHTLVLSNNNLTGTLNP------------------------EFPHLGSLQ  119

Query  550  FLDLSGNSLSGPVSDSMLENLGSLR  624
             +D SGN+LSG + D   E  GSLR
Sbjct  120  VVDFSGNNLSGRIPDGFFEQCGSLR  144



>gb|KFK24685.1| hypothetical protein AALP_AA8G011600 [Arabis alpina]
Length=976

 Score =   113 bits (282),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 85/153 (56%), Gaps = 24/153 (16%)
 Frame = +1

Query  166  AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  345
            A   ++   NDDVLGLIVFKSG+ DP S L++W+ +D  PC W    C P+  RV+E+ L
Sbjct  21   AAAGQNPTFNDDVLGLIVFKSGLHDPLSKLSSWNSEDLDPCNWLGCICDPSTNRVTELRL  80

Query  346  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  525
             G  LSG IGRGL +L  L+ L L++NN +G ++P                         
Sbjct  81   DGFSLSGHIGRGLLRLNFLHTLLLSNNNLTGTLNP------------------------E  116

Query  526  LGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
              ++ SLQ LD SGN+LSG + D+  +  GSLR
Sbjct  117  FPHLGSLQVLDFSGNNLSGRIPDAFFQQCGSLR  149



>ref|XP_009589224.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Nicotiana tomentosiformis]
Length=938

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 88/103 (85%), Gaps = 1/103 (1%)
 Frame = +1

Query  319  NGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKN  498
            NGRVSE++L+GL LSGKIGRGLEKL+ L VLSL++NNF+G ISP+LGLL NL+ LNLS+N
Sbjct  2    NGRVSELNLNGLSLSGKIGRGLEKLQSLQVLSLSNNNFTGPISPELGLLINLENLNLSQN  61

Query  499  SISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLG-SLR  624
             +SG +P S+  M+SLQFLDLS NSLSGPVSD++ +N G SLR
Sbjct  62   GLSGNIPASISKMTSLQFLDLSENSLSGPVSDTIFDNCGNSLR  104


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 52/92 (57%), Gaps = 0/92 (0%)
 Frame = +1

Query  325  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  504
            ++ E  L G   SG++   +    HLN L L+ N F+G I   +  L  L  L LS N I
Sbjct  176  QLKEFLLQGNQFSGELPSDIGFCPHLNKLDLSENLFTGAIPESVQKLNALSFLTLSNNMI  235

Query  505  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSM  600
            +G  P  + NMSSL++LD SGNSL G + DS+
Sbjct  236  NGDFPQWISNMSSLEYLDFSGNSLEGSLPDSI  267


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = +1

Query  328  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  507
            ++++DL     +G I   ++KL  L+ L+L++N  +G     +  +++L+ L+ S NS+ 
Sbjct  201  LNKLDLSENLFTGAIPESVQKLNALSFLTLSNNMINGDFPQWISNMSSLEYLDFSGNSLE  260

Query  508  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML  603
            G++PDS+G++  L++L LSGN LSG +  SM+
Sbjct  261  GSLPDSIGDLKMLKYLSLSGNKLSGNIPKSMV  292



>gb|EMT18823.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=973

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = +1

Query  193  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  372
            NDDVLGLIVFK+ V DP   LATWSEDD+  CAW  + C P  GRVS ++L G GLSGK+
Sbjct  31   NDDVLGLIVFKADVVDPEGRLATWSEDDERACAWAGITCDPRTGRVSGLNLAGFGLSGKL  90

Query  373  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  549
            GRGL +LE L  LSL++NNFSG I P L  L +LQ+L+LS N+ SG +PD   G   +L+
Sbjct  91   GRGLLRLESLPSLSLSANNFSGDIPPDLARLPDLQSLDLSSNAFSGAIPDGFFGKCHALR  150

Query  550  FLDLSGNSLSGPVSD  594
             + L+ N+ +G   D
Sbjct  151  DVSLANNAFTGDTPD  165



>ref|XP_003557968.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brachypodium distachyon]
Length=970

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 94/146 (64%), Gaps = 1/146 (1%)
 Frame = +1

Query  160  SGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  339
            +G G      LNDDVLGLIVFK+ V DP   LATWSEDD+  CAW  V C P   RVS +
Sbjct  20   AGRGAGSVAALNDDVLGLIVFKADVVDPEGRLATWSEDDERACAWAGVTCDPRTSRVSGL  79

Query  340  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  519
             L G GLSGK+GRGL +LE L  LSL+ NNFSG +   L  L +LQ+L+LS N+ SG VP
Sbjct  80   SLDGFGLSGKLGRGLLRLESLQSLSLSRNNFSGDLPADLARLPDLQSLDLSSNAFSGAVP  139

Query  520  DS-LGNMSSLQFLDLSGNSLSGPVSD  594
            D   G   SL+ + L+ N+ SG + D
Sbjct  140  DGFFGKCHSLRDVSLANNAFSGGIPD  165



>ref|XP_006279331.1| hypothetical protein CARUB_v10012717mg [Capsella rubella]
 gb|EOA12229.1| hypothetical protein CARUB_v10012717mg [Capsella rubella]
Length=967

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 90/138 (65%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG 
Sbjct  24   FNDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGH  83

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            IGRGL +L+ L+ L L++NN +G ++P+   L +LQ +N S N++SG +PD       SL
Sbjct  84   IGRGLLRLQFLHTLVLSNNNLTGNLNPEFPRLGSLQVINFSGNNLSGRIPDGFFEQCGSL  143

Query  547  QFLDLSGNSLSGPVSDSM  600
            + + L+ N L+GP+  S+
Sbjct  144  RSVSLANNKLTGPLPVSL  161



>ref|XP_009415955.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1020

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 100/147 (68%), Gaps = 2/147 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LND+V+GLIVFK+ ++DP + LA+W+E D +PC W  V+C P   RV  + L  L LSG 
Sbjct  49   LNDEVMGLIVFKAALEDPTAALASWNEADATPCGWAHVRCDPRTSRVVRLALDSLSLSGP  108

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            + RGL++L  L  LSL++NN SG + P L LL  L++L+LS+NS SG++P  L  + S+ 
Sbjct  109  LPRGLDRLPALASLSLSNNNLSGPVPPGLSLLPALRSLDLSRNSFSGSLPGDLAFLPSIV  168

Query  550  FLDLSGNSLSGPVSDSMLE--NLGSLR  624
             LDLS N+LSGP+ DS+      GSLR
Sbjct  169  SLDLSSNALSGPLPDSLFSAATCGSLR  195


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 56/92 (61%), Gaps = 0/92 (0%)
 Frame = +1

Query  325  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  504
            R+  + L+G   SG I  G+    HL++L L+ N+F G +   +  L +L +L LS N +
Sbjct  267  RLRNLQLNGNRFSGTIPAGVGLCRHLSILDLSYNSFEGALPSSMRYLGSLTSLKLSDNQL  326

