BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS059D10

Length=641
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006366590.1|  PREDICTED: aconitate hydratase 2, mitochondr...    162   6e-42   Solanum tuberosum [potatoes]
ref|XP_004243472.1|  PREDICTED: aconitate hydratase, cytoplasmic        162   6e-42   Solanum lycopersicum
dbj|BAG16527.1|  putative aconitase                                     157   3e-40   Capsicum chinense [bonnet pepper]
gb|KDP22711.1|  hypothetical protein JCGZ_01813                         156   6e-40   Jatropha curcas
ref|XP_009770911.1|  PREDICTED: aconitate hydratase, cytoplasmic        155   1e-39   Nicotiana sylvestris
ref|XP_006376779.1|  aconitate hydratase family protein                 154   3e-39   Populus trichocarpa [western balsam poplar]
ref|XP_002524184.1|  aconitase, putative                                153   9e-39   Ricinus communis
ref|XP_011047264.1|  PREDICTED: aconitate hydratase, cytoplasmic        153   1e-38   Populus euphratica
emb|CDP10817.1|  unnamed protein product                                152   2e-38   Coffea canephora [robusta coffee]
ref|XP_010276105.1|  PREDICTED: aconitate hydratase, cytoplasmic        152   2e-38   Nelumbo nucifera [Indian lotus]
ref|XP_011048785.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    151   4e-38   Populus euphratica
ref|XP_011095404.1|  PREDICTED: putative aconitate hydratase, cyt...    151   4e-38   Sesamum indicum [beniseed]
ref|XP_009601350.1|  PREDICTED: aconitate hydratase, cytoplasmic        151   4e-38   Nicotiana tomentosiformis
emb|CDP05740.1|  unnamed protein product                                150   9e-38   Coffea canephora [robusta coffee]
ref|XP_002321126.2|  hypothetical protein POPTR_0014s15170g             149   2e-37   Populus trichocarpa [western balsam poplar]
ref|XP_010046497.1|  PREDICTED: aconitate hydratase, cytoplasmic        146   2e-36   Eucalyptus grandis [rose gum]
gb|KDO62733.1|  hypothetical protein CISIN_1g001863mg                   145   3e-36   Citrus sinensis [apfelsine]
ref|XP_006452377.1|  hypothetical protein CICLE_v10007338mg             145   5e-36   Citrus clementina [clementine]
gb|EPS60517.1|  hypothetical protein M569_14286                         142   4e-35   Genlisea aurea
ref|XP_006351962.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    142   5e-35   Solanum tuberosum [potatoes]
ref|XP_009598331.1|  PREDICTED: aconitate hydratase 2, mitochondr...    140   2e-34   Nicotiana tomentosiformis
ref|XP_009598330.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    140   3e-34   Nicotiana tomentosiformis
gb|KDO54659.1|  hypothetical protein CISIN_1g001917mg                   139   4e-34   Citrus sinensis [apfelsine]
gb|KDO54661.1|  hypothetical protein CISIN_1g001917mg                   139   4e-34   Citrus sinensis [apfelsine]
gb|KDO54656.1|  hypothetical protein CISIN_1g001917mg                   140   4e-34   Citrus sinensis [apfelsine]
ref|XP_006447556.1|  hypothetical protein CICLE_v10014140mg             139   4e-34   
gb|KDO54660.1|  hypothetical protein CISIN_1g001917mg                   139   5e-34   Citrus sinensis [apfelsine]
gb|KDO54657.1|  hypothetical protein CISIN_1g001917mg                   139   5e-34   Citrus sinensis [apfelsine]
ref|XP_006447555.1|  hypothetical protein CICLE_v10014140mg             139   6e-34   Citrus clementina [clementine]
ref|XP_010278679.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    139   1e-33   Nelumbo nucifera [Indian lotus]
ref|XP_002278138.1|  PREDICTED: aconitate hydratase, cytoplasmic        137   3e-33   Vitis vinifera
gb|EYU27339.1|  hypothetical protein MIMGU_mgv1a000710mg                137   5e-33   Erythranthe guttata [common monkey flower]
ref|XP_009787326.1|  PREDICTED: aconitate hydratase 2, mitochondr...    134   2e-32   Nicotiana sylvestris
ref|XP_009787319.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    134   3e-32   Nicotiana sylvestris
gb|KJB60836.1|  hypothetical protein B456_009G327800                    131   2e-31   Gossypium raimondii
gb|KJB60837.1|  hypothetical protein B456_009G327800                    131   2e-31   Gossypium raimondii
gb|KJB60835.1|  hypothetical protein B456_009G327800                    132   3e-31   Gossypium raimondii
ref|XP_007045642.1|  Aconitase 3                                        131   4e-31   
ref|XP_003543388.1|  PREDICTED: aconitate hydratase 2, mitochondr...    131   4e-31   Glycine max [soybeans]
gb|KHN36531.1|  Aconitate hydratase, cytoplasmic                        130   9e-31   Glycine soja [wild soybean]
ref|XP_004251517.2|  PREDICTED: aconitate hydratase, cytoplasmic        129   2e-30   Solanum lycopersicum
gb|EYU24785.1|  hypothetical protein MIMGU_mgv1a000742mg                129   3e-30   Erythranthe guttata [common monkey flower]
gb|KJB50479.1|  hypothetical protein B456_008G173400                    129   3e-30   Gossypium raimondii
ref|XP_003540302.1|  PREDICTED: aconitate hydratase 2, mitochondr...    127   8e-30   Glycine max [soybeans]
ref|XP_006346211.1|  PREDICTED: aconitate hydratase 2, mitochondr...    127   1e-29   Solanum tuberosum [potatoes]
gb|KHG15607.1|  Aconitate hydratase 2, mitochondrial -like protein      125   2e-29   Gossypium arboreum [tree cotton]
gb|KDP39136.1|  hypothetical protein JCGZ_00893                         125   5e-29   Jatropha curcas
ref|XP_011100304.1|  PREDICTED: aconitate hydratase, cytoplasmic        125   5e-29   Sesamum indicum [beniseed]
gb|KHG18502.1|  Aconitate hydratase 2, mitochondrial -like protein      124   8e-29   Gossypium arboreum [tree cotton]
ref|XP_007149973.1|  hypothetical protein PHAVU_005G115100g             124   9e-29   Phaseolus vulgaris [French bean]
ref|XP_010445106.1|  PREDICTED: aconitate hydratase 3, mitochondr...    120   1e-28   
ref|XP_010448188.1|  PREDICTED: aconitate hydratase 3, mitochondr...    123   2e-28   Camelina sativa [gold-of-pleasure]
gb|KJB62848.1|  hypothetical protein B456_009G440000                    123   2e-28   Gossypium raimondii
ref|XP_006283068.1|  hypothetical protein CARUB_v10004061mg             123   2e-28   Capsella rubella
gb|KJB62847.1|  hypothetical protein B456_009G440000                    123   2e-28   Gossypium raimondii
ref|XP_008455442.1|  PREDICTED: aconitate hydratase, cytoplasmic        123   2e-28   Cucumis melo [Oriental melon]
ref|XP_008379632.1|  PREDICTED: aconitate hydratase, cytoplasmic        123   2e-28   
ref|XP_004159202.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    123   3e-28   
ref|NP_567763.2|  aconitase 2                                           123   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAK91447.1|  AT4g26970/F10M23_310                                    123   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869584.1|  hypothetical protein ARALYDRAFT_492099             122   4e-28   
ref|XP_009353280.1|  PREDICTED: aconitate hydratase, cytoplasmic        122   4e-28   Pyrus x bretschneideri [bai li]
ref|XP_003596988.1|  Aconitate hydratase                                122   4e-28   Medicago truncatula
ref|XP_004144496.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    122   6e-28   Cucumis sativus [cucumbers]
ref|XP_009599619.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    122   6e-28   Nicotiana tomentosiformis
ref|XP_009769027.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    121   1e-27   Nicotiana sylvestris
ref|XP_003527493.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    120   2e-27   Glycine max [soybeans]
ref|XP_006592372.1|  PREDICTED: aconitate hydratase 2, mitochondr...    120   2e-27   Glycine max [soybeans]
ref|XP_003539865.1|  PREDICTED: aconitate hydratase 2, mitochondr...    120   3e-27   Glycine max [soybeans]
gb|KJB30566.1|  hypothetical protein B456_005G149700                    119   5e-27   Gossypium raimondii
gb|KJB30569.1|  hypothetical protein B456_005G149700                    119   5e-27   Gossypium raimondii
ref|XP_006413121.1|  hypothetical protein EUTSA_v10024309mg             119   6e-27   Eutrema salsugineum [saltwater cress]
ref|XP_010433420.1|  PREDICTED: aconitate hydratase 3, mitochondrial    119   7e-27   Camelina sativa [gold-of-pleasure]
emb|CDY14291.1|  BnaA08g14220D                                          119   8e-27   Brassica napus [oilseed rape]
emb|CDY66424.1|  BnaAnng22230D                                          119   9e-27   Brassica napus [oilseed rape]
gb|KHG08190.1|  Aconitate hydratase 2, mitochondrial                    118   1e-26   Gossypium arboreum [tree cotton]
ref|XP_004487412.1|  PREDICTED: aconitate hydratase 2, mitochondr...    118   1e-26   Cicer arietinum [garbanzo]
ref|XP_009109156.1|  PREDICTED: aconitate hydratase 3, mitochondrial    118   2e-26   Brassica rapa
ref|XP_008230066.1|  PREDICTED: aconitate hydratase, cytoplasmic        116   5e-26   Prunus mume [ume]
ref|XP_010488774.1|  PREDICTED: aconitate hydratase 2, mitochondrial    116   8e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010467089.1|  PREDICTED: aconitate hydratase 2, mitochondr...    115   9e-26   Camelina sativa [gold-of-pleasure]
ref|XP_007217144.1|  hypothetical protein PRUPE_ppa000812mg             115   9e-26   Prunus persica
ref|XP_008342002.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    115   1e-25   
ref|XP_002883704.1|  hypothetical protein ARALYDRAFT_480186             114   3e-25   
gb|KFK29204.1|  hypothetical protein AALP_AA7G102800                    114   3e-25   Arabis alpina [alpine rockcress]
ref|XP_010675721.1|  PREDICTED: putative aconitate hydratase, cyt...    114   4e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010412716.1|  PREDICTED: aconitate hydratase 2, mitochondr...    113   6e-25   
ref|XP_010929878.1|  PREDICTED: putative aconitate hydratase, cyt...    112   1e-24   Elaeis guineensis
emb|CDY50945.1|  BnaC03g74450D                                          112   2e-24   Brassica napus [oilseed rape]
ref|XP_006296904.1|  hypothetical protein CARUB_v10012896mg             111   3e-24   Capsella rubella
ref|XP_010443085.1|  PREDICTED: aconitate hydratase 3, mitochondr...    110   8e-24   Camelina sativa [gold-of-pleasure]
gb|KFK39331.1|  hypothetical protein AALP_AA3G230700                    110   1e-23   Arabis alpina [alpine rockcress]
ref|XP_008804304.1|  PREDICTED: putative aconitate hydratase, cyt...    110   1e-23   Phoenix dactylifera
ref|XP_009136177.1|  PREDICTED: aconitate hydratase 2, mitochondrial    109   2e-23   Brassica rapa
ref|XP_009148490.1|  PREDICTED: aconitate hydratase 2, mitochondrial    109   2e-23   Brassica rapa
emb|CDX97969.1|  BnaA06g07200D                                          109   2e-23   
gb|KHG02134.1|  hypothetical protein F383_25649                         108   2e-23   Gossypium arboreum [tree cotton]
ref|XP_003605929.1|  Aconitate hydratase                                107   5e-23   Medicago truncatula
emb|CDY18054.1|  BnaC07g04160D                                          107   7e-23   Brassica napus [oilseed rape]
ref|XP_010450391.1|  PREDICTED: aconitate hydratase 2, mitochondr...    107   8e-23   Camelina sativa [gold-of-pleasure]
ref|NP_178634.2|  aconitate hydratase 3                                 106   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396145.1|  hypothetical protein EUTSA_v10002387mg             106   2e-22   Eutrema salsugineum [saltwater cress]
ref|XP_002279260.1|  PREDICTED: aconitate hydratase, cytoplasmic        106   2e-22   Vitis vinifera
emb|CDX93088.1|  BnaA03g38100D                                          105   2e-22   
ref|XP_010440740.1|  PREDICTED: aconitate hydratase 2, mitochondr...    104   6e-22   Camelina sativa [gold-of-pleasure]
ref|XP_002870438.1|  predicted protein                                  104   9e-22   Arabidopsis lyrata subsp. lyrata
emb|CDY56501.1|  BnaAnng14360D                                          104   9e-22   Brassica napus [oilseed rape]
ref|XP_010533007.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    102   4e-21   Tarenaya hassleriana [spider flower]
ref|XP_007132546.1|  hypothetical protein PHAVU_011G1037001g            102   5e-21   Phaseolus vulgaris [French bean]
ref|XP_004287944.1|  PREDICTED: aconitate hydratase, cytoplasmic        101   8e-21   Fragaria vesca subsp. vesca
ref|XP_002532564.1|  aconitase, putative                                100   1e-20   
ref|XP_004517086.1|  PREDICTED: aconitate hydratase 2, mitochondr...  99.8    3e-20   Cicer arietinum [garbanzo]
ref|XP_010482909.1|  PREDICTED: putative aconitate hydratase, cyt...  98.2    1e-19   
ref|XP_008800034.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  95.9    6e-19   Phoenix dactylifera
ref|XP_010943467.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  95.1    1e-18   Elaeis guineensis
ref|XP_010918136.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  95.1    1e-18   Elaeis guineensis
ref|XP_008785050.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  94.4    2e-18   Phoenix dactylifera
ref|XP_009419582.1|  PREDICTED: putative aconitate hydratase, cyt...  93.2    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399225.1|  PREDICTED: putative aconitate hydratase, cyt...  90.1    6e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006828850.1|  hypothetical protein AMTR_s00001p00156400        89.7    8e-17   Amborella trichopoda
gb|EEC83022.1|  hypothetical protein OsI_28099                        85.9    3e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_008676648.1|  PREDICTED: uncharacterized protein LOC100216...  86.3    1e-15   
ref|XP_009382046.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  86.3    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007020811.1|  Aconitase 3                                      85.5    2e-15   
ref|XP_002445174.1|  hypothetical protein SORBIDRAFT_07g005390        85.1    3e-15   Sorghum bicolor [broomcorn]
ref|XP_004974379.1|  PREDICTED: putative aconitate hydratase, cyt...  84.7    3e-15   
ref|XP_009384004.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  84.3    4e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAD25640.1|  cytoplasmic aconitate hydratase                       82.4    2e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAP30039.1|  aconitase                                             80.5    7e-14   Solanum pennellii
gb|AAO62410.1|  aconitase                                             80.5    8e-14   Solanum pennellii
gb|AAG28426.1|AF194945_1  cytosolic aconitase                         79.7    2e-13   Nicotiana tabacum [American tobacco]
ref|XP_003573387.2|  PREDICTED: putative aconitate hydratase, cyt...  78.6    4e-13   Brachypodium distachyon [annual false brome]
gb|KJB30565.1|  hypothetical protein B456_005G149700                  77.0    1e-12   Gossypium raimondii
gb|KHG08189.1|  hypothetical protein F383_11434                       76.6    1e-12   Gossypium arboreum [tree cotton]
sp|Q6YZX6.1|ACOC_ORYSJ  RecName: Full=Putative aconitate hydratas...  75.9    2e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAC26045.1|  aconitase-iron regulated protein 1                    75.9    2e-12   Citrus limon [lemon]
emb|CBE71057.1|  aconitate hydratase 3                                75.5    3e-12   Citrus clementina [clementine]
gb|ADM34980.1|  cytosolic aconitase                                   75.5    3e-12   Pyrus pyrifolia [sha li]
gb|KHN41224.1|  Aconitate hydratase, cytoplasmic                      74.3    7e-12   Glycine soja [wild soybean]
emb|CBE71058.1|  aconitate hydratase 2                                74.3    7e-12   Citrus clementina [clementine]
ref|XP_011097878.1|  PREDICTED: putative aconitate hydratase, cyt...  73.6    1e-11   
sp|P49608.1|ACOC_CUCMA  RecName: Full=Aconitate hydratase, cytopl...  73.2    2e-11   Cucurbita maxima [Boston marrow]
dbj|BAJ85661.1|  predicted protein                                    70.5    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004287770.1|  PREDICTED: aconitate hydratase 1                 70.1    2e-10   Fragaria vesca subsp. vesca
ref|XP_008363093.1|  PREDICTED: aconitate hydratase 1-like            65.1    2e-10   
emb|CAA58046.1|  aconitase                                            69.7    2e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36543.1|  putative aconitase                                   69.3    3e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30197.1|  hypothetical protein AALP_AA7G230700                  69.3    3e-10   Arabis alpina [alpine rockcress]
ref|XP_007046597.1|  Aconitase 1                                      68.9    4e-10   
gb|KDO71343.1|  hypothetical protein CISIN_1g002610mg                 68.9    5e-10   Citrus sinensis [apfelsine]
gb|KDO71342.1|  hypothetical protein CISIN_1g002610mg                 68.9    5e-10   Citrus sinensis [apfelsine]
ref|XP_007020807.1|  Aconitase 3                                      68.9    5e-10   
ref|XP_006413195.1|  hypothetical protein EUTSA_v10024325mg           68.9    5e-10   
gb|KDO71344.1|  hypothetical protein CISIN_1g002610mg                 68.6    5e-10   Citrus sinensis [apfelsine]
emb|CDX69174.1|  BnaC01g02790D                                        68.6    6e-10   
gb|KDO71346.1|  hypothetical protein CISIN_1g002610mg                 68.6    6e-10   Citrus sinensis [apfelsine]
ref|NP_195308.1|  aconitate hydratase 1                               68.2    7e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007203240.1|  hypothetical protein PRUPE_ppa001138mg           68.2    7e-10   Prunus persica
ref|XP_008242011.1|  PREDICTED: aconitate hydratase 1                 68.2    8e-10   Prunus mume [ume]
ref|XP_006285963.1|  hypothetical protein CARUB_v10007484mg           68.2    8e-10   Capsella rubella
gb|AAL13084.1|  putative aconitase                                    68.2    8e-10   Prunus avium [gean]
ref|XP_010526818.1|  PREDICTED: aconitate hydratase 1                 68.2    8e-10   Tarenaya hassleriana [spider flower]
ref|XP_009109264.1|  PREDICTED: aconitate hydratase 1-like            68.2    8e-10   Brassica rapa
ref|XP_010437416.1|  PREDICTED: aconitate hydratase 1-like            68.2    8e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010446873.1|  PREDICTED: aconitate hydratase 1                 67.8    9e-10   Camelina sativa [gold-of-pleasure]
ref|XP_009150005.1|  PREDICTED: aconitate hydratase 1                 67.8    9e-10   Brassica rapa
ref|XP_002445994.1|  hypothetical protein SORBIDRAFT_06g000200        63.2    1e-09   
ref|XP_006412056.1|  hypothetical protein EUTSA_v10024358mg           66.6    2e-09   Eutrema salsugineum [saltwater cress]
ref|XP_010432222.1|  PREDICTED: aconitate hydratase 1-like            66.6    2e-09   Camelina sativa [gold-of-pleasure]
gb|KHG25176.1|  Aconitate hydratase, cytoplasmic                      66.2    3e-09   Gossypium arboreum [tree cotton]
ref|XP_006412054.1|  hypothetical protein EUTSA_v10024358mg           66.2    3e-09   
gb|KHG25175.1|  Aconitate hydratase, cytoplasmic                      66.2    3e-09   Gossypium arboreum [tree cotton]
ref|XP_009344825.1|  PREDICTED: aconitate hydratase 1                 66.2    3e-09   Pyrus x bretschneideri [bai li]
ref|XP_009363442.1|  PREDICTED: aconitate hydratase 1-like            66.2    3e-09   Pyrus x bretschneideri [bai li]
gb|KJB48278.1|  hypothetical protein B456_008G061900                  66.2    3e-09   Gossypium raimondii
ref|XP_009337075.1|  PREDICTED: aconitate hydratase 1-like            66.2    3e-09   Pyrus x bretschneideri [bai li]
ref|XP_008337967.1|  PREDICTED: aconitate hydratase 1                 66.2    3e-09   
emb|CDX75532.1|  BnaA01g01700D                                        65.9    4e-09   
emb|CBE71056.1|  aconitate hydratase 1                                65.9    4e-09   Citrus clementina [clementine]
ref|XP_006467022.1|  PREDICTED: aconitate hydratase 1                 65.9    4e-09   Citrus sinensis [apfelsine]
gb|KDP23953.1|  hypothetical protein JCGZ_25341                       65.9    4e-09   Jatropha curcas
gb|KHN41868.1|  Aconitate hydratase 1                                 65.9    4e-09   Glycine soja [wild soybean]
emb|CDY41626.1|  BnaC03g62580D                                        65.9    4e-09   Brassica napus [oilseed rape]
ref|XP_008669746.1|  PREDICTED: putative aconitate hydratase, cyt...  65.5    5e-09   Zea mays [maize]
gb|EMS45933.1|  Putative aconitate hydratase, cytoplasmic             65.1    6e-09   Triticum urartu
gb|KDO71345.1|  hypothetical protein CISIN_1g002610mg                 65.1    6e-09   Citrus sinensis [apfelsine]
ref|XP_006425366.1|  hypothetical protein CICLE_v10024840mg           65.1    8e-09   Citrus clementina [clementine]
ref|XP_002460765.1|  hypothetical protein SORBIDRAFT_02g034590        64.7    9e-09   Sorghum bicolor [broomcorn]
ref|XP_006380559.1|  hypothetical protein POPTR_0007s09260g           64.3    1e-08   Populus trichocarpa [western balsam poplar]
emb|CBI24446.3|  unnamed protein product                              63.9    2e-08   Vitis vinifera
ref|XP_010100637.1|  Aconitate hydratase                              63.9    2e-08   
ref|XP_008669747.1|  PREDICTED: putative aconitate hydratase, cyt...  63.9    2e-08   Zea mays [maize]
ref|XP_010113288.1|  Aconitate hydratase 1                            63.9    2e-08   
ref|XP_010266897.1|  PREDICTED: aconitate hydratase 1                 63.5    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_003517155.1|  PREDICTED: aconitate hydratase 1                 63.5    2e-08   Glycine max [soybeans]
gb|EMT33022.1|  Putative aconitate hydratase, cytoplasmic             63.5    2e-08   
ref|XP_002263337.1|  PREDICTED: aconitate hydratase 1                 63.5    2e-08   Vitis vinifera
ref|XP_007157870.1|  hypothetical protein PHAVU_002G105000g           63.5    2e-08   Phaseolus vulgaris [French bean]
ref|NP_001147431.1|  aconitase2                                       63.2    3e-08   Zea mays [maize]
ref|XP_011022256.1|  PREDICTED: aconitate hydratase 1                 63.2    3e-08   Populus euphratica
ref|XP_006383042.1|  aconitate hydratase family protein               62.8    4e-08   Populus trichocarpa [western balsam poplar]
gb|KJB17578.1|  hypothetical protein B456_003G006000                  62.4    5e-08   Gossypium raimondii
ref|XP_008661884.1|  PREDICTED: aconitase2 isoform X1                 62.4    5e-08   
gb|AES61065.2|  cytoplasmic-like aconitate hydratase                  62.4    5e-08   Medicago truncatula
ref|XP_003537655.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  62.0    7e-08   Glycine max [soybeans]
emb|CDY24823.1|  BnaA08g14870D                                        61.6    9e-08   Brassica napus [oilseed rape]
dbj|BAJ92965.1|  predicted protein                                    61.2    1e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002867051.1|  aconitate hydratase, cytoplasmic                 60.8    2e-07   
ref|XP_004985790.1|  PREDICTED: putative aconitate hydratase, cyt...  60.8    2e-07   Setaria italica
ref|XP_010029634.1|  PREDICTED: aconitate hydratase 1                 60.5    2e-07   Eucalyptus grandis [rose gum]
gb|KCW56576.1|  hypothetical protein EUGRSUZ_I02307                   60.5    2e-07   Eucalyptus grandis [rose gum]
ref|XP_001779205.1|  predicted protein                                60.1    3e-07   
ref|XP_008440877.1|  PREDICTED: aconitate hydratase                   60.1    3e-07   Cucumis melo [Oriental melon]
ref|XP_010033531.1|  PREDICTED: aconitate hydratase 1-like            60.1    3e-07   Eucalyptus grandis [rose gum]
ref|XP_010529315.1|  PREDICTED: aconitate hydratase 1-like            59.7    3e-07   Tarenaya hassleriana [spider flower]
ref|XP_008670445.1|  PREDICTED: putative aconitate hydratase, cyt...  59.7    4e-07   Zea mays [maize]
emb|CAN83844.1|  hypothetical protein VITISV_003004                   59.7    4e-07   Vitis vinifera
ref|XP_003612247.1|  Aconitate hydratase                              59.7    4e-07   Medicago truncatula
ref|XP_008670444.1|  PREDICTED: putative aconitate hydratase, cyt...  59.7    4e-07   Zea mays [maize]
ref|XP_004512178.1|  PREDICTED: aconitate hydratase 1-like            59.7    4e-07   Cicer arietinum [garbanzo]
ref|XP_008658754.1|  PREDICTED: uncharacterized protein LOC100304...  59.3    5e-07   
gb|EEC74472.1|  hypothetical protein OsI_09921                        59.3    6e-07   Oryza sativa Indica Group [Indian rice]
ref|NP_001048898.1|  Os03g0136900                                     59.3    6e-07   
ref|XP_002530635.1|  aconitase, putative                              58.9    7e-07   Ricinus communis
gb|KCW53221.1|  hypothetical protein EUGRSUZ_J02488                   58.5    1e-06   Eucalyptus grandis [rose gum]
ref|XP_003558862.1|  PREDICTED: putative aconitate hydratase, cyt...  58.2    1e-06   Brachypodium distachyon [annual false brome]
ref|XP_003590814.1|  Aconitate hydratase                              57.8    2e-06   
gb|EMT24311.1|  Putative aconitate hydratase, cytoplasmic             57.8    2e-06   
ref|XP_002465901.1|  hypothetical protein SORBIDRAFT_01g047850        57.0    3e-06   Sorghum bicolor [broomcorn]
ref|XP_004166975.1|  PREDICTED: aconitate hydratase 1-like            56.6    4e-06   
ref|XP_004134842.1|  PREDICTED: aconitate hydratase 1-like            56.2    5e-06   Cucumis sativus [cucumbers]
gb|KGN48958.1|  Aconitase                                             56.2    6e-06   
ref|XP_002976825.1|  hypothetical protein SELMODRAFT_443331           56.2    6e-06   
ref|XP_002980554.1|  hypothetical protein SELMODRAFT_444572           56.2    6e-06   
gb|EMS48231.1|  Putative aconitate hydratase, cytoplasmic             54.7    2e-05   Triticum urartu
ref|XP_006651017.1|  PREDICTED: putative aconitate hydratase, cyt...  54.3    2e-05   
gb|EMT03129.1|  Putative aconitate hydratase, cytoplasmic             53.9    3e-05   
gb|ADZ57218.1|  aconitase protein                                     53.1    5e-05   Litchi chinensis [litchi]
ref|XP_001770969.1|  predicted protein                                52.8    7e-05   
gb|KHN36000.1|  Aconitate hydratase, cytoplasmic                      52.4    1e-04   Glycine soja [wild soybean]
gb|EEE58288.1|  hypothetical protein OsJ_09326                        50.8    3e-04   Oryza sativa Japonica Group [Japonica rice]



