BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS058C09

Length=642
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009775244.1|  PREDICTED: lysosomal alpha-mannosidase-like        308   3e-94   Nicotiana sylvestris
ref|XP_009591416.1|  PREDICTED: lysosomal alpha-mannosidase-like        308   4e-94   Nicotiana tomentosiformis
ref|XP_006365417.1|  PREDICTED: lysosomal alpha-mannosidase-like        302   3e-92   Solanum tuberosum [potatoes]
ref|NP_001234851.1|  alpha-mannosidase precursor                        301   7e-92   Solanum lycopersicum
gb|ADU20406.1|  alpha-mannosidase                                       298   1e-90   Capsicum annuum
gb|ABY83271.1|  alpha-mannosidase                                       297   2e-90   Solanum lycopersicum
emb|CDP17307.1|  unnamed protein product                                294   4e-89   Coffea canephora [robusta coffee]
emb|CDO98309.1|  unnamed protein product                                291   3e-88   Coffea canephora [robusta coffee]
ref|XP_008348155.1|  PREDICTED: lysosomal alpha-mannosidase-like        276   6e-87   
ref|XP_008350944.1|  PREDICTED: lysosomal alpha-mannosidase-like        268   2e-86   
gb|AIX48016.1|  LMann protein                                           285   7e-86   synthetic construct
ref|XP_009378044.1|  PREDICTED: lysosomal alpha-mannosidase-like        283   5e-85   Pyrus x bretschneideri [bai li]
gb|EYU24520.1|  hypothetical protein MIMGU_mgv1a0008521mg               263   1e-84   Erythranthe guttata [common monkey flower]
gb|KHN31257.1|  Lysosomal alpha-mannosidase                             281   1e-84   Glycine soja [wild soybean]
ref|XP_008379739.1|  PREDICTED: lysosomal alpha-mannosidase-like        278   1e-84   
ref|XP_003523176.1|  PREDICTED: lysosomal alpha-mannosidase-like        281   1e-84   Glycine max [soybeans]
ref|XP_007032025.1|  Glycosyl hydrolase family 38 protein               281   2e-84   
gb|AGR44468.1|  alpha-mannosidase                                       280   5e-84   Pyrus x bretschneideri [bai li]
ref|XP_007214917.1|  hypothetical protein PRUPE_ppa000717mg             280   5e-84   Prunus persica
ref|XP_008231241.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    280   7e-84   Prunus mume [ume]
ref|XP_004297489.1|  PREDICTED: alpha-mannosidase-like                  279   1e-83   Fragaria vesca subsp. vesca
ref|XP_006485097.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    278   2e-83   Citrus sinensis [apfelsine]
gb|KJB76312.1|  hypothetical protein B456_012G082700                    277   2e-83   Gossypium raimondii
ref|XP_006485096.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    278   2e-83   Citrus sinensis [apfelsine]
gb|KJB76306.1|  hypothetical protein B456_012G082700                    277   2e-83   Gossypium raimondii
gb|KJB76311.1|  hypothetical protein B456_012G082700                    278   3e-83   Gossypium raimondii
gb|KJB76313.1|  hypothetical protein B456_012G082700                    278   3e-83   Gossypium raimondii
gb|KJB76308.1|  hypothetical protein B456_012G082700                    278   3e-83   Gossypium raimondii
gb|KJB76304.1|  hypothetical protein B456_012G082700                    278   3e-83   Gossypium raimondii
gb|KJB76307.1|  hypothetical protein B456_012G082700                    278   3e-83   Gossypium raimondii
gb|KJB76305.1|  hypothetical protein B456_012G082700                    277   3e-83   Gossypium raimondii
ref|XP_004501750.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    276   7e-83   Cicer arietinum [garbanzo]
ref|XP_004501751.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    276   7e-83   
ref|XP_007137859.1|  hypothetical protein PHAVU_009G161600g             272   8e-83   Phaseolus vulgaris [French bean]
ref|XP_007038135.1|  Glycosyl hydrolase family 38 protein isoform 4     273   9e-83   
ref|XP_011042968.1|  PREDICTED: alpha-mannosidase-like                  276   1e-82   Populus euphratica
ref|XP_010249227.1|  PREDICTED: lysosomal alpha-mannosidase-like        276   1e-82   
ref|XP_007038136.1|  Glycosyl hydrolase family 38 protein isoform 5     272   1e-82   
ref|XP_002318770.1|  hypothetical protein POPTR_0012s10830g             276   2e-82   
ref|XP_002511094.1|  lysosomal alpha-mannosidase, putative              274   8e-82   Ricinus communis
ref|XP_007038134.1|  Glycosyl hydrolase family 38 protein isoform 3     273   1e-81   
ref|XP_007038133.1|  Glycosyl hydrolase family 38 protein isoform 2     273   1e-81   
ref|XP_007038132.1|  Glycosyl hydrolase family 38 protein isoform 1     273   2e-81   
gb|KDP22539.1|  hypothetical protein JCGZ_26370                         273   2e-81   Jatropha curcas
gb|KJB19726.1|  hypothetical protein B456_003G116600                    273   2e-81   Gossypium raimondii
ref|XP_007210406.1|  hypothetical protein PRUPE_ppa000755mg             273   2e-81   Prunus persica
ref|XP_011083026.1|  PREDICTED: alpha-mannosidase-like                  272   3e-81   Sesamum indicum [beniseed]
ref|XP_010550227.1|  PREDICTED: lysosomal alpha-mannosidase             272   4e-81   Tarenaya hassleriana [spider flower]
gb|KDO51267.1|  hypothetical protein CISIN_1g001813mg                   271   4e-81   Citrus sinensis [apfelsine]
ref|XP_008239559.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    272   4e-81   Prunus mume [ume]
ref|XP_008239561.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    271   5e-81   Prunus mume [ume]
ref|XP_003526925.1|  PREDICTED: lysosomal alpha-mannosidase-like        271   6e-81   Glycine max [soybeans]
gb|KDO51266.1|  hypothetical protein CISIN_1g001813mg                   271   6e-81   Citrus sinensis [apfelsine]
gb|KDP41855.1|  hypothetical protein JCGZ_26873                         271   7e-81   Jatropha curcas
gb|KHN09713.1|  Lysosomal alpha-mannosidase                             271   7e-81   Glycine soja [wild soybean]
gb|KDO51268.1|  hypothetical protein CISIN_1g001813mg                   270   7e-81   Citrus sinensis [apfelsine]
ref|XP_009339045.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    271   9e-81   
ref|XP_009339044.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    271   1e-80   Pyrus x bretschneideri [bai li]
gb|KDO43591.1|  hypothetical protein CISIN_1g0150281mg                  249   3e-80   Citrus sinensis [apfelsine]
ref|XP_010249229.1|  PREDICTED: lysosomal alpha-mannosidase-like        269   5e-80   Nelumbo nucifera [Indian lotus]
ref|XP_010028936.1|  PREDICTED: lysosomal alpha-mannosidase             268   7e-80   Eucalyptus grandis [rose gum]
ref|XP_011468215.1|  PREDICTED: alpha-mannosidase isoform X2            267   2e-79   Fragaria vesca subsp. vesca
ref|XP_010682967.1|  PREDICTED: alpha-mannosidase-like                  267   2e-79   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO43582.1|  hypothetical protein CISIN_1g0020361mg                  263   2e-79   Citrus sinensis [apfelsine]
ref|XP_004304565.1|  PREDICTED: alpha-mannosidase isoform X1            267   2e-79   Fragaria vesca subsp. vesca
ref|XP_002276092.2|  PREDICTED: alpha-mannosidase isoform X2            267   3e-79   Vitis vinifera
ref|XP_002512840.1|  lysosomal alpha-mannosidase, putative              266   3e-79   
ref|XP_010660680.1|  PREDICTED: alpha-mannosidase isoform X1            266   3e-79   
gb|KHG03548.1|  Lysosomal alpha-mannosidase                             266   5e-79   Gossypium arboreum [tree cotton]
ref|XP_004143760.1|  PREDICTED: lysosomal alpha-mannosidase-like        266   5e-79   Cucumis sativus [cucumbers]
ref|XP_011098968.1|  PREDICTED: alpha-mannosidase isoform X3            266   6e-79   
ref|XP_011098966.1|  PREDICTED: alpha-mannosidase isoform X1            266   7e-79   Sesamum indicum [beniseed]
ref|XP_011098967.1|  PREDICTED: alpha-mannosidase isoform X2            266   8e-79   Sesamum indicum [beniseed]
ref|XP_003602752.1|  Lysosomal alpha-mannosidase                        265   9e-79   Medicago truncatula
ref|XP_003602753.1|  Lysosomal alpha-mannosidase                        265   1e-78   
ref|XP_010039003.1|  PREDICTED: lysosomal alpha-mannosidase-like        263   3e-78   