Query  505  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSM  600
            SG VP  +GN++++Q +DLS N L+G +  S+
Sbjct  327  SGDVPAWIGNLTTIQQVDLSNNKLAGNLPASL  358



>ref|XP_003567498.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brachypodium distachyon]
Length=1056

 Score =   110 bits (274),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 95/148 (64%), Gaps = 5/148 (3%)
 Frame = +1

Query  184  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  363
            + +N++VLGL+VF+S + DP+  L+ WSE D +PC W  V+C PA  RV  + L  L LS
Sbjct  35   MPVNEEVLGLVVFRSALADPSGALSAWSESDATPCGWAHVECDPATSRVLRLSLDNLFLS  94

Query  364  -----GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  528
                 G I RGL++L  L  LSLA NNFSG +SP L LL +L++L+LS N+ SG +P+  
Sbjct  95   STSGTGGIPRGLDRLPALQSLSLAGNNFSGNLSPGLSLLASLRSLDLSHNAFSGNLPEDF  154

Query  529  GNMSSLQFLDLSGNSLSGPVSDSMLENL  612
              + +L++LDL+ NS SG +  S    L
Sbjct  155  PFLPALRYLDLTANSFSGSLPTSFPSTL  182


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 51/88 (58%), Gaps = 0/88 (0%)
 Frame = +1

Query  325  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  504
            R+  +DL    LSG +  G+  L +L  + L+ N FSG I   +GL  +L  ++LS N+ 
Sbjct  231  RLRALDLSNNRLSGPVAAGIASLHNLKTVDLSGNRFSGAIPADIGLCPHLSRIDLSSNAF  290

Query  505  SGTVPDSLGNMSSLQFLDLSGNSLSGPV  588
             G +P S+G +SSL F   SGN LSG V
Sbjct  291  DGALPGSIGALSSLVFFSASGNRLSGQV  318



>ref|XP_008776998.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=1008

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 100/145 (69%), Gaps = 0/145 (0%)
 Frame = +1

Query  166  AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  345
            A G     LND+VLGLIVFKS ++DP + LA+WSE D + C W  V+C PA   V  + L
Sbjct  25   ADGDLPTPLNDEVLGLIVFKSALEDPTAALASWSETDATACGWAHVECDPATSHVLRLYL  84

Query  346  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  525
              L LSG + RGL++L +L  LS+++NN SG++   L LL  L +L+LS+N+ SG +P  
Sbjct  85   DSLSLSGPLPRGLDRLPYLESLSISNNNLSGLLPAGLSLLPRLHSLDLSRNAFSGRLPQD  144

Query  526  LGNMSSLQFLDLSGNSLSGPVSDSM  600
            LGN+++L+ LDLS NSLSGP+ DS+
Sbjct  145  LGNITNLRSLDLSSNSLSGPIPDSL  169



>ref|NP_001050035.1| Os03g0335500 [Oryza sativa Japonica Group]
 gb|ABF95811.1| leucine-rich repeat transmembrane protein kinase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11949.1| Os03g0335500 [Oryza sativa Japonica Group]
Length=971

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            L+DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ + L G GLSGK
Sbjct  30   LDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPLTGRVAGLSLAGFGLSGK  89

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            +GRGL +LE L  LSL+ NNFSG +   L  L +LQ+L+LS N+ SG +PD   G+  +L
Sbjct  90   LGRGLLRLESLQSLSLSGNNFSGDLPADLARLPDLQSLDLSANAFSGAIPDGFFGHCRNL  149

Query  547  QFLDLSGNSLSGPV  588
            + + L+ N+ SG V
Sbjct  150  RDVSLANNAFSGDV  163



>ref|XP_006650049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Oryza brachyantha]
Length=971

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +1

Query  196  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  375
            DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVVDPEGRLATWSEDDERPCAWASVTCDPLTGRVAGLSLAGFGLSGKLG  91

Query  376  RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQF  552
            RGL +LE L  LSL+ NNFSG +   L  L +LQ+L+LS N+ SG +PD   G+  SL+ 
Sbjct  92   RGLLRLESLQSLSLSRNNFSGDLPADLARLPDLQSLDLSSNAFSGAIPDGFFGHCRSLRD  151

Query  553  LDLSGNSLSGPV  588
            + L+ N+ SG V
Sbjct  152  ISLANNAFSGDV  163



>ref|XP_010451924.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=953

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 90/141 (64%), Gaps = 7/141 (5%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG 
Sbjct  24   FNDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGH  83

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL----GNM  537
            IGRGL +L+ L  L L++NN +G I+P+   L +LQ ++ S N +SG +P+      G++
Sbjct  84   IGRGLLRLQFLRALVLSNNNLTGTINPEFPHLGSLQVVDFSGNHLSGRIPEGFFEQCGSL  143

Query  538  SSLQFLDLSGNSLSGPVSDSM  600
            SS+ F   + N L+GP+  S+
Sbjct  144  SSVSF---ANNKLTGPLPLSL  161



>ref|XP_010424006.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Camelina sativa]
Length=959

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 78/144 (54%), Gaps = 24/144 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG 
Sbjct  24   FNDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGH  83

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +L+ L  L L++NN +G ++P                           ++ SLQ
Sbjct  84   IGRGLLRLQFLRALVLSNNNLTGTLNP------------------------EFPHLGSLQ  119

Query  550  FLDLSGNSLSGPVSDSMLENLGSL  621
             +D SGN LSG + +   E  GSL
Sbjct  120  VVDFSGNHLSGRIPEGFFEQCGSL  143



>ref|XP_010424007.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Camelina sativa]
Length=955

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 78/144 (54%), Gaps = 24/144 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG 
Sbjct  24   FNDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGH  83

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  549
            IGRGL +L+ L  L L++NN +G ++P                           ++ SLQ
Sbjct  84   IGRGLLRLQFLRALVLSNNNLTGTLNP------------------------EFPHLGSLQ  119

Query  550  FLDLSGNSLSGPVSDSMLENLGSL  621
             +D SGN LSG + +   E  GSL
Sbjct  120  VVDFSGNHLSGRIPEGFFEQCGSL  143



>ref|XP_010490496.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=967

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 90/141 (64%), Gaps = 7/141 (5%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
             NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG 
Sbjct  24   FNDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDSFSLSGH  83

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL----GNM  537
            IGRGL +L+ L  L L++NN +G ++P+   L +LQ ++ S N +SG +P+      G++
Sbjct  84   IGRGLLRLQFLRALVLSNNNLTGTLNPEFPHLGSLQVVDFSGNHLSGRIPEGFFEQCGSL  143

Query  538  SSLQFLDLSGNSLSGPVSDSM  600
            SS+ F   + N L+GP+  S+
Sbjct  144  SSVSF---ANNKLTGPLPLSL  161



>dbj|BAK06250.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=973

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = +1

Query  193  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  372
            NDDVLGLIVFK+ V DP   LATWSEDD+  CAW  + C P  GRVS ++L G GLSGK+
Sbjct  31   NDDVLGLIVFKADVVDPEGRLATWSEDDERACAWAGITCDPRTGRVSGLNLAGFGLSGKL  90