>ref|XP_006366590.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=997

 Score =   162 bits (410),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  385  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  564
            ++S  RSLRCSVPRWSHGVDWKSP SLTAQIR+AAP LN FHRK+ATMA+ENPFKGI T 
Sbjct  53   YSSTLRSLRCSVPRWSHGVDWKSPISLTAQIRTAAPALNGFHRKLATMAAENPFKGILTG  112

Query  565  LPKPGGGEFGKFYSLPALNDPRIDK  639
            LPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  113  LPKPGGGEFGKFYSLPALNDPRIDK  137



>ref|XP_004243472.1| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=995

 Score =   162 bits (410),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  385  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  564
            ++S  RSLRCSVPRWSHGVDWKSP SLTAQIR+AAP LN FHRK+ATMA+ENPFKGI T 
Sbjct  51   YSSTLRSLRCSVPRWSHGVDWKSPISLTAQIRTAAPALNGFHRKLATMAAENPFKGILTG  110

Query  565  LPKPGGGEFGKFYSLPALNDPRIDK  639
            LPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  111  LPKPGGGEFGKFYSLPALNDPRIDK  135



>dbj|BAG16527.1| putative aconitase [Capsicum chinense]
Length=995

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R   ++S  RSL CSV RWSHGVDWKSP SLTAQIR+AAP LN FHRK+ATMA+ENPFKG
Sbjct  47   RCYYYSSTLRSLGCSVTRWSHGVDWKSPISLTAQIRTAAPALNSFHRKLATMAAENPFKG  106

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I T+LPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  107  ILTALPKPGGGEFGKFYSLPALNDPRIDK  135



>gb|KDP22711.1| hypothetical protein JCGZ_01813 [Jatropha curcas]
Length=998

 Score =   156 bits (395),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L+F +A RS RCSVPRWSHGVDW+SP SL +QIRSAAPV+  F RKIATMA+E+PFKG
Sbjct  50   RSLSFTAAVRSFRCSVPRWSHGVDWRSPVSLRSQIRSAAPVIEQFQRKIATMAAEHPFKG  109

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I T+LPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  110  IVTALPKPGGGEFGKFYSLPALNDPRIDK  138



>ref|XP_009770911.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana sylvestris]
Length=996

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  385  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  564
            F+S FRS+RCSVPRWSHG+DWKSP SLTAQIR+AAP LN FHRK++TMA +NPFK I T+
Sbjct  52   FSSTFRSVRCSVPRWSHGIDWKSPISLTAQIRTAAPALNSFHRKLSTMAEKNPFKEILTA  111

Query  565  LPKPGGGEFGKFYSLPALNDPRIDK  639
            LPKPGGGEFGKFYSLPALNDPRI+K
Sbjct  112  LPKPGGGEFGKFYSLPALNDPRIEK  136



>ref|XP_006376779.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP54576.1| aconitate hydratase family protein [Populus trichocarpa]
Length=995

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L+F+SA RSLRCS PRWSHGVDW+SPA+L  QIR+ APV+  F RKIATMA E+PFKG
Sbjct  47   RSLSFSSAVRSLRCSYPRWSHGVDWRSPATLRHQIRAVAPVVERFQRKIATMAHEHPFKG  106

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            IFTSLPKPGGGEFGKFYSLPALNDPRI+K
Sbjct  107  IFTSLPKPGGGEFGKFYSLPALNDPRIEK  135



>ref|XP_002524184.1| aconitase, putative [Ricinus communis]
 gb|EEF38199.1| aconitase, putative [Ricinus communis]
Length=997

 Score =   153 bits (386),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L+F++A RSLRCSVPRWSHGVDW+SP SL +QIR+A+PV+  F RKI+TMA+E+PFKG
Sbjct  48   RSLSFSAAVRSLRCSVPRWSHGVDWRSPVSLRSQIRTASPVIERFQRKISTMAAEHPFKG  107

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I T LPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  108  IVTPLPKPGGGEFGKFYSLPALNDPRIDK  136



>ref|XP_011047264.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047265.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047266.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
Length=1001

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L+F+SAFRSLRCS PRWSHGVDW+SPA+L  QIR+ +P +  F RKIATM  E+PFKG
Sbjct  53   RSLSFSSAFRSLRCSYPRWSHGVDWRSPATLRHQIRAVSPFVERFQRKIATMVPEHPFKG  112