ref|XP_006468891.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    263   4e-78   Citrus sinensis [apfelsine]
ref|XP_006436953.1|  hypothetical protein CICLE_v10030627mg             263   5e-78   
gb|AGX24942.1|  a-mannosidase                                           263   8e-78   Cucumis melo [Oriental melon]
ref|XP_008465523.1|  PREDICTED: lysosomal alpha-mannosidase             263   8e-78   
ref|XP_006844480.1|  hypothetical protein AMTR_s00016p00106660          263   9e-78   Amborella trichopoda
tpg|DAA42034.1|  TPA: alpha-mannosidase                                 256   2e-77   
ref|XP_010453503.1|  PREDICTED: lysosomal alpha-mannosidase-like        261   4e-77   Camelina sativa [gold-of-pleasure]
ref|XP_011033760.1|  PREDICTED: alpha-mannosidase-like isoform X1       261   4e-77   Populus euphratica
ref|XP_006446932.1|  hypothetical protein CICLE_v10014123mg             260   4e-77   
ref|XP_010420018.1|  PREDICTED: lysosomal alpha-mannosidase-like        261   4e-77   Camelina sativa [gold-of-pleasure]
ref|XP_006446933.1|  hypothetical protein CICLE_v10014123mg             261   4e-77   Citrus clementina [clementine]
gb|KFK25632.1|  hypothetical protein AALP_AA8G139900                    260   9e-77   Arabis alpina [alpine rockcress]
ref|XP_002449583.1|  hypothetical protein SORBIDRAFT_05g019600          259   1e-76   Sorghum bicolor [broomcorn]
ref|XP_006399901.1|  hypothetical protein EUTSA_v10012546mg             258   1e-76   
ref|XP_006399902.1|  hypothetical protein EUTSA_v10012546mg             259   1e-76   Eutrema salsugineum [saltwater cress]
ref|NP_001031878.1|  Glycosyl hydrolase family 38 protein               258   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289410.1|  hypothetical protein CARUB_v10002909mg             259   2e-76   Capsella rubella
ref|XP_011463212.1|  PREDICTED: alpha-mannosidase-like isoform X2       259   2e-76   Fragaria vesca subsp. vesca
dbj|BAB11126.1|  alpha-mannosidase                                      259   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196902.2|  Glycosyl hydrolase family 38 protein                  258   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008670747.1|  PREDICTED: lysosomal alpha-mannosidase             258   2e-76   
ref|XP_009415848.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    258   3e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415849.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    258   3e-76   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA42033.1|  TPA: alpha-mannosidase                                 258   3e-76   
ref|XP_011463211.1|  PREDICTED: alpha-mannosidase-like isoform X1       258   3e-76   Fragaria vesca subsp. vesca
ref|XP_008374165.1|  PREDICTED: lysosomal alpha-mannosidase-like        258   4e-76   
ref|XP_010492186.1|  PREDICTED: lysosomal alpha-mannosidase-like        257   7e-76   Camelina sativa [gold-of-pleasure]
ref|XP_002871594.1|  glycosyl hydrolase family 38 protein               257   1e-75   
gb|KJB33198.1|  hypothetical protein B456_006G000300                    252   1e-75   Gossypium raimondii
ref|XP_010663638.1|  PREDICTED: alpha-mannosidase                       256   2e-75   Vitis vinifera
gb|KDP41856.1|  hypothetical protein JCGZ_26874                         256   2e-75   Jatropha curcas
ref|XP_006446930.1|  hypothetical protein CICLE_v10017635mg             252   3e-75   
gb|EPS72042.1|  alpha-mannosidase                                       254   4e-75   Genlisea aurea
ref|XP_003577518.1|  PREDICTED: lysosomal alpha-mannosidase-like        255   5e-75   
ref|XP_003548858.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    254   6e-75   
emb|CDX70531.1|  BnaC03g06150D                                          254   8e-75   
ref|XP_007161620.1|  hypothetical protein PHAVU_001G084700g             254   9e-75   Phaseolus vulgaris [French bean]
ref|XP_007161616.1|  hypothetical protein PHAVU_001G084400g             246   1e-74   Phaseolus vulgaris [French bean]
gb|KCW48512.1|  hypothetical protein EUGRSUZ_K02195                     254   1e-74   Eucalyptus grandis [rose gum]
ref|XP_010942369.1|  PREDICTED: alpha-mannosidase-like                  253   2e-74   Elaeis guineensis
ref|XP_010682958.1|  PREDICTED: alpha-mannosidase                       253   2e-74   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX78550.1|  BnaA03g04620D                                          253   2e-74   
gb|KHG00745.1|  Lysosomal alpha-mannosidase                             253   3e-74   Gossypium arboreum [tree cotton]
gb|KJB33199.1|  hypothetical protein B456_006G000300                    251   4e-74   Gossypium raimondii
ref|XP_009131373.1|  PREDICTED: lysosomal alpha-mannosidase             252   4e-74   Brassica rapa
gb|KJB33197.1|  hypothetical protein B456_006G000300                    252   5e-74   Gossypium raimondii
ref|XP_004979371.1|  PREDICTED: lysosomal alpha-mannosidase-like        251   8e-74   Setaria italica
ref|XP_006468893.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    251   9e-74   Citrus sinensis [apfelsine]
ref|XP_006468894.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    251   1e-73   
ref|XP_002280858.1|  PREDICTED: alpha-mannosidase                       251   1e-73   Vitis vinifera
ref|XP_010660681.1|  PREDICTED: alpha-mannosidase                       251   1e-73   Vitis vinifera
ref|XP_003577519.1|  PREDICTED: lysosomal alpha-mannosidase-like        251   2e-73   Brachypodium distachyon [annual false brome]
ref|XP_002321075.2|  glycosyl hydrolase family 38 family protein        250   2e-73   
ref|XP_002301760.2|  glycosyl hydrolase family 38 family protein        250   3e-73   Populus trichocarpa [western balsam poplar]
ref|XP_008379047.1|  PREDICTED: lysosomal alpha-mannosidase             250   3e-73   
gb|AES80719.2|  glycoside hydrolase family 38 amino-terminal doma...    249   4e-73   Medicago truncatula
ref|XP_003624501.1|  Lysosomal alpha-mannosidase                        249   6e-73   
gb|KEH23493.1|  glycoside hydrolase family 38 amino-terminal doma...    247   6e-73   Medicago truncatula
ref|XP_007214915.1|  hypothetical protein PRUPE_ppa000707mg             249   7e-73   Prunus persica
ref|XP_008231240.1|  PREDICTED: lysosomal alpha-mannosidase             248   9e-73   Prunus mume [ume]
ref|XP_003548841.1|  PREDICTED: lysosomal alpha-mannosidase-like        248   1e-72   Glycine max [soybeans]
ref|XP_008791035.1|  PREDICTED: lysosomal alpha-mannosidase             248   1e-72   Phoenix dactylifera
ref|XP_003553307.2|  PREDICTED: lysosomal alpha-mannosidase-like ...    248   1e-72   Glycine max [soybeans]
ref|XP_002512839.1|  lysosomal alpha-mannosidase, putative              248   1e-72   
ref|XP_010929675.1|  PREDICTED: alpha-mannosidase                       248   2e-72   Elaeis guineensis
ref|XP_003520192.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    248   2e-72   Glycine max [soybeans]
ref|XP_006665027.1|  PREDICTED: lysosomal alpha-mannosidase-like        247   2e-72   Oryza brachyantha
ref|XP_011024751.1|  PREDICTED: alpha-mannosidase isoform X1            248   2e-72   Populus euphratica
gb|KHN00464.1|  Lysosomal alpha-mannosidase                             247   3e-72   Glycine soja [wild soybean]
gb|KHN46850.1|  Lysosomal alpha-mannosidase                             246   4e-72   Glycine soja [wild soybean]
ref|XP_004306319.1|  PREDICTED: alpha-mannosidase                       246   5e-72   Fragaria vesca subsp. vesca
ref|NP_001067993.1|  Os11g0525600                                       246   9e-72   
gb|EEC68272.1|  hypothetical protein OsI_36309                          246   9e-72   Oryza sativa Indica Group [Indian rice]
gb|ABG22500.1|  Glycosyl hydrolases family 38 protein, expressed        246   9e-72   Oryza sativa Japonica Group [Japonica rice]
gb|AIX48008.1|  LMann protein                                           244   2e-71   synthetic construct
gb|KCW53178.1|  hypothetical protein EUGRSUZ_J02455                     243   2e-71   Eucalyptus grandis [rose gum]
ref|XP_004493076.1|  PREDICTED: lysosomal alpha-mannosidase-like        244   3e-71   Cicer arietinum [garbanzo]