Query  373  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  549
            GRGL +LE L  LSL++NNFSG I P L  L +LQ+L+LS N+ S  +P+   G   +L+
Sbjct  91   GRGLLRLESLQSLSLSANNFSGDIPPDLARLPDLQSLDLSCNAFSAPIPEGFFGKCHALR  150

Query  550  FLDLSGNSLSGPVSD  594
             + L+ N+ +G   D
Sbjct  151  DVSLANNAFTGDTPD  165



>emb|CDP13903.1| unnamed protein product [Coffea canephora]
Length=898

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 89/137 (65%), Gaps = 6/137 (4%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL-----  354
            +NDDVLGLIVFK+ VQDP   LA+W+EDD+SPC WN V+C+P + RVSE+ L GL     
Sbjct  1    MNDDVLGLIVFKADVQDPQGKLASWNEDDESPCIWNGVQCNPRSNRVSELVLDGLSLADN  60

Query  355  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPq-lglltnlqtlnlSKNSISGTVPDSLG  531
             L+G +   L +L +L  L L+ N+ SG IS        +L++L+L+KN  SG +P SL 
Sbjct  61   NLTGSLTLSLGQLPNLRTLDLSGNSLSGPISSDFFQQCGSLRSLSLAKNKFSGQIPASLS  120

Query  532  NMSSLQFLDLSGNSLSG  582
            + S L  L++S N  SG
Sbjct  121  SCSMLTSLNISSNQFSG  137



>emb|CDY04822.1| BnaAnng00040D [Brassica napus]
Length=928

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 93/155 (60%), Gaps = 7/155 (5%)
 Frame = +1

Query  175  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  354
            AE    NDDVLGLIVFK+G+ DP S LA+W+ +D  PC+W    C PA  +V+E+ L G 
Sbjct  23   AEDPTFNDDVLGLIVFKAGLDDPFSKLASWNSEDYDPCSWVGCVCDPATNQVTELRLDGF  82

Query  355  GLSGKIGRGLEKLEHLNVLSL--ASNNFSGVISPqlglltnlqtlnlS--KNSISGTVPD  522
             LSG IGRGL +L+ L+ L L  + NN SG I P           ++S  +N ++G +P 
Sbjct  83   SLSGHIGRGLLRLQSLHTLLLDFSGNNLSGRI-PDGFFEQCGSLRSVSLGRNRLTGPLPV  141

Query  523  SLGNMSSLQFLDLSGNSLSG--PVSDSMLENLGSL  621
            SL   S+L  L+LS N LSG  P   S L++L SL
Sbjct  142  SLSYCSTLTHLNLSSNQLSGRLPRELSFLKSLKSL  176



>gb|EAZ26832.1| hypothetical protein OsJ_10748 [Oryza sativa Japonica Group]
Length=971

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            L+DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ + L   GLSGK
Sbjct  30   LDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPITGRVAGLSLACFGLSGK  89

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  546
            +GRGL +LE L  LSL+ NNFSG +   L  L +LQ+L+LS N+ SG +PD   G+  +L
Sbjct  90   LGRGLLRLESLQSLSLSGNNFSGDLPADLARLPDLQSLDLSANAFSGAIPDGFFGHCRNL  149

Query  547  QFLDLSGNSLSGPV  588
            + + L+ N+ SG V
Sbjct  150  RDVSLANNAFSGDV  163



>ref|XP_010670069.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=976

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = +1

Query  202  VLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRG  381
            VLGLIVFK+ ++DP   L +W+EDD+  C W  VKC+P + RVSE++L GL LSGK+GRG
Sbjct  36   VLGLIVFKADIKDPNGKLRSWNEDDNDSCKWYGVKCNPRSNRVSELNLDGLSLSGKLGRG  95

Query  382  LEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV-PDSLGNMSSLQFLD  558
            L +L+ L  LSL++NN +G +S  L  LTNL+ L+LS N+ SG +  D       L+ ++
Sbjct  96   LLQLQSLRKLSLSNNNLTGSLSSALVRLTNLRILDLSDNNFSGVMSSDFFRQCGPLRSIN  155

Query  559  LSGNSLSGPVSDSM  600
            L+ N  SG + DS+
Sbjct  156  LANNKFSGEIPDSL  169



>emb|CDY27220.1| BnaA09g35820D [Brassica napus]
Length=936

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 92/158 (58%), Gaps = 27/158 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGL+ FKS ++DP   LA+W+EDD +PCAWN VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLVAFKSDLRDPDQKLASWNEDDYTPCAWNGVKCHPRTNRVTELTLDGFSLSGR  88

Query  370  IGRGLEKLE---------------------------HLNVLSLASNNFSGVISPqlgllt  468
            IGRGL +L                             L V S+A N  +G I   +G  +
Sbjct  89   IGRGLLQLHLVSLKVVDLSGNGLSGSLPDGFFRQCGSLRVFSVAENKLTGKIPVSVGSCS  148

Query  469  nlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSG  582
            +L +LNLS N  SG++P  + ++++L+ LDLS N L G
Sbjct  149  SLASLNLSSNRFSGSMPLGIWSLNTLRSLDLSRNELEG  186



>ref|XP_001769840.1| predicted protein [Physcomitrella patens]
 gb|EDQ65402.1| predicted protein [Physcomitrella patens]
Length=947

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 88/138 (64%), Gaps = 1/138 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            ++DDVLGL+ FK+G+ DP   L +W EDD SPCAW  + C    GRVSE++L G  L G+
Sbjct  13   MSDDVLGLMAFKAGLHDPTEALRSWREDDASPCAWAGIVCDRVTGRVSELNLVGFSLIGQ  72

Query  370  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  546
            IGRGL KL+ L  L+L+ NN +G I  ++  L  L  L+LS N+++G +  D   +  SL
Sbjct  73   IGRGLIKLDELQTLNLSFNNLTGSIDAEVARLPILVLLDLSNNAMTGPMAEDFFTSCQSL  132

Query  547  QFLDLSGNSLSGPVSDSM  600
              L L GNSL+G +  S+
Sbjct  133  VSLYLVGNSLNGSIPASV  150



>emb|CDX85183.1| BnaC07g24940D, partial [Brassica napus]
Length=933

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 84/115 (73%), Gaps = 4/115 (3%)
 Frame = +1

Query  280  SPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlg  459
            SPC+W +VKC+P   RV+E+ L GL L+GKIGRG++KL+HL VLSL++NN +G I+  L 
Sbjct  2    SPCSWTYVKCNPKTSRVTELSLSGLSLTGKIGRGIQKLQHLKVLSLSNNNLTGNIA-ALS  60