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            IFTSLPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  113  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  141



>emb|CDP10817.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L+++SA RS+R SVPRWSHGVDWKSP+SL +QIR+ +P  N F+RK+ATMASENPFKG
Sbjct  62   RLLSYSSALRSVRSSVPRWSHGVDWKSPSSLCSQIRTTSPACNGFYRKMATMASENPFKG  121

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
              TSLPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  122  TLTSLPKPGGGEFGKFYSLPALNDPRIDK  150



>ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic [Nelumbo nucifera]
Length=992

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L+F+SAFRSLR S PRWSHG DW+SP SL AQIR+AAPV+  F RKIATMASEN FKG
Sbjct  44   RSLSFSSAFRSLRSSPPRWSHGYDWRSPLSLRAQIRTAAPVIERFQRKIATMASENAFKG  103

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I TSLPKPGGGEFGKFYSLPA+NDPRIDK
Sbjct  104  ILTSLPKPGGGEFGKFYSLPAINDPRIDK  132



>ref|XP_011048785.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Populus euphratica]
Length=995

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R  +F SA RSLRCS PRWSHGVDW+SPA+L  QIR+ APV+  F RKIATMA E+PFKG
Sbjct  47   RSSSFTSAVRSLRCSYPRWSHGVDWRSPATLRHQIRAVAPVVERFQRKIATMAHEHPFKG  106

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            IFTSLPKPGGGEFGKFYSLPALNDPRI+K
Sbjct  107  IFTSLPKPGGGEFGKFYSLPALNDPRIEK  135



>ref|XP_011095404.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=1011

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L+F+SA RS+RCS PRWSHGVDW+SP SL AQIR+A+PVL  F RKIATMASE+PF G
Sbjct  63   RSLSFSSALRSIRCSAPRWSHGVDWRSPVSLRAQIRTASPVLERFERKIATMASEHPFSG  122

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I + LPKPGGGEFGKFYSLPAL DPRIDK
Sbjct  123  ILSGLPKPGGGEFGKFYSLPALKDPRIDK  151



>ref|XP_009601350.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana tomentosiformis]
Length=997

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  385  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  564
            F+S  RS+RCSVPRWSHGVDWKSP SLTAQIR+AAP  N FH+K++TMA +NPFK I T+
Sbjct  53   FSSTLRSVRCSVPRWSHGVDWKSPISLTAQIRTAAPAFNSFHKKLSTMAEKNPFKEILTA  112

Query  565  LPKPGGGEFGKFYSLPALNDPRIDK  639
            LPKPGGGEFGKFYSLPALNDPRI+K
Sbjct  113  LPKPGGGEFGKFYSLPALNDPRIEK  137



>emb|CDP05740.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   150 bits (379),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  388  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  567
            +SA RSLRCSVPRWSHGVDW+SP SL AQIR+AAPV+  F RKIATMA E+P+KGI TSL
Sbjct  68   SSAVRSLRCSVPRWSHGVDWRSPVSLRAQIRTAAPVIERFERKIATMAPEHPYKGILTSL  127

Query  568  PKPGGGEFGKFYSLPALNDPRIDK  639
            PKPGGG+FGKFYSLPALNDPRIDK
Sbjct  128  PKPGGGDFGKFYSLPALNDPRIDK  151



>ref|XP_002321126.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
 gb|EEE99441.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
Length=999

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L+F+SA RSLRCS  RWSHGVDW+SPA+L  QIR+ AP +  F RKIATMA E+PFKG
Sbjct  51   RSLSFSSAVRSLRCSYRRWSHGVDWRSPATLRHQIRAVAPFVERFQRKIATMAPEHPFKG  110

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            IFTSLPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  111  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  139



>ref|XP_010046497.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=996

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L+F+SAFRSLR SVPRWSHGVDW+SPASL  QIR+ APV+    RK ATMASENPFK 
Sbjct  48   RSLSFSSAFRSLRSSVPRWSHGVDWRSPASLRPQIRAVAPVIERLQRKFATMASENPFKE  107

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I T+LPK GGG FGKFYSLPALNDPRIDK
Sbjct  108  ILTTLPKAGGGHFGKFYSLPALNDPRIDK  136



>gb|KDO62733.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=875

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L+F+SA R++RCS PRWSHGV+W+SP SL AQ R AAPVL  F RKIA+MA EN FKG
Sbjct  54   RSLSFSSALRTVRCSAPRWSHGVNWRSPVSLRAQSRIAAPVLERFQRKIASMAPENAFKG  113

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I TSLPKPGGGEFGKF+SLPALNDPRID+
Sbjct  114  ILTSLPKPGGGEFGKFFSLPALNDPRIDR  142



>ref|XP_006452377.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 ref|XP_006475065.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Citrus 
sinensis]
 gb|ESR65617.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 gb|KDO62731.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=1002

 Score =   145 bits (366),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L+F+SA R++RCS PRWSHGV+W+SP SL AQ R AAPVL  F RKIA+MA EN FKG
Sbjct  54   RSLSFSSALRTVRCSAPRWSHGVNWRSPVSLRAQSRIAAPVLERFQRKIASMAPENAFKG  113

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I TSLPKPGGGEFGKF+SLPALNDPRID+
Sbjct  114  ILTSLPKPGGGEFGKFFSLPALNDPRIDR  142



>gb|EPS60517.1| hypothetical protein M569_14286, partial [Genlisea aurea]
Length=862

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L+F+SA RSLR S PRWSHGVDW+ P SL +QI + +PVL  FHRKIATMASE+PF G
Sbjct  17   RSLSFSSAIRSLRISAPRWSHGVDWRYPVSLRSQIGTVSPVLERFHRKIATMASEHPFSG  76

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            +  +LPKPGGGEFGK+YSLPALNDPRI+K
Sbjct  77   LLQTLPKPGGGEFGKYYSLPALNDPRIEK  105



>ref|XP_006351962.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Solanum tuberosum]
Length=981

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 76/89 (85%), Gaps = 7/89 (8%)
 Frame = +1

Query  379  LTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPFKG  552
            L F+S FRS     PRWS+GVDWKSP SL AQIR+AA  PVLN+FHRK+ TMASENPFKG
Sbjct  38   LGFSSTFRS-----PRWSYGVDWKSPISLKAQIRTAAVTPVLNNFHRKLTTMASENPFKG  92

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I TSLPKPGGGEFGK+YSLPALNDPRIDK
Sbjct  93   ILTSLPKPGGGEFGKYYSLPALNDPRIDK  121



>ref|XP_009598331.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Nicotiana 
tomentosiformis]
Length=865

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R  +F+SA  SLR SVPRWSHGVDW+SP SL AQ+R+A+P +    R IATMASE+PF+G
Sbjct  116  RSFSFSSALPSLRYSVPRWSHGVDWRSPISLRAQVRTASPDIEPLDRNIATMASEHPFRG  175

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            IFTSLPKPGGGEFGKFYSL ALNDPRIDK
Sbjct  176  IFTSLPKPGGGEFGKFYSLTALNDPRIDK  204



>ref|XP_009598330.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Nicotiana 
tomentosiformis]
Length=1063

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R  +F+SA  SLR SVPRWSHGVDW+SP SL AQ+R+A+P +    R IATMASE+PF+G
Sbjct  116  RSFSFSSALPSLRYSVPRWSHGVDWRSPISLRAQVRTASPDIEPLDRNIATMASEHPFRG  175

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            IFTSLPKPGGGEFGKFYSL ALNDPRIDK
Sbjct  176  IFTSLPKPGGGEFGKFYSLTALNDPRIDK  204



>gb|KDO54659.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=896

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I T+LPKPGGGEFGKFYSLPALNDPRI+K
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEK  136



>gb|KDO54661.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=876

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I T+LPKPGGGEFGKFYSLPALNDPRI+K
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEK  136



>gb|KDO54656.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I T+LPKPGGGEFGKFYSLPALNDPRI+K
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEK  136



>ref|XP_006447556.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 gb|ESR60796.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=888

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  52   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  111

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I T+LPKPGGGEFGKFYSLPALNDPRI+K
Sbjct  112  ILTALPKPGGGEFGKFYSLPALNDPRIEK  140



>gb|KDO54660.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=902

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I T+LPKPGGGEFGKFYSLPALNDPRI+K
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEK  136



>gb|KDO54657.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I T+LPKPGGGEFGKFYSLPALNDPRI+K
Sbjct  108  ILTALPKPGGGEFGKFYSLPALNDPRIEK  136



>ref|XP_006447555.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 ref|XP_006469685.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469686.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Citrus sinensis]
 gb|ESR60795.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=1000

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  52   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  111

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I T+LPKPGGGEFGKFYSLPALNDPRI+K
Sbjct  112  ILTALPKPGGGEFGKFYSLPALNDPRIEK  140



>ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nelumbo nucifera]
Length=997

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +1

Query  409  RCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGE  588
            R S PRWSHG DWKSP SL AQIR+AAPV+  F RKIATMASEN FKGI TSLPKPGGGE
Sbjct  61   RSSAPRWSHGFDWKSPLSLRAQIRTAAPVIERFQRKIATMASENAFKGILTSLPKPGGGE  120

Query  589  FGKFYSLPALNDPRIDK  639
            FGKFYSLPALNDPRIDK
Sbjct  121  FGKFYSLPALNDPRIDK  137



>ref|XP_002278138.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI26642.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 74/89 (83%), Gaps = 5/89 (6%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L F SAFRS      RWSHGVDW+SP SL AQIR+AAPV+  F RK+AT+ASE+PFKG
Sbjct  66   RSLGFLSAFRS-----RRWSHGVDWRSPVSLRAQIRAAAPVIERFERKMATIASEHPFKG  120

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I TS+PKPGGGEFGKFYSLPALNDPRIDK
Sbjct  121  ILTSVPKPGGGEFGKFYSLPALNDPRIDK  149



>gb|EYU27339.1| hypothetical protein MIMGU_mgv1a000710mg [Erythranthe guttata]
Length=1010

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = +1

Query  373  RPLTFASAFRSLR-CSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  549
            R L+F+SA RS+R  S  RWSHG DW+SP SL AQIRS++PVL  F RKIATMASE+PF 
Sbjct  61   RSLSFSSALRSIRYSSSQRWSHGADWRSPVSLRAQIRSSSPVLERFERKIATMASEHPFN  120

Query  550  GIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            GI + LPKP GGEFGKFYSLPALNDPRIDK
Sbjct  121  GILSGLPKPEGGEFGKFYSLPALNDPRIDK  150



>ref|XP_009787326.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Nicotiana sylvestris]
Length=818

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  385  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  564
            F+SA  SL  S PRWSHGVDW+SP SL AQIR+A+P +    R IATMASE+PF+GIFTS
Sbjct  73   FSSALPSLSYSTPRWSHGVDWRSPISLRAQIRTASPDIERLDRNIATMASEHPFRGIFTS  132

Query  565  LPKPGGGEFGKFYSLPALNDPRIDK  639
            LPKPGGGEFGKFYSL ALNDPRIDK
Sbjct  133  LPKPGGGEFGKFYSLTALNDPRIDK  157



>ref|XP_009787319.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X1 [Nicotiana 
sylvestris]
Length=1017

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  385  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  564
            F+SA  SL  S PRWSHGVDW+SP SL AQIR+A+P +    R IATMASE+PF+GIFTS
Sbjct  73   FSSALPSLSYSTPRWSHGVDWRSPISLRAQIRTASPDIERLDRNIATMASEHPFRGIFTS  132

Query  565  LPKPGGGEFGKFYSLPALNDPRIDK  639
            LPKPGGGEFGKFYSL ALNDPRIDK
Sbjct  133  LPKPGGGEFGKFYSLTALNDPRIDK  157



>gb|KJB60836.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=860

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  388  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  567
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVLTSL  106

Query  568  PKPGGGEFGKFYSLPALNDPRIDK  639
            PKPGGGEFGKFYSLPALNDPRIDK
Sbjct  107  PKPGGGEFGKFYSLPALNDPRIDK  130



>gb|KJB60837.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=865

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  388  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  567
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVLTSL  106

Query  568  PKPGGGEFGKFYSLPALNDPRIDK  639
            PKPGGGEFGKFYSLPALNDPRIDK
Sbjct  107  PKPGGGEFGKFYSLPALNDPRIDK  130



>gb|KJB60835.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=990

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  388  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  567
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVLTSL  106

Query  568  PKPGGGEFGKFYSLPALNDPRIDK  639
            PKPGGGEFGKFYSLPALNDPRIDK
Sbjct  107  PKPGGGEFGKFYSLPALNDPRIDK  130



>ref|XP_007045642.1| Aconitase 3 [Theobroma cacao]
 gb|EOY01474.1| Aconitase 3 [Theobroma cacao]
Length=995

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R LT ++A RS   SVPRWSH +DW+SP SL AQIR+  PV+    RK ATMASE+PFK 
Sbjct  48   RSLT-SAAVRSFHGSVPRWSHRLDWRSPLSLRAQIRAVTPVIERLERKFATMASEHPFKA  106

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            + TSLPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  107  VLTSLPKPGGGEFGKFYSLPALNDPRIDK  135



>ref|XP_003543388.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +1

Query  376  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  555
            P + ++A RS   +VPRWSHGVDW+SP  L  QIR+AAP++  FHR+IAT A++NPFKG 
Sbjct  37   PGSSSAATRSFGSAVPRWSHGVDWRSPLGLRPQIRAAAPLIERFHRRIATSATDNPFKGN  96

Query  556  FTSLPKPGGGEFGKFYSLPALNDPRIDK  639
             TSLPKPGGGEFGKFYSLP+LNDPRID+
Sbjct  97   LTSLPKPGGGEFGKFYSLPSLNDPRIDR  124



>gb|KHN36531.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=984

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +1

Query  376  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  555
            P + ++A RS   +VPRWSHGVDW+SP  L  QIR+AAP++  FHR+IAT A++NPFKG 
Sbjct  37   PGSSSAATRSFGSAVPRWSHGVDWRSPLGLRPQIRAAAPLIERFHRRIATSATDNPFKGN  96

Query  556  FTSLPKPGGGEFGKFYSLPALNDPRIDK  639
             TSLP+PGGGEFGKFYSLP+LNDPRID+
Sbjct  97   LTSLPRPGGGEFGKFYSLPSLNDPRIDR  124



>ref|XP_004251517.2| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=981

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 70/83 (84%), Gaps = 7/83 (8%)
 Frame = +1

Query  397  FRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPFKGIFTSLP  570
            FRSLR     W +GVDWKSP SLT+QIR+AA  PVLN+F RK+ TMAS NPFKGI TSLP
Sbjct  44   FRSLR-----WRYGVDWKSPISLTSQIRTAAVTPVLNNFRRKLTTMASGNPFKGILTSLP  98

Query  571  KPGGGEFGKFYSLPALNDPRIDK  639
            KPGGGEFGK+YSLPALNDPRIDK
Sbjct  99   KPGGGEFGKYYSLPALNDPRIDK  121



>gb|EYU24785.1| hypothetical protein MIMGU_mgv1a000742mg [Erythranthe guttata]
Length=997

 Score =   129 bits (323),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 63/76 (83%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +1

Query  415  SVPRWSHGVDWKSPASLTAQIR-SAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEF  591
            S  RWSHGVDWKSPASL +QIR S+A      HRKIATMASEN FKGIFTSLPKPGGGEF
Sbjct  60   SAARWSHGVDWKSPASLASQIRISSAFSDTLLHRKIATMASENAFKGIFTSLPKPGGGEF  119

Query  592  GKFYSLPALNDPRIDK  639
            GKFYSLPALNDPRIDK
Sbjct  120  GKFYSLPALNDPRIDK  135



>gb|KJB50479.1| hypothetical protein B456_008G173400 [Gossypium raimondii]
Length=996