ref|XP_010096026.1|  Lysosomal alpha-mannosidase                        243   3e-71   
ref|XP_008646753.1|  PREDICTED: lysosomal alpha-mannosidase-like        227   3e-71   
gb|KCW53177.1|  hypothetical protein EUGRSUZ_J02455                     244   4e-71   Eucalyptus grandis [rose gum]
ref|XP_010033509.1|  PREDICTED: lysosomal alpha-mannosidase-like        244   4e-71   
gb|KJB17632.1|  hypothetical protein B456_003G008600                    244   4e-71   Gossypium raimondii
ref|XP_008788433.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    243   5e-71   
gb|KJB17633.1|  hypothetical protein B456_003G008600                    243   5e-71   Gossypium raimondii
ref|XP_008788432.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    243   5e-71   
gb|KHG14504.1|  Lysosomal alpha-mannosidase                             243   6e-71   Gossypium arboreum [tree cotton]
ref|XP_007032026.1|  Glycosyl hydrolase family 38 protein               243   6e-71   
ref|XP_010920132.1|  PREDICTED: alpha-mannosidase-like                  243   7e-71   
gb|KCW53175.1|  hypothetical protein EUGRSUZ_J02454                     243   8e-71   Eucalyptus grandis [rose gum]
ref|XP_010034699.1|  PREDICTED: lysosomal alpha-mannosidase-like        243   9e-71   
ref|XP_007156173.1|  hypothetical protein PHAVU_003G264400g             243   1e-70   Phaseolus vulgaris [French bean]
ref|XP_004232502.1|  PREDICTED: lysosomal alpha-mannosidase             241   4e-70   Solanum lycopersicum
ref|XP_007157901.1|  hypothetical protein PHAVU_002G1073000g            238   4e-70   Phaseolus vulgaris [French bean]
gb|KCW53184.1|  hypothetical protein EUGRSUZ_J02460                     240   7e-70   Eucalyptus grandis [rose gum]
ref|XP_010920133.1|  PREDICTED: alpha-mannosidase-like                  239   1e-69   Elaeis guineensis
emb|CDP01879.1|  unnamed protein product                                239   1e-69   Coffea canephora [robusta coffee]
ref|XP_010066409.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal al...    239   1e-69   
ref|XP_010040832.1|  PREDICTED: lysosomal alpha-mannosidase-like        234   2e-69   Eucalyptus grandis [rose gum]
ref|XP_006380603.1|  hypothetical protein POPTR_0007s09730g             239   2e-69   Populus trichocarpa [western balsam poplar]
ref|XP_006340752.1|  PREDICTED: lysosomal alpha-mannosidase-like        239   2e-69   Solanum tuberosum [potatoes]
ref|XP_009379378.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    238   3e-69   Pyrus x bretschneideri [bai li]
ref|XP_009379379.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    238   3e-69   
ref|XP_008354624.1|  PREDICTED: lysosomal alpha-mannosidase-like        238   3e-69   
ref|XP_003624502.1|  Lysosomal alpha-mannosidase                        238   3e-69   Medicago truncatula
ref|XP_008242061.1|  PREDICTED: lysosomal alpha-mannosidase             238   5e-69   Prunus mume [ume]
ref|XP_011098969.1|  PREDICTED: alpha-mannosidase                       238   6e-69   Sesamum indicum [beniseed]
gb|KFK28275.1|  hypothetical protein AALP_AA8G495400                    238   6e-69   Arabis alpina [alpine rockcress]
ref|XP_008440841.1|  PREDICTED: lysosomal alpha-mannosidase             237   7e-69   Cucumis melo [Oriental melon]
ref|XP_003629280.1|  Lysosomal alpha-mannosidase                        237   8e-69   
ref|XP_009412777.1|  PREDICTED: lysosomal alpha-mannosidase             237   8e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010040831.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal al...    237   8e-69   
ref|XP_010528132.1|  PREDICTED: lysosomal alpha-mannosidase             237   1e-68   Tarenaya hassleriana [spider flower]
ref|XP_011008830.1|  PREDICTED: alpha-mannosidase isoform X2            237   1e-68   Populus euphratica
ref|XP_011008829.1|  PREDICTED: alpha-mannosidase isoform X1            237   1e-68   Populus euphratica
gb|KFK33593.1|  hypothetical protein AALP_AA5G034100                    237   1e-68   Arabis alpina [alpine rockcress]
ref|XP_006830303.1|  hypothetical protein AMTR_s00121p00111530          237   1e-68   
ref|XP_009591889.1|  PREDICTED: lysosomal alpha-mannosidase-like        233   1e-68   Nicotiana tomentosiformis
ref|XP_007203420.1|  hypothetical protein PRUPE_ppa021513mg             236   1e-68   
ref|NP_189306.1|  glycosyl hydrolase family 38 protein                  237   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006466974.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    236   1e-68   Citrus sinensis [apfelsine]
ref|XP_008354644.1|  PREDICTED: lysosomal alpha-mannosidase-like        236   1e-68   
ref|XP_006425431.1|  hypothetical protein CICLE_v10024800mg             236   1e-68   
gb|KDO71257.1|  hypothetical protein CISIN_1g001850mg                   235   2e-68   Citrus sinensis [apfelsine]
dbj|BAH56863.1|  AT3G26720                                              236   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001118706.1|  glycosyl hydrolase family 38 protein               236   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395530.1|  hypothetical protein EUTSA_v10003577mg             236   2e-68   Eutrema salsugineum [saltwater cress]
ref|XP_007046660.1|  Fatty acid hydroxylase superfamily isoform 2       236   2e-68   
gb|KDO71255.1|  hypothetical protein CISIN_1g001850mg                   236   2e-68   Citrus sinensis [apfelsine]
gb|KDO71256.1|  hypothetical protein CISIN_1g001850mg                   236   2e-68   Citrus sinensis [apfelsine]
ref|XP_007046659.1|  Glycosyl hydrolase family 38 protein isoform 1     236   2e-68   
ref|XP_002875335.1|  glycosyl hydrolase family 38 protein               236   3e-68   
gb|EMS46456.1|  Lysosomal alpha-mannosidase                             236   3e-68   Triticum urartu
gb|EYU31875.1|  hypothetical protein MIMGU_mgv1a000658mg                236   3e-68   Erythranthe guttata [common monkey flower]
ref|XP_004158902.1|  PREDICTED: lysosomal alpha-mannosidase-like        236   3e-68   
gb|AIX48011.1|  LMann protein                                           235   4e-68   synthetic construct
gb|KCW53179.1|  hypothetical protein EUGRSUZ_J024562                    234   4e-68   Eucalyptus grandis [rose gum]
ref|XP_010034700.1|  PREDICTED: lysosomal alpha-mannosidase-like        234   4e-68   
ref|XP_003573734.1|  PREDICTED: lysosomal alpha-mannosidase             235   4e-68   Brachypodium distachyon [annual false brome]
ref|XP_004135022.1|  PREDICTED: lysosomal alpha-mannosidase-like        235   5e-68   Cucumis sativus [cucumbers]
ref|XP_010113332.1|  Lysosomal alpha-mannosidase                        235   5e-68   Morus notabilis
gb|EMT01931.1|  Lysosomal alpha-mannosidase                             235   5e-68   
gb|AIX48013.1|  LMann protein                                           234   7e-68   synthetic construct
gb|AIX48006.1|  LMann protein                                           234   9e-68   synthetic construct
ref|XP_002530831.1|  lysosomal alpha-mannosidase, putative              233   1e-67   
ref|XP_009152026.1|  PREDICTED: lysosomal alpha-mannosidase             234   1e-67   Brassica rapa
gb|EYU30803.1|  hypothetical protein MIMGU_mgv1a000690mg                234   1e-67   Erythranthe guttata [common monkey flower]
ref|XP_009386958.1|  PREDICTED: lysosomal alpha-mannosidase             234   2e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001770740.1|  predicted protein                                  233   2e-67   
ref|XP_009759740.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    233   2e-67   Nicotiana sylvestris
ref|XP_009759741.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    233   2e-67   Nicotiana sylvestris
gb|KHN36022.1|  Lysosomal alpha-mannosidase                             233   2e-67   Glycine soja [wild soybean]
ref|XP_002975348.1|  hypothetical protein SELMODRAFT_103066             233   2e-67   
ref|XP_002964449.1|  hypothetical protein SELMODRAFT_266756             233   3e-67   
ref|XP_008788431.1|  PREDICTED: lysosomal alpha-mannosidase-like        233   3e-67   Phoenix dactylifera
dbj|BAJ94660.1|  predicted protein                                      233   3e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002865084.1|  glycosyl hydrolase family 38 protein               233   5e-67   