Query  460  lltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
               +LQ L+LS NS+SG +  SL   +SL++LDL+GNS SG +SD +  N  SLR
Sbjct  61   NNNHLQKLDLSHNSLSGQISSSL---TSLRYLDLTGNSFSGTLSDDVFTNCSSLR  112



>emb|CDX72142.1| BnaC08g27320D [Brassica napus]
Length=936

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 91/158 (58%), Gaps = 27/158 (17%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            LNDDVLGL+ FKS ++DP   LA+W+EDD +PCAWN VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLVAFKSDLRDPDQKLASWNEDDYTPCAWNGVKCHPRTNRVTELTLDGFSLSGR  88

Query  370  IGRGLEKLE--HLNVLSLASNNFSGVISPq-lglltnlqtlnlSKNSISGTVPDSLG---  531
            IGRGL +L    L V+ L+ N  SG +         +L+  ++++N ++G +P S+G   
Sbjct  89   IGRGLLQLHLVSLKVVDLSGNGLSGSLPDGFFRQCGSLRAFSVAENKLTGKIPVSVGSCS  148

Query  532  ---------------------NMSSLQFLDLSGNSLSG  582
                                 ++++L+ LDLS N L G
Sbjct  149  SLASLNLSSNGFSGSMPLGIWSLNTLRSLDLSRNELEG  186



>ref|XP_011076585.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Sesamum indicum]
Length=987

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 98/139 (71%), Gaps = 2/139 (1%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCA-WNFVKCHPANGRVSEVDLHGLGLSG  366
            LNDDVLGLIVFK+ ++DP   L++W+EDDDSPC  W  VKC+P + RVSE+ L G GLSG
Sbjct  25   LNDDVLGLIVFKADIRDPDQKLSSWNEDDDSPCNNWIGVKCNPRSNRVSELVLDGFGLSG  84

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV-PDSLGNMSS  543
            K+GRGL +L+ L  LSLA NN +G +S  L  L++L+ L+LS+N + G++  D      S
Sbjct  85   KLGRGLLQLQSLQKLSLAKNNLTGSLSLSLAQLSDLRVLDLSENGLWGSISSDFFMQCGS  144

Query  544  LQFLDLSGNSLSGPVSDSM  600
            L+ + L+ N  SGP+ +S+
Sbjct  145  LRSISLARNKFSGPIPESL  163



>gb|EAY76307.1| hypothetical protein OsI_04242 [Oryza sativa Indica Group]
Length=947

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 93/169 (55%), Gaps = 27/169 (16%)
 Frame = +1

Query  196  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  375
            DDVL L+VFK+GV DP   LA W+EDDD PC+W  V C    GRV+ + L G  LSG++ 
Sbjct  29   DDVLALVVFKTGVADPMGRLAAWTEDDDRPCSWPGVGCDARAGRVTSLSLPGASLSGRLP  88

Query  376  RGLEKLEHLNVLSLASNNFSGVISPqlgll--------------------------tnlq  477
            R L +L+ L  LSL  NN SG + P L                              +++
Sbjct  89   RALLRLDALASLSLPRNNLSGPVLPGLLAALPRLRSLDLSSNRLAAPVPAELFAQCRSIR  148

Query  478  tlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
             L+L++N +SG +P ++ + +SL  L+LS N L+GP+ D  L +L SLR
Sbjct  149  ALSLARNELSGYIPPAVTSCASLVSLNLSSNRLAGPIPDG-LWSLPSLR  196



>dbj|BAB85306.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAB86487.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
Length=947

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 93/169 (55%), Gaps = 27/169 (16%)
 Frame = +1

Query  196  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  375
            DDVL L+VFK+GV DP   LA W+EDDD PC+W  V C    GRV+ + L G  LSG++ 
Sbjct  29   DDVLALVVFKTGVADPMGRLAAWTEDDDRPCSWPGVGCDARAGRVTSLSLPGASLSGRLP  88

Query  376  RGLEKLEHLNVLSLASNNFSGVISPqlgll--------------------------tnlq  477
            R L +L+ L  LSL  NN SG + P L                              +++
Sbjct  89   RALLRLDALASLSLPRNNLSGPVLPGLLAALPRLRSLDLSSNRLAAPVPAELFAQCRSIR  148

Query  478  tlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
             L+L++N +SG +P ++ + +SL  L+LS N L+GP+ D  L +L SLR
Sbjct  149  ALSLARNELSGYIPPAVTSCASLVSLNLSSNRLAGPIPDG-LWSLPSLR  196



>ref|XP_002990711.1| hypothetical protein SELMODRAFT_132189, partial [Selaginella 
moellendorffii]
 gb|EFJ08160.1| hypothetical protein SELMODRAFT_132189, partial [Selaginella 
moellendorffii]
Length=908

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 86/125 (69%), Gaps = 1/125 (1%)
 Frame = +1

Query  238  DPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSL  417
            DP   LA+WSED  SPC W  ++C P +GRV++V L GL LSG +GRGL KL+HL VLSL
Sbjct  1    DPRRALASWSEDSASPCNWTGIQCSPQSGRVTQVTLDGLELSGPLGRGLLKLDHLQVLSL  60

Query  418  ASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSLQFLDLSGNSLSGPVSD  594
            A NN SG ISPQ+ +L +L+ L+LS N++SG +P  SL ++  L  LD+S NS SG V  
Sbjct  61   ARNNLSGSISPQIRVLKSLRNLSLSHNALSGPLPGASLASLELLSLLDVSHNSFSGSVPP  120

Query  595  SMLEN  609
             +  N
Sbjct  121  ELFAN  125



>ref|XP_009789234.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=972

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 96/143 (67%), Gaps = 1/143 (1%)
 Frame = +1

Query  175  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  354
            A +L  NDD+LGL+VFK+ +QDP  +L +W+E+DDSPC WN +KC+P + RVS++ L G 
Sbjct  21   ALNLSFNDDILGLMVFKADIQDPLGNLVSWNEEDDSPCNWNGIKCNPRSNRVSQIVLDGF  80

Query  355  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLG  531
            GLSGKI RGL +L+ L  LSLA NNF+G IS  +  L NL+ L+LS+N+  G +P D   
Sbjct  81   GLSGKISRGLLRLQLLRKLSLAKNNFTGSISSTVVQLDNLRVLDLSENNFFGLIPGDFFR  140

Query  532  NMSSLQFLDLSGNSLSGPVSDSM  600
                L+ + L+ N   G +  S+
Sbjct  141  QCGPLRSVSLAKNKFLGKIPGSL  163



>ref|XP_002439964.1| hypothetical protein SORBIDRAFT_09g023480 [Sorghum bicolor]
 gb|EES18394.1| hypothetical protein SORBIDRAFT_09g023480 [Sorghum bicolor]
Length=944

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 90/146 (62%), Gaps = 4/146 (3%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            ++DDVL L+V KSG+ DP+  LA WSED D  CAW  V C P  GRV+ +DL    L+G+
Sbjct  47   VSDDVLALVVLKSGLSDPSGRLAPWSEDADRACAWPGVSCDPRTGRVAALDLPAASLAGR  106