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R LT ++A RS  CSVPRWSH +DW+SP +L ++IR+  P++    RK ATMA+E+PFK 
Sbjct  49   RSLT-SAAVRSFHCSVPRWSHRLDWRSPLNLRSEIRAFNPIIEQLQRKFATMAAEHPFKA  107

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            + TSLP+PGGGEFGKFYSLPALNDPRIDK
Sbjct  108  VLTSLPRPGGGEFGKFYSLPALNDPRIDK  136



>ref|XP_003540302.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +1

Query  376  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  555
            P + A+A RS   +VPRWS GVDW+SP  L   IR+AAP++  FHR+IAT A+ENPFKG 
Sbjct  37   PGSSAAATRSFGSAVPRWSRGVDWRSPLGLRPHIRAAAPLIERFHRRIATSATENPFKGN  96

Query  556  FTSLPKPGGGEFGKFYSLPALNDPRIDK  639
             TSLP+PGGGEFGKFYSLP+LNDPRID+
Sbjct  97   LTSLPRPGGGEFGKFYSLPSLNDPRIDR  124



>ref|XP_006346211.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=980

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 4/86 (5%)
 Frame = +1

Query  385  FASAFRSLRCSVPRWS-HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  561
            FA+ +RS+RCSVPRWS +GV+ + P SL AQIR+A+ V+    R +ATMASE+PFKGIFT
Sbjct  38   FATTYRSIRCSVPRWSNYGVNRRFPISLKAQIRTASQVV---ERNVATMASEHPFKGIFT  94

Query  562  SLPKPGGGEFGKFYSLPALNDPRIDK  639
            SLPKPGGGEFGKFYSLPALNDPRI+K
Sbjct  95   SLPKPGGGEFGKFYSLPALNDPRINK  120



>gb|KHG15607.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=668

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R LT ++A RS  CSVPRWS  +DW+SP +L ++IR+  P++    RK ATMA+E+PFK 
Sbjct  49   RSLT-STAVRSFHCSVPRWSPRLDWRSPLNLRSEIRAFNPIIEQLQRKFATMAAEHPFKA  107

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            + TSLPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  108  VLTSLPKPGGGEFGKFYSLPALNDPRIDK  136



>gb|KDP39136.1| hypothetical protein JCGZ_00893 [Jatropha curcas]
Length=1002

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 72/89 (81%), Gaps = 6/89 (7%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L+F+   RSLRCS P WSHGVDW SP SL AQ R ++PV+    R+++TM SE+PFKG
Sbjct  57   RYLSFS---RSLRCSAPLWSHGVDWHSPISLRAQARVSSPVV---ERRLSTMTSEHPFKG  110

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I T+LPKPGGGEFGKFY+LPALNDPRID+
Sbjct  111  ILTNLPKPGGGEFGKFYNLPALNDPRIDR  139



>ref|XP_011100304.1| PREDICTED: aconitate hydratase, cytoplasmic [Sesamum indicum]
Length=1001

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 69/84 (82%), Gaps = 4/84 (5%)
 Frame = +1

Query  397  FRSLR-CSVPRWSHGVDWKSPASLTAQIRSAAPVLND--FHRKIATMASENPFKGIFTSL  567
             RSL   S  RWSHGVDWKSP SL AQIR A+ V +D   HRKIATMA+ENPFKGIFTSL
Sbjct  55   LRSLSYLSAARWSHGVDWKSPPSLAAQIRIAS-VSSDTLLHRKIATMAAENPFKGIFTSL  113

Query  568  PKPGGGEFGKFYSLPALNDPRIDK  639
            PK GGGEFGKFYSLPALNDPRIDK
Sbjct  114  PKSGGGEFGKFYSLPALNDPRIDK  137



>gb|KHG18502.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=933

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = +1

Query  388  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSL  567
            ++A RS  CS PRWSH +DW+SP SL AQ+R+  PV+    RK +TMA+E+PFK + TSL
Sbjct  47   SAAVRSFHCS-PRWSHRLDWRSPFSLRAQVRAVNPVIERLERKFSTMAAEHPFKAVLTSL  105

Query  568  PKPGGGEFGKFYSLPALNDPRIDK  639
            PKPGGGEFGKFYSLPALNDPRIDK
Sbjct  106  PKPGGGEFGKFYSLPALNDPRIDK  129



>ref|XP_007149973.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
 gb|ESW21967.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
Length=983

 Score =   124 bits (312),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +1

Query  415  SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFG  594
            +VPRWSHGVDW+SP  L  QIR+ AP++  FHR+IAT A +NPFKG  TSLPKPGGGEFG
Sbjct  49   AVPRWSHGVDWRSPLGLRHQIRAVAPLIERFHRRIATSALDNPFKGNLTSLPKPGGGEFG  108

Query  595  KFYSLPALNDPRIDK  639
            KFYSLP+LNDPRID+
Sbjct  109  KFYSLPSLNDPRIDR  123



>ref|XP_010445106.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=383

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = +1

Query  373  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  546
            R  +F+SA RS R CS   RWSHG  W+ PASL AQ R++APV+  F RK AT+ASE+ +
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRYPASLRAQSRNSAPVMEKFERKYATIASEHAY  106

Query  547  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            K I TSLPKPGGGE+G++YSLPALNDPR+DK
Sbjct  107  KDILTSLPKPGGGEYGQYYSLPALNDPRVDK  137



>ref|XP_010448188.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=998

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 72/91 (79%), Gaps = 2/91 (2%)
 Frame = +1

Query  373  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  546
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R++APV+  F RK ATMASE+ +
Sbjct  48   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQSRNSAPVMEKFERKYATMASEHAY  107

Query  547  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            K I TSLPKPGGGE+G++YSLPALNDPR+DK
Sbjct  108  KDILTSLPKPGGGEYGQYYSLPALNDPRVDK  138



>gb|KJB62848.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=864

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 4/89 (4%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L+F+ + RSLRCS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG
Sbjct  49   RSLSFSYSLRSLRCSAPR----LHWRSPESLRVLARTSVPVVERFHRRIATTASEHPFKG  104

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            + TSLPKPGGGEFGKFYSLPALNDPRID+
Sbjct  105  VMTSLPKPGGGEFGKFYSLPALNDPRIDR  133



>ref|XP_006283068.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
 gb|EOA15966.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
Length=995

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = +1

Query  373  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  546
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+  F RK ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQSRISAPVMEKFERKYATMASEHAY  104

Query  547  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            K I TSLPKPGGGE+GK+YSLPALNDPR+DK
Sbjct  105  KDILTSLPKPGGGEYGKYYSLPALNDPRVDK  135



>gb|KJB62847.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=993

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 4/89 (4%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L+F+ + RSLRCS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG
Sbjct  49   RSLSFSYSLRSLRCSAPR----LHWRSPESLRVLARTSVPVVERFHRRIATTASEHPFKG  104

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            + TSLPKPGGGEFGKFYSLPALNDPRID+
Sbjct  105  VMTSLPKPGGGEFGKFYSLPALNDPRIDR  133



>ref|XP_008455442.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis melo]
Length=989

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 69/89 (78%), Gaps = 4/89 (4%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK ++MA+ENPFK 
Sbjct  45   RSLSASSAFRS----TTRWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFKE  100

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
              TSLPKPGGGEFGK+YSLP+LNDPRIDK
Sbjct  101  NLTSLPKPGGGEFGKYYSLPSLNDPRIDK  129



>ref|XP_008379632.1| PREDICTED: aconitate hydratase, cytoplasmic [Malus domestica]
Length=994

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 70/88 (80%), Gaps = 2/88 (2%)
 Frame = +1

Query  379  LTFASAFRSLRCSVPRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  555
            L F SA  + R S PRWSHG V W+SP +L +QIR+ APV+  F RKIA+MASENPFK  
Sbjct  48   LRFLSASSAAR-SFPRWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKIASMASENPFKAN  106

Query  556  FTSLPKPGGGEFGKFYSLPALNDPRIDK  639
             TSLPKPGGGEFGKFYSLP+LNDPRIDK
Sbjct  107  LTSLPKPGGGEFGKFYSLPSLNDPRIDK  134



>ref|XP_004159202.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
Length=989

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 69/89 (78%), Gaps = 4/89 (4%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK ++MA+ENPFK 
Sbjct  45   RSLSASSAFRS----TARWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFKE  100

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
              TSLPKPGGGEFGK+YSLP+LNDPRIDK
Sbjct  101  NLTSLPKPGGGEFGKYYSLPSLNDPRIDK  129



>ref|NP_567763.2| aconitase 2 [Arabidopsis thaliana]
 sp|Q94A28.3|ACO3M_ARATH RecName: Full=Aconitate hydratase 3, mitochondrial; Short=Aconitase 
3; AltName: Full=Citrate hydro-lyase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE85279.1| aconitase 2 [Arabidopsis thaliana]
Length=995

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +1

Query  373  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  546
            R  +F+SA RS R CS   RWSHG  W SPASL AQ R++ PV+  F RK ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWGSPASLRAQARNSTPVMEKFERKYATMASEHSY  104

Query  547  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            K I TSLPKPGGGE+GK+YSLPALNDPRIDK
Sbjct  105  KDILTSLPKPGGGEYGKYYSLPALNDPRIDK  135



>gb|AAK91447.1| AT4g26970/F10M23_310 [Arabidopsis thaliana]
 gb|AAN18061.1| At4g26970/F10M23_310 [Arabidopsis thaliana]
Length=995

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +1

Query  373  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  546
            R  +F+SA RS R CS   RWSHG  W SPASL AQ R++ PV+  F RK ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWGSPASLRAQARNSTPVMEKFERKYATMASEHSY  104

Query  547  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            K I TSLPKPGGGE+GK+YSLPALNDPRIDK
Sbjct  105  KDILTSLPKPGGGEYGKYYSLPALNDPRIDK  135



>ref|XP_002869584.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45843.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
Length=995

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +1

Query  373  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  546
            R  +F+SA RS R CS   RWSHGV W SPASL AQ R++APV+  F R  ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGVSWGSPASLRAQSRNSAPVMEKFERTYATMASEHAY  104

Query  547  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            K I TSLPKPGGGE+G +YSLPALNDPR+DK
Sbjct  105  KDILTSLPKPGGGEYGNYYSLPALNDPRVDK  135



>ref|XP_009353280.1| PREDICTED: aconitate hydratase, cytoplasmic [Pyrus x bretschneideri]
Length=994

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 71/90 (79%), Gaps = 5/90 (6%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  549
            R L+ +SA RS     PRWSHG V W+SP +L +QIR+ APV+  F RKIA+MASENPFK
Sbjct  49   RFLSSSSAARSF----PRWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKIASMASENPFK  104

Query  550  GIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
               TSLPKPGGGEFGKFYSLP+LNDPRIDK
Sbjct  105  ANLTSLPKPGGGEFGKFYSLPSLNDPRIDK  134



>ref|XP_003596988.1| Aconitate hydratase [Medicago truncatula]
 gb|AES67239.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +1

Query  379  LTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  558
             T ++   + R +V RWSHGV W+SP SL  QIR+ AP +  +HRKIAT A ENPFKG  
Sbjct  33   FTSSAVANAARSTVNRWSHGVLWRSPFSLRPQIRAVAPFIEQYHRKIATSAGENPFKGNL  92

Query  559  TSLPKPGGGEFGKFYSLPALNDPRIDK  639
            TSLPKPGGGEFGKFYSLP+LNDPRID+
Sbjct  93   TSLPKPGGGEFGKFYSLPSLNDPRIDR  119



>ref|XP_004144496.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
 gb|KGN43521.1| hypothetical protein Csa_7G043630 [Cucumis sativus]
Length=989

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 69/89 (78%), Gaps = 4/89 (4%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK ++MA+ENPFK 
Sbjct  45   RSLSASSAFRS----TARWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFKE  100

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
              TSLPKPGGGE+GK+YSLP+LNDPRIDK
Sbjct  101  NLTSLPKPGGGEYGKYYSLPSLNDPRIDK  129



>ref|XP_009599619.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana tomentosiformis]
Length=985

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 70/91 (77%), Gaps = 11/91 (12%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPF  546
            R L F+SA RSLR     W    +WKSP  L AQIR+ A  PVLN FHRK++TMA+ENPF
Sbjct  44   RSLNFSSAVRSLR-----W----NWKSPIILKAQIRTTATTPVLNSFHRKLSTMAAENPF  94

Query  547  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            KGI T LPKPGGGEFGK+YSLPALNDPRIDK
Sbjct  95   KGILTVLPKPGGGEFGKYYSLPALNDPRIDK  125



>ref|XP_009769027.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana sylvestris]
Length=989

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 71/91 (78%), Gaps = 11/91 (12%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPF  546
            R L+F+SA RSLR     W    +WKSP SL AQIR+ A  PVLN  HRK++TMA+ENPF
Sbjct  48   RSLSFSSAVRSLR-----W----NWKSPISLKAQIRTTATTPVLNSSHRKLSTMAAENPF  98

Query  547  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            KGI T LPKPGGGEFGK+YSLPALNDPRIDK
Sbjct  99   KGILTVLPKPGGGEFGKYYSLPALNDPRIDK  129



>ref|XP_003527493.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=979

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R  +F++A   LRCSVPRWSH +   SP S    I + APV+  FHR+IATMA+ENPFKG
Sbjct  31   RTSSFSAAPSLLRCSVPRWSHRLHSTSPLSPRPPITAVAPVVERFHRQIATMANENPFKG  90

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
              TSLPKPGGGEFGKFYSLP+LNDPRID+
Sbjct  91   NLTSLPKPGGGEFGKFYSLPSLNDPRIDR  119



>ref|XP_006592372.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Glycine max]
Length=890

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  382  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  561
            +F++  RSL CSVPRWSH +   SP +   +I + AP++  FHR+IATMA+ENPFKG  T
Sbjct  39   SFSATARSLLCSVPRWSHRLHSASPLTPRPRISAVAPLVERFHREIATMANENPFKGNLT  98

Query  562  SLPKPGGGEFGKFYSLPALNDPRIDK  639
            SLPKPGGGEFGKFYSLP+LNDPRID+
Sbjct  99   SLPKPGGGEFGKFYSLPSLNDPRIDR  124



>ref|XP_003539865.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=984

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  382  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  561
            +F++  RSL CSVPRWSH +   SP +   +I + AP++  FHR+IATMA+ENPFKG  T
Sbjct  39   SFSATARSLLCSVPRWSHRLHSASPLTPRPRISAVAPLVERFHREIATMANENPFKGNLT  98

Query  562  SLPKPGGGEFGKFYSLPALNDPRIDK  639
            SLPKPGGGEFGKFYSLP+LNDPRID+
Sbjct  99   SLPKPGGGEFGKFYSLPSLNDPRIDR  124



>gb|KJB30566.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30567.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=992

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +1

Query  382  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  561
            T +   RS   S  RW H +DW+SP SL AQIR+  PV+  F ++ ATMA+E+PFK + T
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPFSLRAQIRALNPVIERFQKQFATMAAEHPFKEVLT  106

Query  562  SLPKPGGGEFGKFYSLPALNDPRIDK  639
            SLPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  107  SLPKPGGGEFGKFYSLPALNDPRIDK  132



>gb|KJB30569.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=985

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +1

Query  382  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  561
            T +   RS   S  RW H +DW+SP SL AQIR+  PV+  F ++ ATMA+E+PFK + T
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPFSLRAQIRALNPVIERFQKQFATMAAEHPFKEVLT  106

Query  562  SLPKPGGGEFGKFYSLPALNDPRIDK  639
            SLPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  107  SLPKPGGGEFGKFYSLPALNDPRIDK  132



>ref|XP_006413121.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
 gb|ESQ54574.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
Length=999

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = +1

Query  373  RPLTFASAFRSLRC--SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  546
            R  +F+SA RS R   +  RWS+G +W+SPASL AQ R++APV+  F RK ATMASE+ +
Sbjct  48   RSKSFSSALRSFRVGSASTRWSYGGNWRSPASLRAQTRNSAPVMERFERKYATMASEHAY  107