ref|XP_010478748.1|  PREDICTED: lysosomal alpha-mannosidase-like        232   6e-67   Camelina sativa [gold-of-pleasure]
ref|XP_011462239.1|  PREDICTED: alpha-mannosidase isoform X2            232   8e-67   Fragaria vesca subsp. vesca
ref|XP_011462234.1|  PREDICTED: alpha-mannosidase isoform X1            231   8e-67   Fragaria vesca subsp. vesca
ref|XP_010425390.1|  PREDICTED: lysosomal alpha-mannosidase-like        231   9e-67   Camelina sativa [gold-of-pleasure]
ref|NP_201416.1|  Glycosyl hydrolase family protein                     231   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011099865.1|  PREDICTED: alpha-mannosidase                       231   1e-66   Sesamum indicum [beniseed]
tpg|DAA46680.1|  TPA: hypothetical protein ZEAMMB73_299553              229   1e-66   
ref|NP_001064140.1|  Os10g0140200                                       231   1e-66   
gb|EEC66555.1|  hypothetical protein OsI_32713                          231   1e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_006573549.1|  PREDICTED: lysosomal alpha-mannosidase-like        231   2e-66   Glycine max [soybeans]
ref|XP_010246823.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    231   2e-66   Nelumbo nucifera [Indian lotus]
emb|CDX83641.1|  BnaC07g23810D                                          231   2e-66   
ref|XP_010246825.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    230   2e-66   Nelumbo nucifera [Indian lotus]
ref|XP_004289082.1|  PREDICTED: alpha-mannosidase-like isoform X2       230   2e-66   Fragaria vesca subsp. vesca
ref|XP_008659412.1|  PREDICTED: lysosomal alpha-mannosidase-like        230   3e-66   Zea mays [maize]
ref|XP_011462206.1|  PREDICTED: alpha-mannosidase-like isoform X1       230   3e-66   Fragaria vesca subsp. vesca
dbj|BAJ95309.1|  predicted protein                                      230   3e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002265360.1|  PREDICTED: alpha-mannosidase                       230   3e-66   Vitis vinifera
ref|XP_008658181.1|  PREDICTED: uncharacterized protein LOC100193...    229   3e-66   
ref|XP_006393801.1|  hypothetical protein EUTSA_v10003575mg             230   4e-66   
ref|XP_006290539.1|  hypothetical protein CARUB_v10016625mg             230   4e-66   Capsella rubella
ref|XP_008658145.1|  PREDICTED: uncharacterized protein LOC100193...    229   5e-66   Zea mays [maize]
gb|KDP43185.1|  hypothetical protein JCGZ_22737                         229   5e-66   Jatropha curcas
ref|XP_009379376.1|  PREDICTED: lysosomal alpha-mannosidase-like        229   5e-66   
gb|AIX48017.1|  LMann protein                                           229   6e-66   synthetic construct
emb|CDP16739.1|  unnamed protein product                                229   7e-66   Coffea canephora [robusta coffee]
ref|XP_002464752.1|  hypothetical protein SORBIDRAFT_01g026390          229   8e-66   Sorghum bicolor [broomcorn]
ref|XP_010502611.1|  PREDICTED: lysosomal alpha-mannosidase-like        229   8e-66   Camelina sativa [gold-of-pleasure]
ref|XP_006279760.1|  hypothetical protein CARUB_v10027738mg             228   2e-65   Capsella rubella
ref|XP_004983404.1|  PREDICTED: lysosomal alpha-mannosidase-like        228   2e-65   Setaria italica
gb|KCW53183.1|  hypothetical protein EUGRSUZ_J02459                     227   3e-65   Eucalyptus grandis [rose gum]
ref|XP_010033508.1|  PREDICTED: lysosomal alpha-mannosidase-like        227   3e-65   
gb|KCW53182.1|  hypothetical protein EUGRSUZ_J02459                     227   3e-65   Eucalyptus grandis [rose gum]
ref|XP_004509374.1|  PREDICTED: lysosomal alpha-mannosidase-like        227   5e-65   Cicer arietinum [garbanzo]
ref|XP_001765541.1|  predicted protein                                  226   1e-64   
gb|EPS72012.1|  hypothetical protein M569_02745                         226   1e-64   Genlisea aurea
gb|AAL73068.1|AC090873_14  Putative alpha-mannosidase                   222   1e-64   Oryza sativa [red rice]
ref|XP_010444832.1|  PREDICTED: lysosomal alpha-mannosidase-like        226   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010679911.1|  PREDICTED: alpha-mannosidase isoform X1            222   2e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679912.1|  PREDICTED: alpha-mannosidase isoform X2            222   2e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010514333.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    222   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_009368805.1|  PREDICTED: lysosomal alpha-mannosidase-like        221   2e-62   Pyrus x bretschneideri [bai li]
ref|XP_009112282.1|  PREDICTED: lysosomal alpha-mannosidase             219   3e-62   Brassica rapa
emb|CDY18591.1|  BnaA09g08040D                                          219   6e-62   Brassica napus [oilseed rape]
emb|CDX81409.1|  BnaC09g08200D                                          217   2e-61   
tpg|DAA46691.1|  TPA: hypothetical protein ZEAMMB73_463862              213   4e-61   
ref|XP_008659396.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    214   2e-60   
emb|CDY46339.1|  BnaC01g30310D                                          205   2e-60   
ref|XP_008659385.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    214   2e-60   
ref|XP_008659379.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    214   3e-60   
ref|XP_002980507.1|  hypothetical protein SELMODRAFT_178241             212   1e-59   
sp|C0HJB3.1|MANA_CANEN  RecName: Full=Alpha-mannosidase; Short=JB...    212   1e-59   
ref|XP_002984653.1|  hypothetical protein SELMODRAFT_120549             211   3e-59   
emb|CBI15496.3|  unnamed protein product                                211   3e-59   
gb|KJB76310.1|  hypothetical protein B456_012G082700                    207   6e-58   
ref|XP_002973911.1|  hypothetical protein SELMODRAFT_100184             199   4e-55   
dbj|BAA06405.1|  alpha-mannosidase                                      182   5e-55   
ref|XP_010099053.1|  Lysosomal alpha-mannosidase                        196   6e-54   
ref|XP_002969151.1|  hypothetical protein SELMODRAFT_410022             194   2e-53   
gb|EFA84943.1|  alpha-mannosidase                                       192   1e-52   
dbj|GAM29188.1|  hypothetical protein SAMD00019534_123640               192   1e-52   
ref|XP_010096029.1|  Lysosomal alpha-mannosidase                        182   1e-52   
ref|XP_011454669.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    189   3e-51   
gb|EKC30993.1|  Lysosomal alpha-mannosidase                             189   3e-51   
ref|XP_006809006.1|  PREDICTED: lysosomal alpha-mannosidase-like        187   6e-51   
ref|XP_004084261.1|  PREDICTED: lysosomal alpha-mannosidase             187   6e-51   
ref|XP_002613686.1|  hypothetical protein BRAFLDRAFT_287967             185   1e-50   
ref|XP_005458747.1|  PREDICTED: lysosomal alpha-mannosidase-like        187   1e-50   
ref|XP_002504941.1|  glycoside hydrolase                                187   1e-50   
ref|XP_009064562.1|  hypothetical protein LOTGIDRAFT_207233             186   1e-50   
ref|XP_003291027.1|  hypothetical protein DICPUDRAFT_49593              186   2e-50   
dbj|GAM19522.1|  hypothetical protein SAMD00019534_026970               186   3e-50   
ref|XP_629747.1|  hypothetical protein DDB_G0292206                     185   5e-50   
ref|XP_005826181.1|  hypothetical protein GUITHDRAFT_39786              184   8e-50   
ref|XP_822510.1|  lysosomal alpha-mannosidase precursor                 184   9e-50   
ref|XP_011454670.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    184   1e-49   
gb|KDO51270.1|  hypothetical protein CISIN_1g001813mg                   183   2e-49   
ref|XP_010737172.1|  PREDICTED: lysosomal alpha-mannosidase             183   3e-49   
gb|EMP37225.1|  Lysosomal alpha-mannosidase                             182   3e-49   
pdb|1O7D|A  Chain A, The Structure Of The Bovine Lysosomal A-Mann...    173   6e-49   
gb|KDO51269.1|  hypothetical protein CISIN_1g001813mg                   181   7e-49   
ref|XP_008287607.1|  PREDICTED: lysosomal alpha-mannosidase             181   9e-49   