Query  370  IGR-GLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  546
            + R  L +L+ L  L+L  N  SG +     L   L+ L+LS N+ISG +P SL +  SL
Sbjct  107  LPRSALLRLDALVSLALPGNRLSGALP--DALPPRLRALDLSGNAISGGIPASLASCDSL  164

Query  547  QFLDLSGNSLSGPVSDSMLENLGSLR  624
              L+LS N L+GPV D +  +L SLR
Sbjct  165  VSLNLSRNRLTGPVPDGIW-SLPSLR  189


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 60/101 (59%), Gaps = 1/101 (1%)
 Frame = +1

Query  322  GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  501
             R+  ++L    +SG++   +  +  L VL +++N F GV+ P++G    L+ L + +NS
Sbjct  377  ARLQYLNLSSNSMSGQLPASIGLMLVLEVLDVSANKFEGVVPPEIGGAMALRQLLMGRNS  436

Query  502  ISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            ++G +P  +G   SL  LDLS N L+GP+  SM  NL SL+
Sbjct  437  LTGGIPVQIGTCKSLIALDLSHNKLAGPIPMSM-GNLASLQ  476



>ref|XP_001759642.1| predicted protein [Physcomitrella patens]
 gb|EDQ75554.1| predicted protein [Physcomitrella patens]
Length=901

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 90/151 (60%), Gaps = 2/151 (1%)
 Frame = +1

Query  172  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  351
            GAE++   D+   L+ FK+ + D  S L TW  +D  PC W+ + C   N  V+ ++L  
Sbjct  30   GAEAIA-TDEGWALLDFKNAISDSRSTLRTWKSEDSYPCEWSGISCD-KNSHVTSINLRN  87

Query  352  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  531
             GLSG I   L +L  L +L L+ NNFSG I PQL  + +L  L L  N+++G++P  L 
Sbjct  88   AGLSGTIALELHRLRKLRILILSENNFSGPIPPQLSEIGSLWKLKLDHNNLTGSIPGELS  147

Query  532  NMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  624
            ++S+L+  DLS N+LSGP++D++      LR
Sbjct  148  HLSNLRIFDLSYNALSGPINDTIFRTCRRLR  178



>ref|XP_004961741.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=942

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 89/146 (61%), Gaps = 4/146 (3%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            ++DDVL L+V KSG+ DPA  LA WSED D  C+W  V C P  GRV+ ++L    L+G+
Sbjct  46   VSDDVLALVVLKSGLSDPAGRLAPWSEDADRACSWPGVSCDPRTGRVAALELPAASLAGR  105

Query  370  IGR-GLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  546
            + R  L +L+ L  L+L  N  SG +     L   L+ L+LS N+IS  +P SL +  SL
Sbjct  106  LPRSALLRLDALVSLALPGNRLSGALP--DALPPRLRALDLSGNAISSGIPASLASCESL  163

Query  547  QFLDLSGNSLSGPVSDSMLENLGSLR  624
              L+LS N L+GPV D +  +L SLR
Sbjct  164  VSLNLSRNQLTGPVPDGIW-SLPSLR  188



>emb|CDY14823.1| BnaC04g48200D [Brassica napus]
Length=640

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 90/145 (62%), Gaps = 4/145 (3%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQ-DPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  366
            LN D L L+  KS V+ DP   +  WSE D +PC W+ V C   NGRV+ ++L G  LSG
Sbjct  24   LNSDGLSLLALKSAVENDPTKVMNHWSESDQTPCHWSGVAC--TNGRVTSLNLFGKSLSG  81

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  546
             I   L  L+ LN L LA NNFS  +  +L   TNL+ ++LS NS+SG +PD + ++ SL
Sbjct  82   YIPSELGLLDSLNRLDLAHNNFSKPVPVRLFEPTNLRYIDLSHNSLSGPIPDQIRHLKSL  141

Query  547  QFLDLSGNSLSGPVSDSMLENLGSL  621
              LDLS N L+G + +S+ E LGSL
Sbjct  142  NHLDLSSNRLNGSLPESLTE-LGSL  165



>emb|CDY47962.1| BnaA04g24400D [Brassica napus]
Length=645

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 89/145 (61%), Gaps = 4/145 (3%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGV-QDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  366
            LN D L L+  KS V  DP   +  WSE D +PC W+ V C   NGRV+ ++L G  LSG
Sbjct  24   LNSDGLSLLALKSAVDNDPTKVMNHWSESDQTPCHWSGVAC--TNGRVTSLNLFGKSLSG  81

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  546
             I   L  L+ LN L LA NNFS  +  +L   TNL+ ++LS NS+SG +PD + ++ SL
Sbjct  82   YIPSELGLLDSLNRLDLAHNNFSKPVPVRLFEPTNLRYIDLSHNSLSGPIPDQIRHLKSL  141

Query  547  QFLDLSGNSLSGPVSDSMLENLGSL  621
              LDLS N L+G + +S+ E LGSL
Sbjct  142  NHLDLSSNRLNGSLPESLAE-LGSL  165



>ref|XP_009142052.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Brassica rapa]
Length=642

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 89/145 (61%), Gaps = 4/145 (3%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGV-QDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  366
            LN D L L+  KS V  DP   +  WSE D +PC W+ V C   NGRV+ ++L G  LSG
Sbjct  24   LNSDGLSLLALKSAVDNDPTKVMNHWSESDQTPCHWSGVAC--TNGRVTSLNLFGKSLSG  81

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  546
             I   L  L+ LN L LA NNFS  +  +L   TNL+ ++LS NS+SG +PD + ++ SL
Sbjct  82   YIPSELGLLDSLNRLDLAHNNFSKPVPVRLFEPTNLRYIDLSHNSLSGPIPDQIRHLKSL  141

Query  547  QFLDLSGNSLSGPVSDSMLENLGSL  621
              LDLS N L+G + +S+ E LGSL
Sbjct  142  NHLDLSSNRLNGSLPESLAE-LGSL  165



>ref|XP_002458686.1| hypothetical protein SORBIDRAFT_03g038240 [Sorghum bicolor]
 gb|EES03806.1| hypothetical protein SORBIDRAFT_03g038240 [Sorghum bicolor]
Length=948

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 88/183 (48%), Gaps = 50/183 (27%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            L DDVL L+VFK+ V DP+  LATW+EDDD PC+W  V C    GRV+ + L    LSG+
Sbjct  26   LTDDVLALVVFKTDVSDPSGRLATWTEDDDRPCSWPAVGCDARTGRVTSLSLPAASLSGR  85

Query  370  IGR----------------------------GLEKLEHLNV-------------------  408
            + R                             L +L  L++                   
Sbjct  86   LPRALLRLDALLSLALPRNNLSGPVLPNLLTALPRLRSLDLSSNRLAAPVPAQLFAQCRA  145