Query  547  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            K I TSLPKP GGE+GK+YSLPALNDPRID+
Sbjct  108  KDILTSLPKPDGGEYGKYYSLPALNDPRIDR  138



>ref|XP_010433420.1| PREDICTED: aconitate hydratase 3, mitochondrial [Camelina sativa]
Length=997

 Score =   119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +1

Query  373  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  546
            R  +F+SA RS R CS   RWSHG  W+SP SL AQ R++APV+  F RK ATM SE+ +
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRSPVSLRAQSRNSAPVMEKFERKYATMTSEHAY  106

Query  547  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            K I TSLPKPGGG +GK+YSLPALNDPR+DK
Sbjct  107  KDILTSLPKPGGGAYGKYYSLPALNDPRVDK  137



>emb|CDY14291.1| BnaA08g14220D [Brassica napus]
Length=995

 Score =   119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +1

Query  373  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  546
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A+MASE+ +
Sbjct  45   RSRSFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHAY  104

Query  547  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            K + TSLPKPGGGE+GK+YSLPALNDPRIDK
Sbjct  105  KDLLTSLPKPGGGEYGKYYSLPALNDPRIDK  135



>emb|CDY66424.1| BnaAnng22230D [Brassica napus]
Length=995

 Score =   119 bits (297),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +1

Query  373  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  546
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A+MASE+ +
Sbjct  45   RSRSFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHAY  104

Query  547  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            K + TSLPKPGGGE+GK+YSLPALNDPRIDK
Sbjct  105  KDLLTSLPKPGGGEYGKYYSLPALNDPRIDK  135



>gb|KHG08190.1| Aconitate hydratase 2, mitochondrial [Gossypium arboreum]
Length=973

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +1

Query  382  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFT  561
            T +   RS   S  RW H +DW+SP SL AQIR+  PV   F ++ ATMA+E+PFK + T
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPLSLRAQIRAFNPVTERFQKQFATMAAEHPFKEVLT  106

Query  562  SLPKPGGGEFGKFYSLPALNDPRIDK  639
            SLPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  107  SLPKPGGGEFGKFYSLPALNDPRIDK  132



>ref|XP_004487412.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=984

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +1

Query  418  VPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGK  597
            V RWSHGV W+SP SL  QIR+ AP +  FHRKIAT A ENPFKG   +LPKPGGGEFGK
Sbjct  52   VNRWSHGVHWRSPFSLRPQIRAVAPFIERFHRKIATSAGENPFKGNLATLPKPGGGEFGK  111

Query  598  FYSLPALNDPRIDK  639
            FYSLP+LNDPRID+
Sbjct  112  FYSLPSLNDPRIDR  125



>ref|XP_009109156.1| PREDICTED: aconitate hydratase 3, mitochondrial [Brassica rapa]
Length=995

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = +1

Query  382  TFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  555
            +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A+MASE+ ++ I
Sbjct  48   SFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHTYQDI  107

Query  556  FTSLPKPGGGEFGKFYSLPALNDPRIDK  639
             TSLPKPGGGE+GK+YSLPALNDPRIDK
Sbjct  108  LTSLPKPGGGEYGKYYSLPALNDPRIDK  135



>ref|XP_008230066.1| PREDICTED: aconitate hydratase, cytoplasmic [Prunus mume]
Length=994

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +1

Query  424  RWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  600
            RWSHG V W+SP +L +QIR+ APV+  F RKIA+MASENPFK   TSLPKPGGGEFGKF
Sbjct  64   RWSHGGVHWRSPYTLRSQIRAIAPVIEQFQRKIASMASENPFKANLTSLPKPGGGEFGKF  123

Query  601  YSLPALNDPRIDK  639
            YSLP+LNDPRID+
Sbjct  124  YSLPSLNDPRIDR  136



>ref|XP_010488774.1| PREDICTED: aconitate hydratase 2, mitochondrial [Camelina sativa]
Length=991

 Score =   116 bits (290),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 69/87 (79%), Gaps = 5/87 (6%)
 Frame = +1

Query  382  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  558
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+P+KGIF
Sbjct  49   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  104

Query  559  TSLPKPGGGEFGKFYSLPALNDPRIDK  639
            T+LPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  105  TTLPKPGGGEFGKFYSLPALNDPRIDK  131



>ref|XP_010467089.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=994

 Score =   115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 69/87 (79%), Gaps = 5/87 (6%)
 Frame = +1

Query  382  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  558
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+P+KGIF
Sbjct  52   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  107

Query  559  TSLPKPGGGEFGKFYSLPALNDPRIDK  639
            T+LPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  108  TTLPKPGGGEFGKFYSLPALNDPRIDK  134



>ref|XP_007217144.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
 gb|EMJ18343.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
Length=996

 Score =   115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +1

Query  424  RWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  600
            RWSHG V W+SP +L +QIR+ APV+  F RK+A+MASENPFK   TSLPKPGGGEFGKF
Sbjct  64   RWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKMASMASENPFKANLTSLPKPGGGEFGKF  123

Query  601  YSLPALNDPRIDK  639
            YSLP+LNDPRID+
Sbjct  124  YSLPSLNDPRIDR  136



>ref|XP_008342002.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Malus domestica]
Length=992

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 62/74 (84%), Gaps = 1/74 (1%)
 Frame = +1

Query  421  PRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGK  597
            PRWSHG V W+S  +L +QIR+ APV+  F RKIA+MASENPFK   TSLPKPGGGEFGK
Sbjct  59   PRWSHGGVHWRSSYTLRSQIRAVAPVIEQFQRKIASMASENPFKPNLTSLPKPGGGEFGK  118

Query  598  FYSLPALNDPRIDK  639
            FYSLP+LNDPRID+
Sbjct  119  FYSLPSLNDPRIDR  132



>ref|XP_002883704.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59963.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 67/87 (77%), Gaps = 5/87 (6%)
 Frame = +1

Query  382  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  558
            T + AFRSL    PRWSH    K SP  LT QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  51   TISPAFRSL----PRWSHCFHSKPSPFRLTTQIRAVSPVLDRLERTFSSMASEHPFKGIF  106

Query  559  TSLPKPGGGEFGKFYSLPALNDPRIDK  639
            T+LPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  107  TTLPKPGGGEFGKFYSLPALNDPRIDK  133



>gb|KFK29204.1| hypothetical protein AALP_AA7G102800 [Arabis alpina]
Length=999

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 70/93 (75%), Gaps = 4/93 (4%)
 Frame = +1

Query  373  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMAS--EN  540
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+  F RK AT+AS  E+
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQARISAPVMERFERKYATIASDSEH  106

Query  541  PFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
             +K I TSLPKP GGE+GK+YSLPALNDPR+DK
Sbjct  107  AYKDILTSLPKPDGGEYGKYYSLPALNDPRVDK  139



>ref|XP_010675721.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R L F+S  RS+  +  RWSHGVDW+SP SL +QI ++ P++  F RKIATMASE+P+K 
Sbjct  67   RSLGFSSVIRSISSASSRWSHGVDWRSPVSLRSQIAASPPLVERFQRKIATMASEHPYKE  126

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            IFTSLPKPGGGEFGKFYSLPALNDPR++K
Sbjct  127  IFTSLPKPGGGEFGKFYSLPALNDPRVEK  155



>ref|XP_010412716.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=991

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 68/87 (78%), Gaps = 5/87 (6%)
 Frame = +1

Query  382  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  558
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+P+KGIF
Sbjct  49   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  104

Query  559  TSLPKPGGGEFGKFYSLPALNDPRIDK  639
            T+LPKP GGEFGKFYSLPALNDPRIDK
Sbjct  105  TTLPKPSGGEFGKFYSLPALNDPRIDK  131



>ref|XP_010929878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Elaeis 
guineensis]
Length=1009

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +1

Query  400  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  579
            R L  S   W HG +W+SP SL AQIRS+A V+  F RK+AT+A+ENPFK I TSLPKP 
Sbjct  69   RPLVRSFGTWRHG-NWRSPVSLRAQIRSSAVVIERFQRKMATLATENPFKNILTSLPKPR  127

Query  580  GGEFGKFYSLPALNDPRIDK  639
            GGEFGKFYSLPALNDPRIDK
Sbjct  128  GGEFGKFYSLPALNDPRIDK  147



>emb|CDY50945.1| BnaC03g74450D [Brassica napus]
Length=995

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = +1

Query  373  RPLTFAS-AFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPF  546
            RP   +S AFRSL    PRWSH +  + SP  L++QIR+ +P L+   RK ++MASE+PF
Sbjct  49   RPFATSSPAFRSL----PRWSHCLHSRLSPFRLSSQIRAVSPGLDRLERKFSSMASEHPF  104

Query  547  KGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            KGIFT+LPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  105  KGIFTTLPKPGGGEFGKFYSLPALNDPRIDK  135



>ref|XP_006296904.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
 gb|EOA29802.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
Length=988

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 66/83 (80%), Gaps = 1/83 (1%)
 Frame = +1

Query  394  AFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLP  570
            +F S+  +  RWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+PFKGIFT+LP
Sbjct  46   SFGSISPAFRRWSHCFHSKPSPISLTSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTALP  105

Query  571  KPGGGEFGKFYSLPALNDPRIDK  639
            KPGGGEFGKFYSLPALNDPRIDK
Sbjct  106  KPGGGEFGKFYSLPALNDPRIDK  128



>ref|XP_010443085.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443086.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443087.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443088.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443089.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443090.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443091.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443092.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
Length=981

 Score =   110 bits (274),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +1

Query  379  LTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            + F  AFR  R CS   RWSHG +W+ PASL AQ R AAP L  F RK A++ASE+ +K 
Sbjct  38   VKFLLAFRLFRVCSAATRWSHGANWRLPASLQAQTRIAAPRLKKFERKFASIASEHAYKD  97

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            I T+L KP GGE+GKFYSLPALNDPRID+
Sbjct  98   ILTTLHKPDGGEYGKFYSLPALNDPRIDR  126



>gb|KFK39331.1| hypothetical protein AALP_AA3G230700 [Arabis alpina]
Length=986

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 68/87 (78%), Gaps = 5/87 (6%)
 Frame = +1

Query  382  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  558
            +FA+ FRSL    PRWSH +  + S   L++QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  44   SFATCFRSL----PRWSHCLHSRPSSFRLSSQIRAVSPVLDRLQRTFSSMASEHPFKGIF  99

Query  559  TSLPKPGGGEFGKFYSLPALNDPRIDK  639
            T+LPKP GGEFGKFYSLPALNDPRIDK
Sbjct  100  TTLPKPDGGEFGKFYSLPALNDPRIDK  126



>ref|XP_008804304.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=1010

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = +1

Query  400  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  579
            R L  S   W HG   +SP SL AQIRS+A V+  F RK+ATMA+ENPFK I TSLPKPG
Sbjct  70   RPLVRSFGTWRHGSS-RSPVSLRAQIRSSAAVIERFQRKMATMATENPFKNILTSLPKPG  128

Query  580  GGEFGKFYSLPALNDPRIDK  639
            GGEFGKFYSLPAL+DPRIDK
Sbjct  129  GGEFGKFYSLPALSDPRIDK  148



>ref|XP_009136177.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=995

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 68/87 (78%), Gaps = 5/87 (6%)
 Frame = +1

Query  382  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  558
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  53   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  108

Query  559  TSLPKPGGGEFGKFYSLPALNDPRIDK  639
            T+LPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  109  TTLPKPGGGEFGKFYSLPALNDPRIDK  135



>ref|XP_009148490.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=991

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 68/87 (78%), Gaps = 5/87 (6%)
 Frame = +1

Query  382  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  558
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  49   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  104

Query  559  TSLPKPGGGEFGKFYSLPALNDPRIDK  639
            T+LPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  105  TTLPKPGGGEFGKFYSLPALNDPRIDK  131



>emb|CDX97969.1| BnaA06g07200D [Brassica napus]
Length=991

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 68/87 (78%), Gaps = 5/87 (6%)
 Frame = +1

Query  382  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  558
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  49   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  104

Query  559  TSLPKPGGGEFGKFYSLPALNDPRIDK  639
            T+LPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  105  TTLPKPGGGEFGKFYSLPALNDPRIDK  131



>gb|KHG02134.1| hypothetical protein F383_25649 [Gossypium arboreum]
Length=993

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 60/76 (79%), Gaps = 4/76 (5%)
 Frame = +1

Query  412  CSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEF  591
            CS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG+ TSLPKPGGGEF
Sbjct  62   CSAPR----LHWRSPESLRILARTSVPVVERFHRRIATTASEHPFKGVMTSLPKPGGGEF  117

Query  592  GKFYSLPALNDPRIDK  639
            GKFYSLPALNDPRID+
Sbjct  118  GKFYSLPALNDPRIDR  133



>ref|XP_003605929.1| Aconitate hydratase [Medicago truncatula]
 gb|AES88126.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +1

Query  400  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  579
            RS   S+PR++      S  SL  QI + AP++  FHRKIATMASENPFKG  TSLPKPG
Sbjct  40   RSFFYSLPRFNRRFHSSSHLSLRPQITAVAPLVERFHRKIATMASENPFKGNLTSLPKPG  99

Query  580  GGEFGKFYSLPALNDPRIDK  639
            GGEFGKFYSLP+LNDPRIDK
Sbjct  100  GGEFGKFYSLPSLNDPRIDK  119



>emb|CDY18054.1| BnaC07g04160D [Brassica napus]
Length=986

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 5/87 (6%)
 Frame = +1

Query  382  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  558
            T++ AFRSL     RWSH +  + SP  L++QIR+A+PVL+   +  ++MASE+PFKGI 
Sbjct  44   TYSPAFRSL----ARWSHCLHSRPSPFRLSSQIRTASPVLDRLEKNFSSMASEHPFKGIL  99

Query  559  TSLPKPGGGEFGKFYSLPALNDPRIDK  639
            T+LPKPGGGEFGKFYSLPALND RIDK
Sbjct  100  TTLPKPGGGEFGKFYSLPALNDSRIDK  126



>ref|XP_010450391.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=980

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = +1

Query  400  RSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKP  576
            RS   S+PR SH +  KS    L +QIR+ +PVL+   R  ++MASE+PFKGIFT+LPKP
Sbjct  40   RSFLTSLPRLSHCLHSKSFQIRLGSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTTLPKP  99

Query  577  GGGEFGKFYSLPALNDPRIDK  639
            GGGEFGKFYSLPALNDPRIDK
Sbjct  100  GGGEFGKFYSLPALNDPRIDK  120



>ref|NP_178634.2| aconitate hydratase 3 [Arabidopsis thaliana]
 sp|Q9SIB9.2|ACO2M_ARATH RecName: Full=Aconitate hydratase 2, mitochondrial; Short=Aconitase 
2; AltName: Full=Citrate hydro-lyase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM97080.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
 gb|AAP68248.1| At2g05710 [Arabidopsis thaliana]
 gb|AEC05964.1| aconitate hydratase 3 [Arabidopsis thaliana]
Length=990

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 64/87 (74%), Gaps = 8/87 (9%)
 Frame = +1

Query  382  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  558
            T + AFR       RWSH    K SP   T+QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  51   TISPAFR-------RWSHSFHSKPSPFRFTSQIRAVSPVLDRLQRTFSSMASEHPFKGIF  103

Query  559  TSLPKPGGGEFGKFYSLPALNDPRIDK  639
            T+LPKPGGGEFGKFYSLPALNDPR+DK
Sbjct  104  TTLPKPGGGEFGKFYSLPALNDPRVDK  130



>ref|XP_006396145.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
 gb|ESQ36924.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
Length=995

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 70/88 (80%), Gaps = 4/88 (5%)
 Frame = +1

Query  382  TFASAFRSLRCSVPRWSHGVDWKSPASL--TAQIRSAAPVLNDFHRKIATMASENPFKGI  555
            +FA++  + R S+PRWSH +  + P S   ++QIR+ +PVL+   R  ++MASE+PFKGI
Sbjct  50   SFATSSPTFR-SLPRWSHCLHSR-PYSFRFSSQIRAVSPVLDRLERNFSSMASEHPFKGI  107