ref|XP_008336033.1|  PREDICTED: lysosomal alpha-mannosidase-like        173   1e-48   
ref|XP_004672474.1|  PREDICTED: lysosomal alpha-mannosidase             175   1e-48   
ref|XP_007667532.1|  PREDICTED: lysosomal alpha-mannosidase             180   2e-48   
ref|XP_008434162.1|  PREDICTED: lysosomal alpha-mannosidase             181   2e-48   
ref|XP_006631611.1|  PREDICTED: lysosomal alpha-mannosidase-like        180   2e-48   
emb|CDQ91797.1|  unnamed protein product                                179   2e-48   
gb|EAW84281.1|  mannosidase, alpha, class 2B, member 1, isoform C...    173   2e-48   
ref|XP_007549783.1|  PREDICTED: lysosomal alpha-mannosidase             180   2e-48   
emb|CBH15235.1|  lysosomal alpha-mannosidase precursor, putative        180   2e-48   
ref|XP_005994396.1|  PREDICTED: lysosomal alpha-mannosidase-like        180   4e-48   
gb|AAC50811.1|  truncated lysosomal acid alpha-mannosidase              171   5e-48   
ref|XP_004635625.1|  PREDICTED: lysosomal alpha-mannosidase             179   5e-48   
ref|XP_003972325.1|  PREDICTED: lysosomal alpha-mannosidase-like        179   9e-48   
ref|XP_005815985.1|  PREDICTED: lysosomal alpha-mannosidase-like        178   1e-47   
gb|KFO19493.1|  Lysosomal alpha-mannosidase                             178   1e-47   
ref|XP_004339151.1|  lysosomal alphamannosidase                         178   2e-47   
ref|XP_010871016.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    178   2e-47   
ref|XP_010611649.1|  PREDICTED: lysosomal alpha-mannosidase             178   2e-47   
gb|EHH59246.1|  Lysosomal alpha-mannosidase                             177   2e-47   
ref|XP_007622497.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    177   2e-47   
ref|XP_005367061.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal al...    177   2e-47   
emb|CAN65410.1|  hypothetical protein VITISV_040416                     179   2e-47   
gb|ERE78954.1|  lysosomal alpha-mannosidase                             177   2e-47   
ref|XP_003501978.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    177   2e-47   
gb|ERE78953.1|  lysosomal alpha-mannosidase                             177   3e-47   
ref|XP_007058276.1|  PREDICTED: lysosomal alpha-mannosidase             177   3e-47   
ref|XP_007993591.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    177   3e-47   
ref|XP_010359961.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    177   3e-47   
ref|XP_007993590.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    177   3e-47   
ref|XP_010359960.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    177   3e-47   
ref|XP_011410222.1|  PREDICTED: lysosomal alpha-mannosidase-like        177   3e-47   
ref|XP_008314774.1|  PREDICTED: lysosomal alpha-mannosidase-like        176   4e-47   
ref|XP_006446934.1|  hypothetical protein CICLE_v10014123mg             177   4e-47   
ref|XP_011402718.1|  PREDICTED: lysosomal alpha-mannosidase-like        176   4e-47   
gb|AIX48007.1|  LMann protein                                           176   4e-47   
ref|XP_006730640.1|  PREDICTED: lysosomal alpha-mannosidase             166   5e-47   
ref|XP_009433166.1|  PREDICTED: lysosomal alpha-mannosidase             176   5e-47   
ref|XP_005588180.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    176   5e-47   
ref|XP_001629647.1|  predicted protein                                  176   5e-47   
ref|XP_005588179.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    176   5e-47   
ref|XP_005310699.1|  PREDICTED: lysosomal alpha-mannosidase             176   5e-47   
ref|XP_005588178.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    176   5e-47   
gb|AAA33224.1|  alpha-mannosidase                                       176   5e-47   
ref|XP_011454672.1|  PREDICTED: lysosomal alpha-mannosidase-like        176   6e-47   
ref|XP_002776156.1|  lysosomal alpha-mannosidase, putative              165   7e-47   
emb|CBJ29183.1|  Alpha-mannosidase, family GH38                         177   8e-47   
ref|XP_003915029.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    176   8e-47   
gb|EHH29677.1|  hypothetical protein EGK_10165                          176   8e-47   
ref|XP_009191865.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    176   9e-47   
gb|ESS67255.1|  lysosomal alpha-mannosidase precursor                   176   9e-47   
gb|AAC09470.1|  lysosomal alpha-mannosidase                             176   9e-47   
gb|EKG04555.1|  lysosomal alpha-mannosidase precursor, putative         176   9e-47   
sp|Q60HE9.1|MA2B1_MACFA  RecName: Full=Lysosomal alpha-mannosidas...    176   1e-46   
ref|XP_008853723.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    176   1e-46   
ref|XP_008853727.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    175   1e-46   
ref|XP_008853725.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    176   1e-46   
ref|XP_008853722.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    176   1e-46   
ref|NP_034894.2|  lysosomal alpha-mannosidase precursor                 176   1e-46   
gb|AAH05430.1|  Mannosidase 2, alpha B1                                 175   1e-46   
ref|XP_008853721.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    176   1e-46   
dbj|BAE42288.1|  unnamed protein product                                175   1e-46   
ref|XP_819105.1|  lysosomal alpha-mannosidase precursor                 175   1e-46   
ref|XP_002788759.1|  lysosomal alpha-mannosidase, putative              164   2e-46   
ref|XP_011402719.1|  PREDICTED: lysosomal alpha-mannosidase-like        172   2e-46   
ref|XP_007421015.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    175   2e-46   
ref|XP_009312011.1|  lysosomal alpha-mannosidase precursor              175   2e-46   
gb|AIX48010.1|  LMann protein                                           174   3e-46   
ref|XP_006161046.1|  PREDICTED: lysosomal alpha-mannosidase             174   3e-46   
ref|XP_008965904.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    174   3e-46   
ref|XP_006874364.1|  PREDICTED: lysosomal alpha-mannosidase             174   3e-46   
ref|XP_008965905.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    174   3e-46   
ref|XP_003798074.1|  PREDICTED: lysosomal alpha-mannosidase             174   4e-46   
ref|XP_007172000.1|  PREDICTED: lysosomal alpha-mannosidase             174   4e-46   
ref|NP_001127406.1|  lysosomal alpha-mannosidase precursor              174   4e-46   
ref|XP_010327778.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    174   4e-46   
sp|Q29451.4|MA2B1_BOVIN  RecName: Full=Lysosomal alpha-mannosidas...    174   5e-46   
gb|AAC51362.1|  lysosomal alpha-mannosidase                             174   5e-46   
gb|EKF32777.1|  lysosomal alpha-mannosidase precursor, putative         174   5e-46   
gb|AAB03816.1|  alpha-mannosidase                                       174   5e-46   
gb|AAC34130.1|  lysosomal alpha-mannosidase                             174   5e-46   
gb|AAC50812.1|  lysosomal acid alpha-mannosidase                        174   5e-46   
ref|XP_005900576.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    174   5e-46   
ref|NP_001166969.1|  lysosomal alpha-mannosidase isoform 2 precursor    174   5e-46   
gb|ELR52904.1|  Lysosomal alpha-mannosidase                             174   5e-46   
ref|NP_000519.2|  lysosomal alpha-mannosidase isoform 1 precursor       174   5e-46   
dbj|BAF84261.1|  unnamed protein product                                174   5e-46   
ref|XP_010853834.1|  PREDICTED: lysosomal alpha-mannosidase             174   5e-46   
ref|XP_005900575.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    174   5e-46   
dbj|BAI45345.1|  mannosidase, alpha, class 2B, member 1                 174   5e-46   
ref|XP_005259970.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    174   5e-46   
dbj|BAD93158.1|  mannosidase, alpha, class 2B, member 1 precursor...    174   6e-46   
ref|XP_002801133.1|  PREDICTED: lysosomal alpha-mannosidase-like        173   7e-46   
ref|XP_003941791.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    173   7e-46   