Query  409  ---LSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  579
               +SLA N  SG I P +    +L +LNLS N ++G +PD L ++ SL+ LDLSGN LS
Sbjct  146  VRAISLAHNQLSGYIPPAVASCASLVSLNLSSNRLAGPIPDGLWSLPSLRSLDLSGNELS  205

Query  580  GPV  588
            G V
Sbjct  206  GSV  208


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +1

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  543
            G++  G+  +  L VL +++N   G + P++G    L+ L + +NS++G +P  +GN SS
Sbjct  397  GQLPAGIGGMRLLEVLDVSANRLEGTVPPEIGGTVALRDLRMGRNSLTGRIPSQIGNCSS  456

Query  544  LQFLDLSGNSLSGPVSDSMLENLGSLR  624
            L  LD S N+L GP+  SM  NL SL+
Sbjct  457  LIALDFSHNNLMGPIPSSM-GNLTSLQ  482



>ref|XP_008649763.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Zea mays]
 gb|AFW78385.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=938

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 87/144 (60%), Gaps = 4/144 (3%)
 Frame = +1

Query  196  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  375
            DDVL L+V KSG+ DPA  LA WSED D  CAW  V C     RV+ +DL    L+G++ 
Sbjct  44   DDVLALVVLKSGLFDPAGRLAPWSEDADRACAWPGVSCDSRTDRVAALDLPAASLAGRLP  103

Query  376  R-GLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  552
            R  L +L+ L  L+L  N  SG +     L   L++L+LS N+ISG +P SL +  SL  
Sbjct  104  RAALLRLDALVSLALPGNRLSGTLP--DALPPRLRSLDLSGNAISGGIPASLASCESLVS  161

Query  553  LDLSGNSLSGPVSDSMLENLGSLR  624
            L+LS N L+GPV D +  +L SLR
Sbjct  162  LNLSRNRLTGPVPDGIW-SLPSLR  184



>ref|NP_001055847.2| Os05g0478300 [Oryza sativa Japonica Group]
 gb|AAT01367.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17761.2| Os05g0478300 [Oryza sativa Japonica Group]
Length=917

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 82/146 (56%), Gaps = 4/146 (3%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  369
            +NDDVL L+VFKSGV DP   LA WSED D  CAW  V C    GRV  V L   GLSG+
Sbjct  23   VNDDVLALVVFKSGVSDPGGVLAAWSEDADRACAWPGVSCDARAGRVDAVALPSAGLSGR  82

Query  370  IGRGLEKLEHLNVLSLA-SNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  546
            + R         +      NN SG +     L    + L+LS NS+SG +P +L +  SL
Sbjct  83   LPRSALLRLDALLSLALPGNNLSGPLP--DALPPRARALDLSANSLSGYLPAALASCGSL  140

Query  547  QFLDLSGNSLSGPVSDSMLENLGSLR  624
              L+LSGN LSGPV D +  +L SLR
Sbjct  141  VSLNLSGNLLSGPVPDGIW-SLPSLR  165



>ref|XP_004970391.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=946

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 87/181 (48%), Gaps = 50/181 (28%)
 Frame = +1

Query  196  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  375
            DDVL L+VFK+GV DP+  LATW+EDDD PC+W  V C    GRV+ + L    LSG++ 
Sbjct  26   DDVLALVVFKTGVSDPSGRLATWTEDDDRPCSWPGVGCDARTGRVTSLSLPAASLSGRLP  85

Query  376  ----------------------------------RGLE----------------KLEHLN  405
                                              R L+                +  ++ 
Sbjct  86   PALLRLDALLSLALPRNNLSGPVLPNLLAALPRLRSLDLSSNRLAAPVPAQLFAQCRYIR  145

Query  406  VLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGP  585
             +SLA N  SG I P +    +L +LNLS N ++G +PD L ++ SL+ LDLSGN LSG 
Sbjct  146  AISLAHNQLSGYIPPAVTSCASLVSLNLSSNRLAGPIPDGLWSLPSLRSLDLSGNELSGS  205

Query  586  V  588
            V
Sbjct  206  V  206


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = +1

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  543
            G++  G+  +  L VL +++N   G + P++G    L+ L + +NS++G +P  +GN SS
Sbjct  395  GQLPAGIGGMRLLEVLDVSANRLDGTVPPEIGGAVALRDLRMGRNSLTGGIPAQIGNCSS  454

Query  544  LQFLDLSGNSLSGPVSDSMLENLGSLR  624
            L  LDLS NSL+GP+  +M  NL SL+
Sbjct  455  LVALDLSHNSLTGPIPSTM-GNLTSLQ  480



>ref|NP_001055909.1| Os05g0491400 [Oryza sativa Japonica Group]
 gb|AAT69645.1| unknown protein, contains LRR domain [Oryza sativa Japonica Group]
 dbj|BAF17823.1| Os05g0491400 [Oryza sativa Japonica Group]
 gb|EEE64195.1| hypothetical protein OsJ_19027 [Oryza sativa Japonica Group]
Length=216

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 79/131 (60%), Gaps = 1/131 (1%)
 Frame = +1

Query  208  GLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  387
             L  F+ G+ DP   LA+W  D  +PC W  V C+ A+ RV  +DL  + LSG +   L 
Sbjct  35   ALTEFRKGMSDPDGALASWDPDLVNPCTWFRVTCN-ADNRVIRLDLEEMNLSGHLSADLA  93

Query  388  KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  567
            +L+ L  + +ASNN  G I P+ G L NL +L+L  N+ISG +P SLG + SL+F+ +  
Sbjct  94   RLDQLQFMEIASNNIEGPIPPEFGNLENLISLDLCNNTISGPIPPSLGKLKSLKFMRIDH  153

Query  568  NSLSGPVSDSM  600
            N L+GP+ + +
Sbjct  154  NLLTGPIPNEL  164



>ref|XP_008659447.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Zea mays]
 gb|AFW86332.1| hypothetical protein ZEAMMB73_446534 [Zea mays]
Length=199

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 84/149 (56%), Gaps = 1/149 (1%)
 Frame = +1

Query  166  AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  345
            +G A  +  N +V  L+V KS ++DP   L  W  +   PC W+F+ C P N  V+ ++ 
Sbjct  20   SGLAAPMDFNHEVQVLMVIKSLLKDPYGALRNWDRNSVDPCTWSFISCSPEN-LVTALEA  78

Query  346  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  525
                LSG++   +  L  L  L L +NN  G I  ++G L  L+TL LS N + GTVP+S
Sbjct  79   PSKNLSGRLSPSIGNLTKLEKLQLQNNNIIGPIPAEIGKLAKLRTLVLSSNKLHGTVPNS  138

Query  526  LGNMSSLQFLDLSGNSLSGPVSDSMLENL  612
            LG +  LQ++DLS N+LSGP+  +    L
Sbjct  139  LGRLGRLQYIDLSYNNLSGPIPKTSARTL  167



>gb|EAY98521.1| hypothetical protein OsI_20433 [Oryza sativa Indica Group]
Length=216