Query  556  FTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            FTSLPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  108  FTSLPKPGGGEFGKFYSLPALNDPRIDK  135



>ref|XP_002279260.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI28935.3| unnamed protein product [Vitis vinifera]
Length=987

 Score =   106 bits (264),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 55/90 (61%), Positives = 64/90 (71%), Gaps = 9/90 (10%)
 Frame = +1

Query  373  RPLTFAS-AFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  549
            R L F+S AFRSLR         V+++ P SL AQI +A PV+  F R+IATMA EN FK
Sbjct  46   RSLRFSSSAFRSLR--------SVNFRPPMSLRAQIGAAVPVVEQFQRRIATMAPENAFK  97

Query  550  GIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            GI T LPK  GGEFGK+YSLPALNDPR+DK
Sbjct  98   GILTGLPKASGGEFGKYYSLPALNDPRVDK  127



>emb|CDX93088.1| BnaA03g38100D [Brassica napus]
Length=994

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 5/87 (6%)
 Frame = +1

Query  382  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  558
            T + AFRSL    PRWSH +  + S   L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  52   TSSPAFRSL----PRWSHCLHSRPSLFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  107

Query  559  TSLPKPGGGEFGKFYSLPALNDPRIDK  639
            T+LPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  108  TTLPKPGGGEFGKFYSLPALNDPRIDK  134



>ref|XP_010440740.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010440741.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=981

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +1

Query  400  RSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKP  576
            RS   S+PR SH +  K     L +QIR+ +PVL+   R  ++MASE+PFKGIFT+LPKP
Sbjct  41   RSFLTSLPRLSHCLHSKPFQIRLGSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTTLPKP  100

Query  577  GGGEFGKFYSLPALNDPRIDK  639
            GGGEFGKFYSLPALNDPRIDK
Sbjct  101  GGGEFGKFYSLPALNDPRIDK  121



>ref|XP_002870438.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46697.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=977

 Score =   104 bits (259),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +1

Query  400  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  579
            RS   S+PR SH   +  P  + +QIR+ +PVL+   R  ++MASE+P+KGIFT+LPKPG
Sbjct  40   RSFVTSLPRLSHSKPF--PLRIGSQIRAVSPVLDRLQRTFSSMASEHPYKGIFTTLPKPG  97

Query  580  GGEFGKFYSLPALNDPRIDK  639
            GGEFGKFYSLPALNDPRIDK
Sbjct  98   GGEFGKFYSLPALNDPRIDK  117



>emb|CDY56501.1| BnaAnng14360D [Brassica napus]
Length=973

 Score =   104 bits (259),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 6/84 (7%)
 Frame = +1

Query  394  AFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASEN-PFKGIFTSL  567
            AFRSL    PRWSH +  + S   L++ IR+A+PVL+   R  ++MASE+ PFKGIFT+L
Sbjct  46   AFRSL----PRWSHCLHSRPSLFRLSSHIRTASPVLDRLERNFSSMASEHHPFKGIFTTL  101

Query  568  PKPGGGEFGKFYSLPALNDPRIDK  639
            PKPGGGEFGKFYSLPALNDPRIDK
Sbjct  102  PKPGGGEFGKFYSLPALNDPRIDK  125



>ref|XP_010533007.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Tarenaya 
hassleriana]
Length=998

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 62/83 (75%), Gaps = 6/83 (7%)
 Frame = +1

Query  394  AFRSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLP  570
             FRSL    PRWSH +  +S P  +  QIR+ +PVL    +  +TMA E+PFKGIFTSLP
Sbjct  61   GFRSL----PRWSHCLHRRSIPLRVGPQIRAVSPVLERLEKTFSTMA-EHPFKGIFTSLP  115

Query  571  KPGGGEFGKFYSLPALNDPRIDK  639
            KPGGGEFGKFYSLPALNDPRIDK
Sbjct  116  KPGGGEFGKFYSLPALNDPRIDK  138



>ref|XP_007132546.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
 gb|ESW04540.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
Length=846

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +1

Query  421  PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  600
            P+WSH +   SP +L   IR+ AP +  FHR+IA  A ENPFKG  TSLPKPGGGEFGKF
Sbjct  50   PQWSHRLRRVSPLTLRRPIRAVAPPVERFHREIAATAKENPFKGNLTSLPKPGGGEFGKF  109

Query  601  YSLPALNDPRIDK  639
            YSLP+LNDPRID+
Sbjct  110  YSLPSLNDPRIDR  122



>ref|XP_004287944.1| PREDICTED: aconitate hydratase, cytoplasmic [Fragaria vesca subsp. 
vesca]
Length=990

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  424  RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASE-NPFKGIFTSLPKPGGGEFGKF  600
            RWSHGV W++P +L +QIR+ APV+    R+IATMA E +PFK   TSLPKPGGGE+GKF
Sbjct  58   RWSHGVHWRAPYTLRSQIRAIAPVVERVQRRIATMAPESHPFKEHLTSLPKPGGGEYGKF  117

Query  601  YSLPALNDPRIDK  639
            YSL +L DPRID+
Sbjct  118  YSLTSLKDPRIDR  130



>ref|XP_002532564.1| aconitase, putative [Ricinus communis]
 gb|EEF29825.1| aconitase, putative [Ricinus communis]
Length=990

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 65/89 (73%), Gaps = 9/89 (10%)
 Frame = +1

Query  373  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  552
            R  +F+SA RSL C+V RWSH VDW+SP SL AQ  +A+PV+    RK++T+ASE+P   
Sbjct  51   RSFSFSSALRSLPCAVSRWSHRVDWRSPISLRAQAPAASPVI---ERKLSTIASEHP---  104

Query  553  IFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
                  KPGGGEFGKFYSL AL+DPRID+
Sbjct  105  ---XXXKPGGGEFGKFYSLTALDDPRIDR  130



>ref|XP_004517086.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=979

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +1

Query  400  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPG  579
            RS   S+PR++    + S  SL   I +  P +  FHR IATM++ENPFKG  TSLPKPG
Sbjct  40   RSFFSSIPRFNRRFHYTSYRSLRPHISAVTPGIERFHRTIATMSNENPFKGNLTSLPKPG  99

Query  580  GGEFGKFYSLPALNDPRIDK  639
            GGEFGKFYSLP+LNDPRI+K
Sbjct  100  GGEFGKFYSLPSLNDPRIEK  119



>ref|XP_010482909.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Camelina 
sativa]
Length=997

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = +1

Query  391  SAFRSLRC--SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTS  564
            SAFR  R   S  RWS   +W+ P S  AQ R AAP L  F RK A++ASE+ +K I T+
Sbjct  42   SAFRLFRVCSSATRWSQHANWRLPESFRAQTRIAAPRLEKFQRKFASIASEHAYKDILTT  101

Query  565  LPKPGGGEFGKFYSLPALNDPRIDK  639
            L KP  GE+GKFYSLPALNDPRID+
Sbjct  102  LHKPDVGEYGKFYSLPALNDPRIDR  126



>ref|XP_008800034.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=997

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +1

Query  433  HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLP  612
            H  DW+SP S  AQIRS+A V   F R+ ATMA+ N ++ I TSL KPGGGEFGK+YSLP
Sbjct  67   HFGDWRSPLSHRAQIRSSAAVAERFERRFATMATRNSYESILTSLSKPGGGEFGKYYSLP  126

Query  613  ALNDPRIDK  639
            ALNDPRID+
Sbjct  127  ALNDPRIDR  135



>ref|XP_010943467.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=995

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  442  DWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALN  621
            DW+SP S  AQIR +A V   F R  ATMA+ N ++ I TSLPKPGGGEFGK+YSLPALN
Sbjct  68   DWRSPLSHRAQIRYSAAVAERFERYFATMATRNAYESILTSLPKPGGGEFGKYYSLPALN  127

Query  622  DPRIDK  639
            DPRID+
Sbjct  128  DPRIDR  133



>ref|XP_010918136.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=992

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +1

Query  433  HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLP  612
            H  DW+SP S  AQIRS+A V + F R+ ATMA+ N ++ I +SL KPGGGEFGK+YSLP
Sbjct  62   HFGDWRSPLSHRAQIRSSAAVADRFERRFATMATRNSYESILSSLSKPGGGEFGKYYSLP  121

Query  613  ALNDPRIDK  639
            ALNDPRID+
Sbjct  122  ALNDPRIDR  130



>ref|XP_008785050.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=998

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  442  DWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALN  621
            DW+SP S  AQIR +A V   F R   TMA+ N ++ I TSLPKPGGGEFGK+YSLPALN
Sbjct  69   DWRSPLSHRAQIRYSATVAERFERHFTTMATRNAYESILTSLPKPGGGEFGKYYSLPALN  128

Query  622  DPRIDK  639
            DPRID+
Sbjct  129  DPRIDR  134



>ref|XP_009419582.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=1003

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 58/82 (71%), Gaps = 2/82 (2%)
 Frame = +1

Query  400  RSLRCSVP--RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPK  573
            RS    +P  R      W+SP    A+IRS+A V+  F RK+AT+A+EN FK + TSLPK
Sbjct  60   RSCSSYIPGSRVGLSTSWRSPIGPRARIRSSAAVIERFDRKMATVATENVFKDVLTSLPK  119

Query  574  PGGGEFGKFYSLPALNDPRIDK  639
             GGGE+GK+YSLPALNDPRID+
Sbjct  120  TGGGEYGKYYSLPALNDPRIDR  141



>ref|XP_009399225.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=993

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  436  GVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPA  615
            G DW+SP     +IRS++ V+  F RK+ T A+EN FK + TSLPKP GGE+GK+YSLPA
Sbjct  64   GSDWRSPIGPRPRIRSSSTVIQLFDRKMTTTATENVFKDVLTSLPKPEGGEYGKYYSLPA  123

Query  616  LNDPRIDK  639
            LNDPRID+
Sbjct  124  LNDPRIDR  131



>ref|XP_006828850.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
 gb|ERM96266.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
Length=977

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +1

Query  445  WKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALND  624
            W+SP S  A IRS+   L+ F R++ATMA++N ++ I TSLPKP GGEFGK+YSLP+LND
Sbjct  51   WRSPLSHRAFIRSSTINLDRFERRLATMATQNVYESILTSLPKPSGGEFGKYYSLPSLND  110

Query  625  PRIDK  639
            PRIDK
Sbjct  111  PRIDK  115



>gb|EEC83022.1| hypothetical protein OsI_28099 [Oryza sativa Indica Group]
Length=396

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = +1

Query  469  AQIRSAAPVLNDFHRKIA-TMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            AQI + AP +   HR++A T A+E+PFK I T+LPKPGGGE+GKFYSLPALNDPRIDK
Sbjct  74   AQIGAVAPAVERVHRRMAATAAAEHPFKNILTTLPKPGGGEYGKFYSLPALNDPRIDK  131



>ref|XP_008676648.1| PREDICTED: uncharacterized protein LOC100216599 isoform X1 [Zea 
mays]
Length=987

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  457  ASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRID  636
            A   AQI +A P +  F R++AT A+ + FK I TSLPKPGGGE+GKFYSLPALNDPRID
Sbjct  65   AGARAQIGAAVPAVEQFQRRMATQATVHAFKDILTSLPKPGGGEYGKFYSLPALNDPRID  124

Query  637  K  639
            K
Sbjct  125  K  125



>ref|XP_009382046.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=986

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +1

Query  433  HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLP  612
            H  D +SP S  A +RS+A V + F R+ ATMAS+N ++ I T+L KPGGGEFGK+Y LP
Sbjct  56   HLADLRSPISHRALVRSSAAVADRFERRFATMASKNSYESILTTLSKPGGGEFGKYYCLP  115

Query  613  ALNDPRIDK  639
            AL DPRID+
Sbjct  116  ALTDPRIDR  124



>ref|XP_007020811.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12336.1| Aconitase 3 [Theobroma cacao]
Length=951

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 50/73 (68%), Gaps = 7/73 (10%)
 Frame = +1

Query  421  PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKF  600
            PRWSHGVDW SP SL AQ+R A PV+  F R+IAT+ S +          +  G E+G+F
Sbjct  67   PRWSHGVDWNSPGSLRAQVRIAVPVMERFRRRIATIGSVDKSS-------QAWGREYGRF  119

Query  601  YSLPALNDPRIDK  639
            YSLPALNDPRID+
Sbjct  120  YSLPALNDPRIDR  132



>ref|XP_002445174.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
 gb|EES14669.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
Length=996

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = +1

Query  457  ASLTAQIRSAA-PVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRI  633
            A   AQI +AA P +  F R++AT A+E+ FK I TSLPKPGGGE+GKFYSLPALNDPRI
Sbjct  73   AGARAQIGAAAVPAVERFQRRMATQATEHAFKDILTSLPKPGGGEYGKFYSLPALNDPRI  132

Query  634  DK  639
            DK
Sbjct  133  DK  134



>ref|XP_004974379.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=892

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  457  ASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRID  636
            A   AQI +A P +    R++AT A+E+ FK I TSLPKPGGGE+GKFYSLPALNDPRI+
Sbjct  63   AGARAQIGAAVPAVERLQRRMATQATEHAFKNILTSLPKPGGGEYGKFYSLPALNDPRIE  122

Query  637  K  639
            K
Sbjct  123  K  123



>ref|XP_009384004.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384006.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=977

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +1

Query  418  VPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGK  597
            VPR SH  D +SP S  A +RS A V   F R+ ATMA+ N ++ I T+L KPGGG+FGK
Sbjct  43   VPR-SHLSDGRSPISHRALVRSYAAVAYRFERRFATMATRNSYESILTTLRKPGGGDFGK  101

Query  598  FYSLPALNDPRIDK  639
            +YSLPAL DPRI++
Sbjct  102  YYSLPALTDPRIER  115



>gb|AAD25640.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=898

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MASE+PFKGIFT+LPKPGGGEFGKFYSLPALNDPR+DK
Sbjct  1    MASEHPFKGIFTTLPKPGGGEFGKFYSLPALNDPRVDK  38



>gb|AAP30039.1| aconitase [Solanum pennellii]
Length=898

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ENPFKGI T LPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  1    MAAENPFKGILTVLPKPGGGEFGKFYSLPALNDPRIDK  38



>gb|AAO62410.1| aconitase [Solanum pennellii]
Length=898

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ENPFKGI T LPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  1    MAAENPFKGILTVLPKPGGGEFGKFYSLPALNDPRIDK  38



>gb|AAG28426.1|AF194945_1 cytosolic aconitase [Nicotiana tabacum]
Length=898

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ENPFKGI T LPKPGGGEFGK+YSLPALNDPRIDK
Sbjct  1    MAAENPFKGILTVLPKPGGGEFGKYYSLPALNDPRIDK  38



>ref|XP_003573387.2| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=987

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 48/60 (80%), Gaps = 3/60 (5%)
 Frame = +1

Query  469  AQIRS-AAPVL-NDFHRK-IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            AQI + AAP     FHR+ +AT A+E+ FK I TSLPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  66   AQIGAVAAPAAGTSFHRRRMATSATEHAFKNILTSLPKPGGGEFGKFYSLPALNDPRIDK  125



>gb|KJB30565.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30568.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=898

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+E+PFK + TSLPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  1    MAAEHPFKEVLTSLPKPGGGEFGKFYSLPALNDPRIDK  38



>gb|KHG08189.1| hypothetical protein F383_11434 [Gossypium arboreum]
Length=879

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+E+PFK + TSLPKPGGGEFGKFYSLPALNDPRIDK
Sbjct  1    MAAEHPFKEVLTSLPKPGGGEFGKFYSLPALNDPRIDK  38



>sp|Q6YZX6.1|ACOC_ORYSJ RecName: Full=Putative aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Oryza sativa 
Japonica Group]
 dbj|BAD05751.1| putative Aconitate hydratase [Oryza sativa Japonica Group]
Length=898