ref|XP_007532522.1|  PREDICTED: lysosomal alpha-mannosidase             173   7e-46   
ref|XP_010327777.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    173   7e-46   
ref|XP_010327776.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    173   8e-46   
emb|CAG12505.1|  unnamed protein product                                173   8e-46   
ref|XP_009858813.1|  PREDICTED: lysosomal alpha-mannosidase-like        173   8e-46   
gb|AIX48015.1|  LMann protein                                           173   9e-46   
ref|XP_004060128.1|  PREDICTED: lysosomal alpha-mannosidase             173   1e-45   
ref|XP_004364138.2|  lysosomal alpha-mannosidase                        173   1e-45   
ref|XP_005964354.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    172   1e-45   
gb|EFX74108.1|  hypothetical protein DAPPUDRAFT_252189                  172   1e-45   
ref|XP_005964355.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    172   1e-45   
ref|XP_008251421.1|  PREDICTED: lysosomal alpha-mannosidase             169   1e-45   
ref|XP_004009315.1|  PREDICTED: lysosomal alpha-mannosidase             173   1e-45   
ref|XP_005682349.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal al...    172   1e-45   
gb|AEZ02307.1|  alpha-mannosidase                                       172   1e-45   
ref|XP_812205.1|  lysosomal alpha-mannosidase precursor                 172   1e-45   
ref|NP_955436.1|  lysosomal alpha-mannosidase precursor                 172   2e-45   
ref|XP_006255337.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    172   2e-45   
ref|XP_011406170.1|  PREDICTED: lysosomal alpha-mannosidase-like        172   2e-45   
ref|XP_002761817.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    172   2e-45   
ref|XP_004872424.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    172   2e-45   
gb|EHB14492.1|  Lysosomal alpha-mannosidase                             172   2e-45   
ref|XP_004872425.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    172   2e-45   
ref|XP_004903043.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    172   2e-45   
ref|XP_008985606.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    172   2e-45   
ref|XP_004903042.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    172   2e-45   
ref|XP_004872422.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    172   2e-45   
ref|XP_557728.3|  AGAP008582-PA                                         160   3e-45   
gb|AIX48012.1|  LMann protein                                           171   3e-45   
ref|XP_003225254.1|  PREDICTED: lysosomal alpha-mannosidase             172   3e-45   
gb|EMS63584.1|  Lysosomal alpha-mannosidase                             172   3e-45   
ref|NP_001014354.1|  lysosomal alpha-mannosidase precursor              171   3e-45   
ref|XP_004688311.1|  PREDICTED: lysosomal alpha-mannosidase             171   3e-45   
gb|ESL11694.1|  lysosomal alpha-mannosidase precursor                   171   4e-45   
gb|AIX48009.1|  LMann protein                                           171   4e-45   
ref|XP_004872426.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    171   4e-45   
ref|XP_006041660.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    171   4e-45   
sp|Q8VHC8.1|MA2B1_CAVPO  RecName: Full=Lysosomal alpha-mannosidas...    171   4e-45   
ref|XP_006041659.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    171   4e-45   
gb|AAC48763.1|  lysosomal alpha-mannosidase                             171   5e-45   
ref|XP_011348312.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    171   5e-45   
gb|AAL58983.1|  lysosomal alpha-mannosidase                             171   5e-45   
ref|XP_006768284.1|  PREDICTED: lysosomal alpha-mannosidase             171   5e-45   
ref|XP_004872423.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    171   5e-45   
ref|XP_004872421.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    171   5e-45   
ref|XP_011348313.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    171   5e-45   
ref|XP_004872420.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    171   5e-45   
ref|NP_776986.2|  lysosomal alpha-mannosidase precursor                 171   5e-45   
ref|NP_001244175.1|  lysosomal alpha-mannosidase precursor              171   5e-45   
ref|XP_007421016.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    171   5e-45   
ref|XP_005002974.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    171   5e-45   
ref|XP_004872419.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    171   6e-45   
gb|AAC53369.1|  alpha-D-mannosidase                                     171   6e-45   
ref|XP_004872418.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    171   6e-45   
ref|XP_005002973.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    171   6e-45   
ref|XP_004824291.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    171   6e-45   
ref|XP_004824290.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    171   6e-45   
gb|AAC78560.1|  lysosomal alpha-mannosidase                             171   7e-45   
gb|EMT01827.1|  Lysosomal alpha-mannosidase                             171   7e-45   
ref|XP_004358367.1|  alpha-mannosidase                                  170   8e-45   
ref|XP_004318895.1|  PREDICTED: lysosomal alpha-mannosidase             170   8e-45   
ref|XP_004277528.1|  PREDICTED: lysosomal alpha-mannosidase             170   8e-45   
ref|XP_005169420.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    170   8e-45   
gb|AAX26642.2|  SJCHGC06744 protein                                     161   9e-45   
ref|XP_006023551.1|  PREDICTED: lysosomal alpha-mannosidase             170   1e-44   
ref|XP_008156206.1|  PREDICTED: lysosomal alpha-mannosidase             170   1e-44   
ref|XP_007469173.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    170   1e-44   
ref|XP_005336244.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    170   1e-44   
ref|XP_005336243.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    170   1e-44   
ref|XP_007469172.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    170   1e-44   
ref|XP_006262828.1|  PREDICTED: lysosomal alpha-mannosidase             169   1e-44   
gb|ELT89240.1|  hypothetical protein CAPTEDRAFT_151096                  170   1e-44   
ref|XP_005381070.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    169   1e-44   
ref|XP_005381071.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    169   1e-44   
gb|ELK26831.1|  Lysosomal alpha-mannosidase                             169   2e-44   
gb|EFX87724.1|  hypothetical protein DAPPUDRAFT_207420                  169   2e-44   
ref|XP_008251054.1|  PREDICTED: lysosomal alpha-mannosidase-like ...    169   2e-44   
ref|XP_006530810.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    169   2e-44   
gb|ELV14297.1|  Lysosomal alpha-mannosidase                             169   2e-44   
gb|EPQ17228.1|  Lysosomal alpha-mannosidase                             169   2e-44   
ref|XP_002723977.2|  PREDICTED: lysosomal alpha-mannosidase-like ...    169   2e-44   
pir||JC2200  alpha-mannosidase (EC 3.2.1.24) precursor - human          169   2e-44
ref|XP_003704456.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal al...    170   2e-44   
ref|XP_005881664.1|  PREDICTED: lysosomal alpha-mannosidase             169   2e-44   
ref|XP_007952626.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal al...    169   2e-44   
ref|XP_004475204.1|  PREDICTED: lysosomal alpha-mannosidase-like        166   3e-44   
ref|XP_004616845.1|  PREDICTED: lysosomal alpha-mannosidase             169   3e-44   
ref|XP_011380817.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    169   3e-44   
ref|XP_011380816.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    169   3e-44   
ref|XP_006918784.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    169   3e-44   
ref|XP_006918783.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    169   3e-44   
ref|XP_011409910.1|  PREDICTED: lysosomal alpha-mannosidase-like        168   3e-44   
ref|XP_007103641.1|  PREDICTED: lysosomal alpha-mannosidase isofo...    169   3e-44   