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 79/131 (60%), Gaps = 1/131 (1%)
 Frame = +1

Query  208  GLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  387
             L  F+ G+ DP   LA+W  D  +PC W  V C+ A+ RV  +DL  + LSG +   L 
Sbjct  35   ALTEFRKGMSDPDGALASWDPDLVNPCTWFRVTCN-ADNRVIRLDLEEMNLSGHLSADLA  93

Query  388  KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  567
            +L+ L  + +ASNN  G I P+ G L NL +L+L  N+ISG +P S+G + SL+F+ +  
Sbjct  94   RLDQLQFMEIASNNIEGPIPPEFGNLENLISLDLCNNTISGPIPPSVGKLKSLKFMRIDH  153

Query  568  NSLSGPVSDSM  600
            N L+GP+ + +
Sbjct  154  NLLTGPIPNEL  164



>ref|XP_004491185.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Cicer 
arietinum]
Length=218

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 76/132 (58%), Gaps = 1/132 (1%)
 Frame = +1

Query  208  GLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  387
             L   K  + DP + L +W     SPC W  V C+  N RV+ VDL    LSG +   L 
Sbjct  33   ALYTLKRSLTDPDNVLQSWDPTLVSPCTWFHVTCNQDN-RVTRVDLGNSNLSGHLVPELG  91

Query  388  KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  567
            KLEHL  L L  NN  G I P+LG L +L +L+L  N+ISGTVP SLG + +L FL L+ 
Sbjct  92   KLEHLQYLELYKNNIQGTIPPELGNLRSLVSLDLYNNNISGTVPPSLGKLKNLVFLRLND  151

Query  568  NSLSGPVSDSML  603
            N L+GP+   ++
Sbjct  152  NRLTGPIPRELI  163



>ref|NP_181758.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AAD23712.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 gb|ACN59308.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEC10101.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=646

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 84/145 (58%), Gaps = 4/145 (3%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGV-QDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  366
            LN D L L+  KS V  DP   +  WSE D +PC W+ + C   NGRV+ + L G  LSG
Sbjct  24   LNSDGLSLLALKSAVDNDPTRVMTHWSESDPTPCHWSGIVC--TNGRVTTLVLFGKSLSG  81

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  546
             I   L  L  LN L LA NNFS  I  +L   T L+ ++LS NS+SG +P  + +M SL
Sbjct  82   YIPSELGLLNSLNRLDLAHNNFSKTIPVRLFEATKLRYIDLSHNSLSGPIPAQIKSMKSL  141

Query  547  QFLDLSGNSLSGPVSDSMLENLGSL  621
              LD S N L+G + +S+ E LGSL
Sbjct  142  NHLDFSSNHLNGSLPESLTE-LGSL  165



>gb|KHG13399.1| hypothetical protein F383_10003 [Gossypium arboreum]
Length=785

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 93/154 (60%), Gaps = 10/154 (6%)
 Frame = +1

Query  181  SLQLNDDVLGLIVFKSGV-QDPASHLATWSEDDDSPCAWNFVKCH-------PANGRVSE  336
            +L LN D + L+ FK  +  DP S L +W+ DD +PCAW  V C        P   RV+ 
Sbjct  23   TLALNTDGVLLLSFKHAILSDPLSVLQSWNRDDKTPCAWTGVTCTEIGLPGTPDRLRVTS  82

Query  337  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  516
            + L    L G I   L  ++HL  L L+SNNF+G++   +   T LQ L+LS N ISG++
Sbjct  83   LVLPNSHLHGSISEDLGHIQHLRHLDLSSNNFNGILPSSIFNSTELQVLSLSANLISGSL  142

Query  517  PDSLGNMSSLQFLDLSGNSLSGPVSDSM--LENL  612
            P+++G ++SLQ L+LS N+L+G V +++  L+NL
Sbjct  143  PETIGALASLQLLNLSHNALAGKVPENLTALQNL  176



>ref|XP_006293827.1| hypothetical protein CARUB_v10022811mg [Capsella rubella]
 gb|EOA26725.1| hypothetical protein CARUB_v10022811mg [Capsella rubella]
Length=642

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 86/145 (59%), Gaps = 4/145 (3%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGV-QDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  366
            LN D L L+  KS V  DP   +  WSE D +PC W+ + C   NGRV+ + L G  LSG
Sbjct  21   LNSDGLSLLALKSAVDNDPTRVMTHWSESDPTPCRWSGIVC--TNGRVTSLVLFGKSLSG  78

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  546
             I   L  L+ +N L LA NNFS  +  +L   TNL+ ++LS NS+SG +P  + +M SL
Sbjct  79   YIPSELGLLDSMNRLDLAHNNFSKTVPVRLFQATNLRYIDLSHNSLSGPIPAQIKSMKSL  138

Query  547  QFLDLSGNSLSGPVSDSMLENLGSL  621
              LD S N L+G + +S+ E LGSL
Sbjct  139  NHLDFSSNHLNGSLPESLTE-LGSL  162



>ref|XP_006293826.1| hypothetical protein CARUB_v10022811mg [Capsella rubella]
 gb|EOA26724.1| hypothetical protein CARUB_v10022811mg [Capsella rubella]
Length=608

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 86/145 (59%), Gaps = 4/145 (3%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGV-QDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  366
            LN D L L+  KS V  DP   +  WSE D +PC W+ + C   NGRV+ + L G  LSG
Sbjct  21   LNSDGLSLLALKSAVDNDPTRVMTHWSESDPTPCRWSGIVC--TNGRVTSLVLFGKSLSG  78

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  546
             I   L  L+ +N L LA NNFS  +  +L   TNL+ ++LS NS+SG +P  + +M SL
Sbjct  79   YIPSELGLLDSMNRLDLAHNNFSKTVPVRLFQATNLRYIDLSHNSLSGPIPAQIKSMKSL  138

Query  547  QFLDLSGNSLSGPVSDSMLENLGSL  621
              LD S N L+G + +S+ E LGSL
Sbjct  139  NHLDFSSNHLNGSLPESLTE-LGSL  162



>ref|XP_004246027.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 2 isoform X1 [Solanum lycopersicum]
Length=589

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 82/147 (56%), Gaps = 2/147 (1%)
 Frame = +1

Query  181  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  360
            +L LN D   L+ F+  +      L  W  +D  PC W  V+C   + RV+ + L    L
Sbjct  26   TLALNPDGQALVNFRIAISGSDGVLEQWRPEDSDPCGWKGVQCDSKSKRVTSLSLPNHKL  85

Query  361  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  540
            SG I   + KL+ L  L+L  NNF G I P LG  TNL++L L  N +SG +PD LGN+ 
Sbjct  86   SGYISPDIGKLDQLQFLALHDNNFYGAIPPALGNCTNLKSLFLQSNYLSGWIPDELGNLP  145