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+E+PFK I T+LPKPGGGE+GKFYSLPALNDPRIDK
Sbjct  1    MAAEHPFKNILTTLPKPGGGEYGKFYSLPALNDPRIDK  38



>gb|AAC26045.1| aconitase-iron regulated protein 1 [Citrus limon]
Length=898

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA EN FKGI TSLPKPGGGEFGKF+SLPALNDPRID+
Sbjct  1    MAPENAFKGILTSLPKPGGGEFGKFFSLPALNDPRIDR  38



>emb|CBE71057.1| aconitate hydratase 3 [Citrus clementina]
Length=898

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA EN FKGI TSLPKPGGGEFGKF+SLPALNDPRID+
Sbjct  1    MAPENAFKGILTSLPKPGGGEFGKFFSLPALNDPRIDR  38



>gb|ADM34980.1| cytosolic aconitase [Pyrus pyrifolia]
Length=898

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MASENPFK   TSLPKPGGGEFGKFYSLP+LNDPRID+
Sbjct  1    MASENPFKPNLTSLPKPGGGEFGKFYSLPSLNDPRIDR  38



>gb|KHN41224.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=903

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            + +ENPFKG  TSLPKPGGGEFGKFYSLP+LNDPRID+
Sbjct  6    LTNENPFKGNLTSLPKPGGGEFGKFYSLPSLNDPRIDR  43



>emb|CBE71058.1| aconitate hydratase 2 [Citrus clementina]
Length=898

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+E+PFK I T+LPKPGGGEFGKFYSLPALNDPRI+K
Sbjct  1    MAAEHPFKEILTALPKPGGGEFGKFYSLPALNDPRIEK  38



>ref|XP_011097878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=898

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MASE+PFK I T L KPGGGEFGKFYSLPALNDPRIDK
Sbjct  1    MASEHPFKEILTGLSKPGGGEFGKFYSLPALNDPRIDK  38



>sp|P49608.1|ACOC_CUCMA RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Cucurbita maxima]
 pir||T10101 aconitate hydratase (EC 4.2.1.3) - cucurbit
 dbj|BAA06108.1| aconitase [Cucurbita cv. Kurokawa Amakuri]
Length=898

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ENPFK   TSLPKPGGGEFGK+YSLP+LNDPRID+
Sbjct  1    MAAENPFKENLTSLPKPGGGEFGKYYSLPSLNDPRIDR  38



>dbj|BAJ85661.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=984

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  508  HRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
             R++A   +E+ +  I TSLPKPGGGE+GKFYSLPALNDPRIDK
Sbjct  79   QRRMAASGTEHAYSNILTSLPKPGGGEYGKFYSLPALNDPRIDK  122



>ref|XP_004287770.1| PREDICTED: aconitate hydratase 1 [Fragaria vesca subsp. vesca]
Length=898

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ENPFK I  SL KP GGEFGK+YSLPALNDPR+DK
Sbjct  1    MAAENPFKSILKSLEKPDGGEFGKYYSLPALNDPRVDK  38



>ref|XP_008363093.1| PREDICTED: aconitate hydratase 1-like [Malus domestica]
Length=107

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI+K
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDPRIEK  38



>emb|CAA58046.1| aconitase [Arabidopsis thaliana]
Length=919

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  517  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            +++MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDK
Sbjct  20   LSSMASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDK  60



>emb|CAB36543.1| putative aconitase [Arabidopsis thaliana]
 emb|CAB79552.1| putative aconitase [Arabidopsis thaliana]
Length=907

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  517  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            +   ASE+ +K I TSLPKPGGGE+GK+YSLPALNDPRIDK
Sbjct  7    VKNAASEHSYKDILTSLPKPGGGEYGKYYSLPALNDPRIDK  47



>gb|KFK30197.1| hypothetical protein AALP_AA7G230700 [Arabis alpina]
Length=898

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MASENPF+ IF +L KP GGEFG +YSLPALNDPRID+
Sbjct  1    MASENPFRSIFKALEKPDGGEFGNYYSLPALNDPRIDR  38



>ref|XP_007046597.1| Aconitase 1 [Theobroma cacao]
 gb|EOX90754.1| Aconitase 1 [Theobroma cacao]
Length=900

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ENPF  I  +L KPGGGEFGK+YSLPAL+DPRIDK
Sbjct  1    MATENPFNSILKTLEKPGGGEFGKYYSLPALDDPRIDK  38



>gb|KDO71343.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=898

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRIDK
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIDK  38



>gb|KDO71342.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=900

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRIDK
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIDK  38



>ref|XP_007020807.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12332.1| Aconitase 3 [Theobroma cacao]
Length=883

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 38/54 (70%), Gaps = 5/54 (9%)
 Frame = +1

Query  478  RSAAPVLNDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            R  AP LN     +    SE+ FK I TSLPKPGG EFGKFYSLPALNDPRID+
Sbjct  11   RLMAPQLN-----LGMKCSEHAFKAILTSLPKPGGEEFGKFYSLPALNDPRIDR  59



>ref|XP_006413195.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
 gb|ESQ54648.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
Length=962

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  529  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            ASE+ +K I TSLPKPGGGE+GK+YSLPALNDPRID+
Sbjct  97   ASEHAYKDILTSLPKPGGGEYGKYYSLPALNDPRIDR  133



>gb|KDO71344.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=881

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRIDK
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIDK  38



>emb|CDX69174.1| BnaC01g02790D [Brassica napus]
Length=901

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  529  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            ASENPF+ I  +L KPGGGEFG +YSLPALNDPRIDK
Sbjct  5    ASENPFRSILKALEKPGGGEFGNYYSLPALNDPRIDK  41



>gb|KDO71346.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=807

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRIDK
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIDK  38



>ref|NP_195308.1| aconitate hydratase 1 [Arabidopsis thaliana]
 sp|Q42560.2|ACO1_ARATH RecName: Full=Aconitate hydratase 1; Short=Aconitase 1; AltName: 
Full=Citrate hydro-lyase 1 [Arabidopsis thaliana]
 emb|CAA21469.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 emb|CAB81492.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 gb|AAL32850.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE86576.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=898

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDK
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDK  38



>ref|XP_007203240.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
 gb|EMJ04439.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
Length=898

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRIDK
Sbjct  1    MATANPFQKILTALEKPDGGEFGKYYSLPALNDPRIDK  38



>ref|XP_008242011.1| PREDICTED: aconitate hydratase 1 [Prunus mume]
Length=898

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRIDK
Sbjct  1    MATANPFQKILTALEKPDGGEFGKYYSLPALNDPRIDK  38



>ref|XP_006285963.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
 gb|EOA18861.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
Length=898

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDK
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDK  38



>gb|AAL13084.1| putative aconitase [Prunus avium]
Length=902

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRIDK
Sbjct  1    MATANPFQKILTALEKPDGGEFGKYYSLPALNDPRIDK  38



>ref|XP_010526818.1| PREDICTED: aconitate hydratase 1 [Tarenaya hassleriana]
Length=899

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MASENPF  IF +L +P GGEFGK+YSLP LNDPRIDK
Sbjct  1    MASENPFHSIFKTLERPDGGEFGKYYSLPDLNDPRIDK  38



>ref|XP_009109264.1| PREDICTED: aconitate hydratase 1-like [Brassica rapa]
Length=898

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDK
Sbjct  1    MASENPFRSILKTLEKPDGGEFGNYYSLPALNDPRIDK  38



>ref|XP_010437416.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDK
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDK  38



>ref|XP_010446873.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
 ref|XP_010446874.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
Length=898

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDK
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDK  38



>ref|XP_009150005.1| PREDICTED: aconitate hydratase 1 [Brassica rapa]
Length=898

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MASENPF+ I  +L KP GGEFG +YSLPALNDPRIDK
Sbjct  1    MASENPFRSILKALEKPDGGEFGNYYSLPALNDPRIDK  38



>ref|XP_002445994.1| hypothetical protein SORBIDRAFT_06g000200 [Sorghum bicolor]
 gb|EES10322.1| hypothetical protein SORBIDRAFT_06g000200 [Sorghum bicolor]
Length=106

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  529  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            A+++ FK I  SLPKPGGGE+GKF+SLPALNDPRID+
Sbjct  6    ATKHAFKSILASLPKPGGGEYGKFFSLPALNDPRIDR  42



>ref|XP_006412056.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53509.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=898

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MASENPF+ I  +L KPGGGEFG +YSL ALNDPRIDK
Sbjct  1    MASENPFRCILKTLQKPGGGEFGNYYSLAALNDPRIDK  38



>ref|XP_010432222.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MAS+NPF+ I  +L KP GGEFG +YSLPALNDPRIDK
Sbjct  1    MASDNPFRSILKALEKPDGGEFGNYYSLPALNDPRIDK  38



>gb|KHG25176.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=929

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MAS NPF  I  +L KP GGEFGK+YSLPALNDPRIDK
Sbjct  1    MASANPFNSILKTLEKPQGGEFGKYYSLPALNDPRIDK  38



>ref|XP_006412054.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 ref|XP_006412055.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53507.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53508.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=763

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MASENPF+ I  +L KPGGGEFG +YSL ALNDPRIDK
Sbjct  1    MASENPFRCILKTLQKPGGGEFGNYYSLAALNDPRIDK  38



>gb|KHG25175.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=900

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MAS NPF  I  +L KP GGEFGK+YSLPALNDPRIDK
Sbjct  1    MASANPFNSILKTLEKPQGGEFGKYYSLPALNDPRIDK  38



>ref|XP_009344825.1| PREDICTED: aconitate hydratase 1 [Pyrus x bretschneideri]
Length=898

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MAS NPF+ I T+L +P GGEFGK+YSLPALNDPRI+K
Sbjct  1    MASANPFQKILTALERPDGGEFGKYYSLPALNDPRIEK  38



>ref|XP_009363442.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI+K
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDPRIEK  38



>gb|KJB48278.1| hypothetical protein B456_008G061900 [Gossypium raimondii]
Length=900

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MAS NPF  I  +L KP GGEFGK+YSLPALNDPRIDK
Sbjct  1    MASANPFNSILKTLEKPQGGEFGKYYSLPALNDPRIDK  38



>ref|XP_009337075.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI+K
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDPRIEK  38



>ref|XP_008337967.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=898

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ NPF+ I T+L KP GGEFGK+YSLPALNDPRI+K
Sbjct  1    MAAANPFQKILTALEKPDGGEFGKYYSLPALNDPRIEK  38



>emb|CDX75532.1| BnaA01g01700D [Brassica napus]
Length=925

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  517  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            +   ASENPF+ I  +L KP GGEFG +YSLPALNDPRIDK
Sbjct  25   VCVSASENPFRSILKALEKPDGGEFGSYYSLPALNDPRIDK  65



>emb|CBE71056.1| aconitate hydratase 1 [Citrus clementina]
Length=900

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRI K
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIGK  38



>ref|XP_006467022.1| PREDICTED: aconitate hydratase 1 [Citrus sinensis]
Length=900

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRI K
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIGK  38



>gb|KDP23953.1| hypothetical protein JCGZ_25341 [Jatropha curcas]
Length=900

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            M +ENPF  I  +L KP GGEFGK+YSLPALNDPRIDK
Sbjct  1    MVNENPFTSILKTLEKPDGGEFGKYYSLPALNDPRIDK  38



>gb|KHN41868.1| Aconitate hydratase 1 [Glycine soja]
Length=901

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALNDPRIDK  639
            MA+ENPF  I T+L KPGG GEFGK++SLPALNDPRID+
Sbjct  1    MATENPFNSILTTLEKPGGAGEFGKYFSLPALNDPRIDR  39



>emb|CDY41626.1| BnaC03g62580D [Brassica napus]
Length=905

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            ++SENPF+ I  +L KP GGEFG +YSLPALNDPRIDK
Sbjct  8    LSSENPFRSILKTLEKPDGGEFGNYYSLPALNDPRIDK  45



>ref|XP_008669746.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
 tpg|DAA38797.1| TPA: hypothetical protein ZEAMMB73_641300 [Zea mays]
Length=975

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 4/65 (6%)
 Frame = +1

Query  457  ASLTAQIRSAA---PVLNDFHR-KIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALND  624
            A L   + ++A   P  +  HR ++   A+++ FK I TSL KPGGGE+GKF+SLPALND
Sbjct  49   ARLVPDVTTSAKLQPRDDALHRIRVGVGATKHAFKRILTSLIKPGGGEYGKFFSLPALND  108

Query  625  PRIDK  639
            PRIDK
Sbjct  109  PRIDK  113



>gb|EMS45933.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=858

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  517  IATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            +A   +E+ +  I TSLPKP GGE+GKFYSLPALNDPRIDK
Sbjct  1    MAASGTEHAYNNILTSLPKPEGGEYGKFYSLPALNDPRIDK  41



>gb|KDO71345.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=889

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRID  636
            MA+ENPFK I  +L +P GGEFGK+YSLPALNDPRI+
Sbjct  1    MATENPFKSILKTLQRPDGGEFGKYYSLPALNDPRIE  37



>ref|XP_006425366.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
 gb|ESR38606.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
Length=900

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ENPFK I  +L  P GGEFGK+YSLPALNDPRI K
Sbjct  1    MATENPFKSILKTLQSPDGGEFGKYYSLPALNDPRIGK  38



>ref|XP_002460765.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
 gb|EER97286.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
Length=979

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  511  RKIATMASENP-FKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            R +ATMA  N  F  + TSLPKPGGGE+GK+YSLPALNDPRI++
Sbjct  72   RGLATMADGNSRFGHVLTSLPKPGGGEYGKYYSLPALNDPRIER  115



>ref|XP_006380559.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
 gb|ERP58356.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
Length=899

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 1/38 (3%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ENPFK I  +L KPGG EFGK+YSLPALNDPRID+
Sbjct  1    MANENPFKSILKTLEKPGG-EFGKYYSLPALNDPRIDR  37



>emb|CBI24446.3| unnamed protein product [Vitis vinifera]
Length=918

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  499  NDFHRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            ++F ++    AS NPF  I  +L KP GGEFGK+YSLPAL DPRID+
Sbjct  10   SNFSKRKNNYASSNPFASILKTLEKPAGGEFGKYYSLPALGDPRIDR  56



>ref|XP_010100637.1| Aconitate hydratase [Morus notabilis]
 gb|EXB83385.1| Aconitate hydratase [Morus notabilis]
Length=938

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 3/49 (6%)
 Frame = +1

Query  391  SAFRSLRC---SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATM  528
            +A+RSL     SVPRWSHGV W SP +L +QIR+ APV+  F RKIA+M
Sbjct  50   AAYRSLSSAVRSVPRWSHGVHWNSPYTLRSQIRAVAPVIQQFQRKIASM  98



>ref|XP_008669747.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA38798.1| TPA: hypothetical protein ZEAMMB73_641300 [Zea mays]
Length=905

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  523  TMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            + A+++ FK I TSL KPGGGE+GKF+SLPALNDPRIDK
Sbjct  5    STATKHAFKRILTSLIKPGGGEYGKFFSLPALNDPRIDK  43



>ref|XP_010113288.1| Aconitate hydratase 1 [Morus notabilis]
 gb|EXC35295.1| Aconitate hydratase 1 [Morus notabilis]
Length=977

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  535  ENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            ENPFK I  +L KP GGEFGK+YSLPALNDPRI+K
Sbjct  64   ENPFKSILKTLEKPDGGEFGKYYSLPALNDPRIEK  98



>ref|XP_010266897.1| PREDICTED: aconitate hydratase 1 [Nelumbo nucifera]
Length=900

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ N ++ I  +L KPGGGEFGK+YSLPALNDPRIDK
Sbjct  1    MATRNVYESILKTLEKPGGGEFGKYYSLPALNDPRIDK  38



>ref|XP_003517155.1| PREDICTED: aconitate hydratase 1 [Glycine max]
Length=901

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALNDPRIDK  639
            MA+ENPF  I  +L KPGG GEFGK++SLPALNDPRID+
Sbjct  1    MATENPFNSILRTLEKPGGAGEFGKYFSLPALNDPRIDR  39