>ref|XP_009775244.1| PREDICTED: lysosomal alpha-mannosidase-like [Nicotiana sylvestris]
Length=1029

 Score =   308 bits (789),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  137  LQPMAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVD  316
            ++ MAK E WFL L +  G+   E+KY+VY+TS  IVPGKLNVHLVPHTHDDVGWLKTVD
Sbjct  1    MKNMAKFETWFLIL-MVCGLWVVEAKYMVYNTSQGIVPGKLNVHLVPHTHDDVGWLKTVD  59

Query  317  QYYVGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGL  496
            QYYVGSNNSIQGACV+NVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSP MQSTVR L
Sbjct  60   QYYVGSNNSIQGACVENVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPGMQSTVRQL  119

Query  497  VNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            VNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGH+YIK+QFNVTPRIG
Sbjct  120  VNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHKYIKEQFNVTPRIG  167



>ref|XP_009591416.1| PREDICTED: lysosomal alpha-mannosidase-like [Nicotiana tomentosiformis]
Length=1029

 Score =   308 bits (788),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  137  LQPMAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVD  316
            ++ MAK E WFL L +  G+   E+KY+VY+TS  IVPGKLNVHLVPHTHDDVGWLKTVD
Sbjct  1    MKNMAKFESWFLIL-MVCGLWAVEAKYMVYNTSQDIVPGKLNVHLVPHTHDDVGWLKTVD  59

Query  317  QYYVGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGL  496
            QYYVGSNNSIQGACV+NVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSP MQSTVR L
Sbjct  60   QYYVGSNNSIQGACVENVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPGMQSTVRQL  119

Query  497  VNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            VNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGH+YIK+QFNVTPRIG
Sbjct  120  VNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHKYIKEQFNVTPRIG  167



>ref|XP_006365417.1| PREDICTED: lysosomal alpha-mannosidase-like [Solanum tuberosum]
Length=1028

 Score =   302 bits (774),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  137  LQPMAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVD  316
            ++ M K E WFL L +  G+   E+KY+VY+TS  IV GKLNVHLVPHTHDDVGWLKTVD
Sbjct  1    MKDMGKFEIWFLIL-MVCGLWVVEAKYMVYNTSHGIVSGKLNVHLVPHTHDDVGWLKTVD  59

Query  317  QYYVGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGL  496
            QYYVGSNNSIQ ACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSP MQSTVR L
Sbjct  60   QYYVGSNNSIQVACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPGMQSTVRQL  119

Query  497  VNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            VNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGH+YIKQQFNVTPRIG
Sbjct  120  VNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHRYIKQQFNVTPRIG  167



>ref|NP_001234851.1| alpha-mannosidase precursor [Solanum lycopersicum]
 gb|ADK66339.1| alpha-mannosidase [Solanum lycopersicum]
Length=1028

 Score =   301 bits (771),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  137  LQPMAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVD  316
            ++ M K E WFL L +  G+   E+KY+VY+TS  IV GKLNVHLVPHTHDDVGWLKTVD
Sbjct  1    MKNMGKFEIWFLIL-MVCGLWVVEAKYMVYNTSQGIVSGKLNVHLVPHTHDDVGWLKTVD  59

Query  317  QYYVGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGL  496
            QYYVGSNNSIQ ACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSP MQSTV+ L
Sbjct  60   QYYVGSNNSIQVACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPGMQSTVKQL  119

Query  497  VNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            VNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGH+YIKQQFNVTPRIG
Sbjct  120  VNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHKYIKQQFNVTPRIG  167



>gb|ADU20406.1| alpha-mannosidase [Capsicum annuum]
Length=1030

 Score =   298 bits (763),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 152/168 (90%), Gaps = 2/168 (1%)
 Frame = +2

Query  137  LQPMAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVD  316
            ++ MAK E WFL L L    L  E+KY+VY+TS +IV GKLNVHLVPH+HDDVGWLKT+D
Sbjct  1    MKDMAKCEIWFLILMLCG--LVVEAKYMVYNTSQSIVKGKLNVHLVPHSHDDVGWLKTID  58

Query  317  QYYVGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGL  496
            QYYVGSNNSIQGACV+NVLDS++PALLADKNRKFIYVEQAFFQRWWRNQSP +QSTVR L
Sbjct  59   QYYVGSNNSIQGACVENVLDSMVPALLADKNRKFIYVEQAFFQRWWRNQSPEIQSTVRQL  118

Query  497  VNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            +NSGQLEFINGGWCMHDEAATHYIDMIDQTTLGH+YIKQQFN+ PRIG
Sbjct  119  INSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHRYIKQQFNIAPRIG  166



>gb|ABY83271.1| alpha-mannosidase [Solanum lycopersicum]
Length=1029

 Score =   297 bits (761),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  137  LQPMAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVD  316
            ++ M K E WFL L +  G+   E+KY+VY+TS  IV GKLNVHLVPHTHDDVGWLKTVD
Sbjct  1    MKNMGKFEIWFLIL-MVCGLWVVEAKYMVYNTSQGIVSGKLNVHLVPHTHDDVGWLKTVD  59

Query  317  QYYVGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGL  496
            QYYVGSNNSIQ ACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSP MQSTV+ L
Sbjct  60   QYYVGSNNSIQVACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPGMQSTVKQL  119

Query  497  VNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            VNSGQLE INGGWCMHDEAATHYIDMIDQTTLGH+YIKQQFNVTPRIG
Sbjct  120  VNSGQLESINGGWCMHDEAATHYIDMIDQTTLGHKYIKQQFNVTPRIG  167



>emb|CDP17307.1| unnamed protein product [Coffea canephora]
Length=1018

 Score =   294 bits (752),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +2

Query  167  FLSLTLAVG-VLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNS  343
             + L   VG  LC ESKY+VY+TSA IVP KLNVHLVPH+HDDVGWLKTVDQYYVGSNNS
Sbjct  5    LMLLIFVVGFALCVESKYMVYNTSAKIVPDKLNVHLVPHSHDDVGWLKTVDQYYVGSNNS  64

Query  344  IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFI  523
            IQGACVQNVLDSLIPALLAD+NRKFIYVEQAFFQRWWR+QSPAMQ  VR LV+ GQLEFI
Sbjct  65   IQGACVQNVLDSLIPALLADENRKFIYVEQAFFQRWWRDQSPAMQKIVRQLVDGGQLEFI  124

Query  524  NGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            NGGWCMHDEAATHYIDMIDQTTLGH+YIK+QFNVTPRIG
Sbjct  125  NGGWCMHDEAATHYIDMIDQTTLGHRYIKEQFNVTPRIG  163



>emb|CDO98309.1| unnamed protein product [Coffea canephora]
Length=1018

 Score =   291 bits (746),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +2

Query  167  FLSLTLAVG-VLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNS  343
             + L   VG  LC ESKY+VY+TSA IVP KLNVHLVPH+HDDVGWLKTVDQYYVGSNNS
Sbjct  5    LMLLIFVVGFALCVESKYMVYNTSAKIVPDKLNVHLVPHSHDDVGWLKTVDQYYVGSNNS  64

Query  344  IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFI  523
            IQGACVQNVLDSLIPALLAD+NRKFIYVEQAFFQRWWR+QSPA Q  VR LV++GQLEFI
Sbjct  65   IQGACVQNVLDSLIPALLADENRKFIYVEQAFFQRWWRDQSPATQKIVRQLVDAGQLEFI  124

Query  524  NGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            NGGWCMHDEAATHYIDMIDQTTLGH+YIK+QFNVTPRIG
Sbjct  125  NGGWCMHDEAATHYIDMIDQTTLGHRYIKEQFNVTPRIG  163



>ref|XP_008348155.1| PREDICTED: lysosomal alpha-mannosidase-like [Malus domestica]
Length=468

 Score =   276 bits (706),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  188  VGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQN  367
            VG L  +SK++ Y+TS  IVPGK+NVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQN
Sbjct  15   VGFLVXDSKFIAYNTSQGIVPGKINVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQN  74

Query  368  VLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHD  547
            VLDSL+PALLADKNRKFIYVEQAFFQRWWR+QS ++QS V+ LV SGQLEFINGG CMHD
Sbjct  75   VLDSLVPALLADKNRKFIYVEQAFFQRWWRDQSDSVQSIVKQLVTSGQLEFINGGMCMHD  134

Query  548  EAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            EAATHYIDMIDQTTLGHQ+IK++F+VTPRIG
Sbjct  135  EAATHYIDMIDQTTLGHQFIKREFDVTPRIG  165



>ref|XP_008350944.1| PREDICTED: lysosomal alpha-mannosidase-like [Malus domestica]
Length=278

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  194  VLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVL  373
            +L AESKYV Y+T++ +V GKLNVHLVPH+HDDVGWLKT+DQYYVGSNNSIQGACVQNVL
Sbjct  28   ILYAESKYVQYNTTSGLVAGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNSIQGACVQNVL  87

Query  374  DSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEA  553
            DSL+PALLADKNRKFIYVEQAFFQRWWR QS   Q+ V+ LVN GQLE INGG CMHDEA
Sbjct  88   DSLVPALLADKNRKFIYVEQAFFQRWWREQSEGTQNIVKQLVNDGQLELINGGMCMHDEA  147