Query  541  SLQFLDLSGNSLSGPVSDSM--LENLG  615
             L+ LDLS NSLSG +  S+  L NLG
Sbjct  146  ELENLDLSSNSLSGNIPPSLGKLNNLG  172



>ref|XP_010517745.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
Length=648

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 86/145 (59%), Gaps = 4/145 (3%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGV-QDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  366
            LN D L L+  KS V  DP   +  WSE D +PC W+ + C   NGRV+ + L G  LSG
Sbjct  24   LNSDGLSLLALKSAVDNDPTRVMTHWSESDPTPCRWSGIVC--TNGRVTSLVLLGKSLSG  81

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  546
             I   L  L+ LN L LA NNFS  +  +L   T L+ ++LS NS+SG +P  + +M+SL
Sbjct  82   YIPSELGLLDSLNRLDLAHNNFSKTVPVRLFQATKLRYIDLSHNSLSGPIPVQIKSMTSL  141

Query  547  QFLDLSGNSLSGPVSDSMLENLGSL  621
              LD S N L+G + +S+ E LGSL
Sbjct  142  NHLDFSSNHLNGSLPESLAE-LGSL  165



>ref|NP_001241394.1| somatic embryogenesis receptor kinase 1-like precursor [Glycine 
max]
 gb|ACM89589.1| leucine-rich repeat protein [Glycine max]
 gb|KHN26025.1| Somatic embryogenesis receptor kinase 1 [Glycine soja]
Length=218

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 75/131 (57%), Gaps = 1/131 (1%)
 Frame = +1

Query  208  GLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  387
             L   K  + DP + L +W     SPC W  V C+  N RV+ VDL    LSG +   L 
Sbjct  33   ALYTLKRSLSDPDNVLQSWDPTLVSPCTWFHVTCNQDN-RVTRVDLGNSNLSGHLVPELG  91

Query  388  KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  567
            KLEHL  L L  NN  G I P+LG L +L +L+L  N+ISGT+P SLG + +L FL L+ 
Sbjct  92   KLEHLQYLELYKNNIQGTIPPELGNLKSLVSLDLYNNNISGTIPPSLGKLKNLVFLRLND  151

Query  568  NSLSGPVSDSM  600
            N L+GP+   +
Sbjct  152  NRLTGPIPKEL  162



>dbj|BAK02926.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1171

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 83/140 (59%), Gaps = 2/140 (1%)
 Frame = +1

Query  187  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDS-PCAWNFVKCHPANGRVSEVDLHGLGLS  363
            ++  ++  L+ F++ ++DP + +A W     S PC+W  V C+ A+GRV E+ L  L L+
Sbjct  48   EVQAEIDALLAFRAALRDPYAAMAGWDASSPSAPCSWRGVACNAASGRVVELQLPRLRLA  107

Query  364  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMS  540
            G +   L  L HL  LSL SN  +G I P L  L +L+ + L  N++SG +P S L N++
Sbjct  108  GPVSPALASLRHLQKLSLRSNALTGAIPPALARLASLRAVFLQDNALSGPIPPSFLANLT  167

Query  541  SLQFLDLSGNSLSGPVSDSM  600
             L+  D+S N LSGPV  ++
Sbjct  168  GLETFDVSANLLSGPVPPAL  187


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = +1

Query  337  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  516
            +DL G  L+G I   L +L+ L  L L+ N  S  I P++  +++L TL L  N + G +
Sbjct  630  LDLSGNHLTGPIPSDLSRLDELEELDLSHNQLSSKIPPEISNISSLATLKLDDNHLVGEI  689

Query  517  PDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENL  612
            P SL N+S LQ LDLS NS++G  PVS + + +L
Sbjct  690  PASLANLSKLQALDLSSNSITGSIPVSLAQIPSL  723


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = +1

Query  325  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  504
            ++  V L     SG +  G   L  L  L+++ N+F+G I    G + +LQ L+ S N I
Sbjct  554  QLQHVSLADNSFSGDVPEGFSSLWSLRHLNISVNSFAGSIPATYGYMASLQVLSASHNRI  613

Query  505  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSM  600
            SG VP  L N S+L  LDLSGN L+GP+   +
Sbjct  614  SGEVPAELANCSNLTVLDLSGNHLTGPIPSDL  645



>gb|KHN38434.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 [Glycine 
soja]
Length=197

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 75/131 (57%), Gaps = 1/131 (1%)
 Frame = +1

Query  208  GLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  387
             L   K  + DP + L +W     SPC W  V C+  N RV+ VDL    LSG +   L 
Sbjct  35   ALYTLKRSLSDPDNVLQSWDPTLVSPCTWFHVTCNQDN-RVTRVDLGNSNLSGHLVPELG  93

Query  388  KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  567
            KLEHL  L L  NN  G I P+LG L +L +L+L  N+ISGT+P SLG + +L FL L+ 
Sbjct  94   KLEHLQYLELYKNNIQGTIPPELGSLKSLVSLDLYNNNISGTIPPSLGKLKNLVFLRLND  153

Query  568  NSLSGPVSDSM  600
            N L+GP+   +
Sbjct  154  NRLTGPIPKEL  164



>gb|ACU19288.1| unknown [Glycine max]
Length=218

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 75/131 (57%), Gaps = 1/131 (1%)
 Frame = +1

Query  208  GLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  387
             L   K  + DP + L +W     SPC W  V C+  N RV+ VDL    LSG +   L 
Sbjct  33   ALYTLKRSLSDPDNVLQSWDPTLVSPCTWFHVTCNQDN-RVTRVDLGNSNLSGHLVPELG  91

Query  388  KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  567
            KLEHL  L L  NN  G I P+LG L +L +L+L  N+ISGT+P SLG + +L FL L+ 
Sbjct  92   KLEHLQYLELYKNNIQGTIPPELGNLKSLVSLDLYNNNISGTIPPSLGKLKNLVFLRLND  151

Query  568  NSLSGPVSDSM  600
            N L+GP+   +
Sbjct  152  NRLTGPIPKEL  162



>ref|XP_010506042.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
Length=644

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 86/145 (59%), Gaps = 4/145 (3%)
 Frame = +1

Query  190  LNDDVLGLIVFKSGV-QDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  366
            LN D L L+  KS V  DP   +  WSE D +PC W+ + C   NGRV+ + L G  LSG
Sbjct  24   LNSDGLSLLALKSAVDNDPTRVMTHWSESDPTPCHWSGIVC--TNGRVTSLVLLGKSLSG  81

Query  367  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  546
             I   L  L+ LN L LA NNFS  +  +L   T L+ ++LS NS+SG +P  + +M+SL
Sbjct  82   YIPSELGLLDSLNRLDLAHNNFSKTVPVRLFAATKLRYIDLSHNSLSGPIPVQIKSMTSL  141

Query  547  QFLDLSGNSLSGPVSDSMLENLGSL  621
              LD S N L+G + +S+ E LGSL
Sbjct  142  NHLDFSSNHLNGSLPESLAE-LGSL  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380