>gb|EMT33022.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=937

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  532  SENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            +E+ +  I TSLPKP GGE+GKFYSLPALNDPRIDK
Sbjct  40   TEHAYSNILTSLPKPEGGEYGKFYSLPALNDPRIDK  75



>ref|XP_002263337.1| PREDICTED: aconitate hydratase 1 [Vitis vinifera]
Length=900

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MAS NPF  I  +L KP GGEFGK+YSLPAL DPRID+
Sbjct  1    MASSNPFASILKTLEKPAGGEFGKYYSLPALGDPRIDR  38



>ref|XP_007157870.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
 gb|ESW29864.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
Length=901

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 1/39 (3%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDK  639
            M +ENPF  I  +L KPGGG EFGK+YSLPALNDPRID+
Sbjct  1    MVTENPFSSILRTLEKPGGGGEFGKYYSLPALNDPRIDR  39



>ref|NP_001147431.1| aconitase2 [Zea mays]
 gb|ACG27495.1| aconitate hydratase, cytoplasmic [Zea mays]
 gb|ACN28210.1| unknown [Zea mays]
 gb|AFW57775.1| aconitate hydratase, cytoplasmic [Zea mays]
Length=905

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  529  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            A+++ FK I TSL KPGGGE+GKF+SLPALNDPRIDK
Sbjct  6    ATKHAFKRILTSLLKPGGGEYGKFFSLPALNDPRIDK  42



>ref|XP_011022256.1| PREDICTED: aconitate hydratase 1 [Populus euphratica]
Length=899

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 1/38 (3%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            M +ENPFK I  +L KPGG EFGK+YSLPALNDPRID+
Sbjct  1    MVNENPFKSILKTLEKPGG-EFGKYYSLPALNDPRIDR  37



>ref|XP_006383042.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP60839.1| aconitate hydratase family protein [Populus trichocarpa]
Length=899

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 1/38 (3%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            M +ENPFK I  +L KPGG EFGK+YSLPALNDPRID+
Sbjct  1    MVNENPFKSILKTLEKPGG-EFGKYYSLPALNDPRIDR  37



>gb|KJB17578.1| hypothetical protein B456_003G006000 [Gossypium raimondii]
Length=896

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+EN F  I  +L KP GGEFGK+Y LPALNDPRIDK
Sbjct  1    MAAENAFNTILKTLEKPDGGEFGKYYCLPALNDPRIDK  38



>ref|XP_008661884.1| PREDICTED: aconitase2 isoform X1 [Zea mays]
Length=949

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  529  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            A+++ FK I TSL KPGGGE+GKF+SLPALNDPRIDK
Sbjct  67   ATKHAFKRILTSLLKPGGGEYGKFFSLPALNDPRIDK  103



>gb|AES61065.2| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=895

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +1

Query  517  IATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDK  639
            +AT+ SE+ FKGI T LPKPGGG E+GKF+SLP LND RI++
Sbjct  1    MATLTSEHVFKGILTGLPKPGGGDEYGKFFSLPLLNDSRIER  42



>ref|XP_003537655.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=901

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALNDPRIDK  639
            MA+ENPF  I T+L KPGG GEFGK++SLPALND RID+
Sbjct  1    MATENPFNSILTTLEKPGGAGEFGKYFSLPALNDRRIDR  39



>emb|CDY24823.1| BnaA08g14870D [Brassica napus]
Length=922

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  511  RKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            +++    SENPF+ I  +L KP GGEFG +YSL ALNDPRIDK
Sbjct  20   QELRIFTSENPFRSILKTLEKPDGGEFGNYYSLAALNDPRIDK  62



>dbj|BAJ92965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=999

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = +1

Query  505  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDK  639
            F R+ A+ A++N +  I TSL KPGGG +FGK+YSLPAL DPRID+
Sbjct  93   FERRFASAATKNSYDEILTSLAKPGGGADFGKYYSLPALADPRIDR  138



>ref|XP_002867051.1| aconitate hydratase, cytoplasmic [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43310.1| aconitate hydratase, cytoplasmic [Arabidopsis lyrata subsp. lyrata]
Length=868

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRI  633
            MASENPF+GI  +L KP  GEFG +YSLPALND RI
Sbjct  1    MASENPFRGILKALEKPDSGEFGNYYSLPALNDARI  36



>ref|XP_004985790.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=986

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = +1

Query  505  FHRKIATMASENPFKGIFTSLPKPGGGE-FGKFYSLPALNDPRIDK  639
            F R+ A+ A++N +  I T L KPGGGE FGK+YSLPAL+DPRID+
Sbjct  81   FERRFASAATKNSYDEILTGLGKPGGGEEFGKYYSLPALSDPRIDR  126



>ref|XP_010029634.1| PREDICTED: aconitate hydratase 1 [Eucalyptus grandis]
 gb|KCW56577.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=900

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA ENPFK I  +L +PGGGEFG ++SLPAL D RID+
Sbjct  1    MACENPFKSILKTLERPGGGEFGTYFSLPALGDSRIDR  38



>gb|KCW56576.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=898

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA ENPFK I  +L +PGGGEFG ++SLPAL D RID+
Sbjct  1    MACENPFKSILKTLERPGGGEFGTYFSLPALGDSRIDR  38



>ref|XP_001779205.1| predicted protein [Physcomitrella patens]
 gb|EDQ55968.1| predicted protein, partial [Physcomitrella patens]
Length=896

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  529  ASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRID  636
            ASENPF  + T LPKP GG +GKFYSL  LNDPR+D
Sbjct  1    ASENPFSSLITDLPKPDGGSYGKFYSLVKLNDPRVD  36



>ref|XP_008440877.1| PREDICTED: aconitate hydratase [Cucumis melo]
Length=900

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ENPF  I  +L  P GG FGK+YSLPALNDPRI++
Sbjct  1    MATENPFNSILKTLENPEGGVFGKYYSLPALNDPRIER  38



>ref|XP_010033531.1| PREDICTED: aconitate hydratase 1-like [Eucalyptus grandis]
Length=903

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 1/39 (3%)
 Frame = +1

Query  526  MASENPF-KGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            M SENPF K I  +L KP GGEFGK+Y LPAL+DPRID+
Sbjct  1    MGSENPFEKSILRTLEKPDGGEFGKYYYLPALDDPRIDR  39



>ref|XP_010529315.1| PREDICTED: aconitate hydratase 1-like [Tarenaya hassleriana]
Length=901

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            M  ENPF+ I  +L +P GGE+GKF+SLP+LNDPRI+K
Sbjct  1    MDCENPFRRILKTLERPDGGEYGKFFSLPSLNDPRIEK  38



>ref|XP_008670445.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA40969.1| TPA: hypothetical protein ZEAMMB73_742994 [Zea mays]
Length=980

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  511  RKIATMAS-ENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            R +ATMA   + F  + TSLPKPGGGE+GK+YSLPALND RI++
Sbjct  74   RGVATMADGSSRFGHVLTSLPKPGGGEYGKYYSLPALNDRRIER  117



>emb|CAN83844.1| hypothetical protein VITISV_003004 [Vitis vinifera]
Length=885

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  532  SENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            S NPF  I  +L KP GGEFGK+YSLPAL DPRID+
Sbjct  6    SSNPFASILKTLEKPXGGEFGKYYSLPALGDPRIDR  41



>ref|XP_003612247.1| Aconitate hydratase [Medicago truncatula]
 gb|AES95205.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=901

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 1/38 (3%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRID  636
            MA++NPF  I  +L KPGGG EFGK+YSLPALND RID
Sbjct  1    MATQNPFNNILKTLEKPGGGGEFGKYYSLPALNDSRID  38



>ref|XP_008670444.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
Length=982

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  511  RKIATMAS-ENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            R +ATMA   + F  + TSLPKPGGGE+GK+YSLPALND RI++
Sbjct  74   RGVATMADGSSRFGHVLTSLPKPGGGEYGKYYSLPALNDRRIER  117



>ref|XP_004512178.1| PREDICTED: aconitate hydratase 1-like [Cicer arietinum]
Length=901

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 1/39 (3%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGG-GEFGKFYSLPALNDPRIDK  639
            MA+ENPFK I  +L KPGG G FG +YSLPALND RID+
Sbjct  1    MATENPFKSILKTLEKPGGDGHFGNYYSLPALNDSRIDE  39



>ref|XP_008658754.1| PREDICTED: uncharacterized protein LOC100304315 isoform X1 [Zea 
mays]
Length=989

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +1

Query  505  FHRKIATMASENPFKGIFTSLPKPGGGE-FGKFYSLPALNDPRIDK  639
            F R+ A+ A+ N +  I T L +PGGGE FGK+YSLPAL+DPRID+
Sbjct  84   FERRFASAATRNSYDEILTGLGRPGGGEEFGKYYSLPALSDPRIDR  129



>gb|EEC74472.1| hypothetical protein OsI_09921 [Oryza sativa Indica Group]
Length=986

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = +1

Query  505  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDK  639
            F R+ A+ A++N +  I T L KPGGG EFGK+YSLPAL+DPRI++
Sbjct  81   FERRFASAAAKNSYDEILTGLAKPGGGAEFGKYYSLPALSDPRIER  126



>ref|NP_001048898.1| Os03g0136900 [Oryza sativa Japonica Group]
 gb|ABF93861.1| Aconitate hydratase, cytoplasmic, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10812.1| Os03g0136900 [Oryza sativa Japonica Group]
Length=986

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = +1

Query  505  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDK  639
            F R+ A+ A++N +  I T L KPGGG EFGK+YSLPAL+DPRI++
Sbjct  81   FERRFASAAAKNSYDEILTGLAKPGGGAEFGKYYSLPALSDPRIER  126



>ref|XP_002530635.1| aconitase, putative [Ricinus communis]
 gb|EEF31743.1| aconitase, putative [Ricinus communis]
Length=900

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            M +E+PFK I  +L K  GG FGK+YSLPALNDPRID+
Sbjct  1    MVNESPFKSILKTLEKADGGAFGKYYSLPALNDPRIDR  38



>gb|KCW53221.1| hypothetical protein EUGRSUZ_J02488 [Eucalyptus grandis]
Length=930

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +1

Query  520  ATMASENPF-KGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            A   SENPF K I  +L KP GGEFGK+Y LPAL+DPRID+
Sbjct  26   AEQRSENPFEKSILRTLEKPDGGEFGKYYYLPALDDPRIDR  66



>ref|XP_003558862.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=994

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +1

Query  505  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDK  639
            F R+ A+ A++N +  I TSL KPGGG +FGK+YSLP L DPRID+
Sbjct  88   FERRFASAATKNSYDEILTSLAKPGGGADFGKYYSLPRLADPRIDR  133



>ref|XP_003590814.1| Aconitate hydratase [Medicago truncatula]
Length=924

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 1/37 (3%)
 Frame = +1

Query  532  SENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDK  639
            SE+ FKGI T LPKPGGG E+GKF+SLP LND RI++
Sbjct  35   SEHVFKGILTGLPKPGGGDEYGKFFSLPLLNDSRIER  71



>gb|EMT24311.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=1009

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  544  FKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            F    T LPKPGGGE+GKFYS+PALNDP+IDK
Sbjct  120  FAKTLTILPKPGGGEYGKFYSIPALNDPKIDK  151



>ref|XP_002465901.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
 gb|ABE77202.1| putative aconitate hydratase 1 [Sorghum bicolor]
 gb|EER92899.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
Length=991

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +1

Query  505  FHRKIATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDK  639
            F R+ A+ A+ N +  I T L +PG G EFGK+YSLPAL+DPRID+
Sbjct  86   FERRFASAATRNTYDEILTGLKRPGAGDEFGKYYSLPALSDPRIDR  131



>ref|XP_004166975.1| PREDICTED: aconitate hydratase 1-like, partial [Cucumis sativus]
Length=466

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ENPF  I  +L    GG FGK+YSLPALNDPRI++
Sbjct  1    MATENPFNSILKTLENHEGGVFGKYYSLPALNDPRIER  38



>ref|XP_004134842.1| PREDICTED: aconitate hydratase 1-like [Cucumis sativus]
Length=900

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ENPF  I  +L    GG FGK+YSLPALNDPRI++
Sbjct  1    MATENPFNSILKTLENHEGGVFGKYYSLPALNDPRIER  38



>gb|KGN48958.1| Aconitase [Cucumis sativus]
Length=881

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  MASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            MA+ENPF  I  +L    GG FGK+YSLPALNDPRI++
Sbjct  1    MATENPFNSILKTLENHEGGVFGKYYSLPALNDPRIER  38



>ref|XP_002976825.1| hypothetical protein SELMODRAFT_443331 [Selaginella moellendorffii]
 gb|EFJ21935.1| hypothetical protein SELMODRAFT_443331 [Selaginella moellendorffii]
Length=949

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  508  HRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
             R+   M S +PF+ I TSL K  GGE+GK+YSLP L+DPRI+K
Sbjct  45   QRQEIAMVSGHPFESILTSLSKDDGGEYGKYYSLPDLHDPRIEK  88



>ref|XP_002980554.1| hypothetical protein SELMODRAFT_444572 [Selaginella moellendorffii]
 gb|EFJ18205.1| hypothetical protein SELMODRAFT_444572 [Selaginella moellendorffii]
Length=949

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  508  HRKIATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
             R+   M S +PF+ I TSL K  GGE+GK+YSLP L+DPRI+K
Sbjct  45   QRQEIAMVSGHPFESILTSLSKDDGGEYGKYYSLPDLHDPRIEK  88



>gb|EMS48231.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=860

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 1/38 (3%)
 Frame = +1

Query  529  ASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDK  639
            A++N +  I TSL KPGGG +FGK+YSLPAL DPRID+
Sbjct  14   ATKNSYDEILTSLAKPGGGADFGKYYSLPALADPRIDR  51



>ref|XP_006651017.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Oryza 
brachyantha]
Length=906

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +1

Query  517  IATMASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDK  639
            +   A+ N +  I TSL KPGGG EFGK+YSLPAL+DPRI++
Sbjct  5    VVLAATRNSYDEILTSLAKPGGGPEFGKYYSLPALSDPRIER  46



>gb|EMT03129.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=1967

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 1/38 (3%)
 Frame = +1

Query  529   ASENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDK  639
             A++N +  I TSL KPGGG +FGK+YSLPAL DPRID+
Sbjct  1069  ATKNSYDEILTSLAKPGGGADFGKYYSLPALADPRIDR  1106



>gb|ADZ57218.1| aconitase protein [Litchi chinensis]
Length=883

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/23 (96%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +1

Query  571  KPGGGEFGKFYSLPALNDPRIDK  639
            KPGGGEFGKFY LPALNDPRIDK
Sbjct  1    KPGGGEFGKFYRLPALNDPRIDK  23



>ref|XP_001770969.1| predicted protein [Physcomitrella patens]
 gb|EDQ64299.1| predicted protein [Physcomitrella patens]
Length=898

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  520  ATMASENPFKGIFTSLPKPGGGEFGKFYSLPALNDPRIDK  639
            ++ AS+NPF  + T LPK  GG +G++YSL  LNDPR+D+
Sbjct  3    SSPASKNPFSNLVTDLPKASGGSYGQYYSLVKLNDPRVDE  42



>gb|KHN36000.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=908

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 1/30 (3%)
 Frame = +1

Query  553  IFTSLPKPGG-GEFGKFYSLPALNDPRIDK  639
            I T+L KPGG GEFGK++SLPALNDPRID+
Sbjct  17   ILTTLEKPGGAGEFGKYFSLPALNDPRIDR  46



>gb|EEE58288.1| hypothetical protein OsJ_09326 [Oryza sativa Japonica Group]
Length=907

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = +1

Query  532  SENPFKGIFTSLPKPGGG-EFGKFYSLPALNDPRIDK  639
            ++N +  I T L KPGGG EFGK+YSLPAL+DPRI++
Sbjct  11   AKNSYDEILTGLAKPGGGAEFGKYYSLPALSDPRIER  47



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750