Query  554  ATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            ATHYIDMIDQTTLGH++IKQ+FNVTPRIG
Sbjct  148  ATHYIDMIDQTTLGHRFIKQEFNVTPRIG  176



>gb|AIX48016.1| LMann protein, partial [synthetic construct]
Length=1003

 Score =   285 bits (729),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            Y+VY+TS  IV GKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQ ACVQNVLDSLIPAL
Sbjct  1    YMVYNTSQGIVSGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQVACVQNVLDSLIPAL  60

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
            LADKNRKFIYVEQAFFQRWWRNQSP MQSTV+ LVNSGQLEFINGGWCMHDEAATHYIDM
Sbjct  61   LADKNRKFIYVEQAFFQRWWRNQSPGMQSTVKQLVNSGQLEFINGGWCMHDEAATHYIDM  120

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH+YIKQQFNVTPRIG
Sbjct  121  IDQTTLGHKYIKQQFNVTPRIG  142



>ref|XP_009378044.1| PREDICTED: lysosomal alpha-mannosidase-like [Pyrus x bretschneideri]
Length=1027

 Score =   283 bits (723),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            MA        LTL VG L A+SK++ Y+TS  IVPGK+NVHLVPHTHDDVGWLKTVDQYY
Sbjct  1    MAATRSLLCLLTLVVGFLVADSKFIAYNTSQGIVPGKINVHLVPHTHDDVGWLKTVDQYY  60

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQGACVQNVLDSL+PALLADKNRKFIYVEQAFFQRWWR+QS A+QS V+ L+ S
Sbjct  61   VGSNNSIQGACVQNVLDSLVPALLADKNRKFIYVEQAFFQRWWRDQSDAVQSMVKQLIAS  120

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLEFINGG CMHDEAATHYIDMIDQTTLGH++I+++F+VTPRIG
Sbjct  121  GQLEFINGGMCMHDEAATHYIDMIDQTTLGHRFIQKEFDVTPRIG  165



>gb|EYU24520.1| hypothetical protein MIMGU_mgv1a0008521mg, partial [Erythranthe 
guttata]
Length=230

 Score =   263 bits (671),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = +2

Query  218  VVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPALL  397
            +VYDT+  +VPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQ ACVQNVLDSLIPALL
Sbjct  1    MVYDTAQGVVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQVACVQNVLDSLIPALL  60

Query  398  ADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDMI  577
            ADKNRKFIYVEQAFFQRWWR QS A + TV+ LV++GQLE INGG CMHDEAATHYIDMI
Sbjct  61   ADKNRKFIYVEQAFFQRWWRRQSEATKKTVQILVSTGQLELINGGMCMHDEAATHYIDMI  120

Query  578  DQTTLGHQYIKQQFNVTPRIG  640
            DQTTLGH+YIKQQFNVTPRIG
Sbjct  121  DQTTLGHRYIKQQFNVTPRIG  141



>gb|KHN31257.1| Lysosomal alpha-mannosidase [Glycine soja]
Length=1015

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 146/160 (91%), Gaps = 1/160 (1%)
 Frame = +2

Query  161  FWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNN  340
             WF+ L L   V+ +ESKY+ Y+T++ IVPGKLNVHLVPHTHDDVGWLKT+DQYYVGSNN
Sbjct  9    LWFILLLLGC-VISSESKYIRYNTTSTIVPGKLNVHLVPHTHDDVGWLKTIDQYYVGSNN  67

Query  341  SIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEF  520
            SIQGACVQNVLDSL+PALLADKNRKFIYVEQAFFQRWWR QS A+Q+ V+ LVN+GQLEF
Sbjct  68   SIQGACVQNVLDSLVPALLADKNRKFIYVEQAFFQRWWREQSDAIQNIVKELVNTGQLEF  127

Query  521  INGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            INGG+CMHDEAATHYIDMIDQTTLGHQ+IK++F VTPRIG
Sbjct  128  INGGFCMHDEAATHYIDMIDQTTLGHQFIKEEFGVTPRIG  167



>ref|XP_008379739.1| PREDICTED: lysosomal alpha-mannosidase-like [Malus domestica]
Length=755

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  188  VGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQN  367
            VG L  +SK++ Y+TS  IVPGK+NVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQN
Sbjct  15   VGFLVXDSKFIAYNTSQGIVPGKINVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQN  74

Query  368  VLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHD  547
            VLDSL+PALLADKNRKFIYVEQAFFQRWWR+QS ++QS V+ LV SGQLEFINGG CMHD
Sbjct  75   VLDSLVPALLADKNRKFIYVEQAFFQRWWRDQSDSVQSIVKQLVTSGQLEFINGGMCMHD  134

Query  548  EAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            EAATHYIDMIDQTTLGHQ+IK++F+VTPRIG
Sbjct  135  EAATHYIDMIDQTTLGHQFIKREFDVTPRIG  165



>ref|XP_003523176.1| PREDICTED: lysosomal alpha-mannosidase-like [Glycine max]
Length=1011

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 146/160 (91%), Gaps = 1/160 (1%)
 Frame = +2

Query  161  FWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNN  340
             WF+ L L   V+ +ESKY+ Y+T++ IVPGKLNVHLVPHTHDDVGWLKT+DQYYVGSNN
Sbjct  9    LWFILLLLGC-VISSESKYIRYNTTSTIVPGKLNVHLVPHTHDDVGWLKTIDQYYVGSNN  67

Query  341  SIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEF  520
            SIQGACVQNVLDSL+PALLADKNRKFIYVEQAFFQRWWR QS A+Q+ V+ LVN+GQLEF
Sbjct  68   SIQGACVQNVLDSLVPALLADKNRKFIYVEQAFFQRWWREQSDAVQNIVKELVNTGQLEF  127

Query  521  INGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            INGG+CMHDEAATHYIDMIDQTTLGHQ+IK++F VTPRIG
Sbjct  128  INGGFCMHDEAATHYIDMIDQTTLGHQFIKEEFGVTPRIG  167



>ref|XP_007032025.1| Glycosyl hydrolase family 38 protein [Theobroma cacao]
 gb|EOY02951.1| Glycosyl hydrolase family 38 protein [Theobroma cacao]
Length=1018

 Score =   281 bits (719),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  173  SLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQG  352
            ++ L +G+LCAESKY+VY+TSA IV GK+NVH+VPHTHDDVGWLKTVDQYYVGSNNSIQG
Sbjct  8    AVVLLLGILCAESKYMVYNTSAGIVAGKINVHVVPHTHDDVGWLKTVDQYYVGSNNSIQG  67

Query  353  ACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGG  532
            ACVQNVLDS++PALLADKNRKFIYVEQAFFQRWWR+QS  MQS V+ LV+SGQLEFINGG
Sbjct  68   ACVQNVLDSIVPALLADKNRKFIYVEQAFFQRWWRDQSELMQSIVKNLVSSGQLEFINGG  127

Query  533  WCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
             CMHDEA  HYIDMIDQTTLGH++IK++F VTPRIG
Sbjct  128  MCMHDEAVPHYIDMIDQTTLGHRFIKEEFGVTPRIG  163



>gb|AGR44468.1| alpha-mannosidase [Pyrus x bretschneideri]
Length=1024

 Score =   280 bits (716),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  188  VGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQN  367
            VG L A+SK++ YDTS  IVPGK+NVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQN
Sbjct  15   VGFLFADSKFIAYDTSQGIVPGKINVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQN  74

Query  368  VLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHD  547
            VLDSL+PALLADKNRKFIYVEQAFFQRWWR+QS ++QS V+ LV SGQLEFINGG CMHD
Sbjct  75   VLDSLVPALLADKNRKFIYVEQAFFQRWWRDQSDSVQSIVKQLVTSGQLEFINGGMCMHD  134

Query  548  EAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            EAATHYIDMIDQTTLGH++IK++F+VTPRIG
Sbjct  135  EAATHYIDMIDQTTLGHRFIKREFDVTPRIG  165



>ref|XP_007214917.1| hypothetical protein PRUPE_ppa000717mg [Prunus persica]
 gb|AGC10269.1| alpha-mannosidase [Prunus persica]
 gb|EMJ16116.1| hypothetical protein PRUPE_ppa000717mg [Prunus persica]
Length=1024

 Score =   280 bits (716),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  176  LTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGA  355
            L + VG L A+SK++VY+TS  IVPGK+NVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGA
Sbjct  11   LIILVGFLVADSKFMVYNTSQGIVPGKINVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGA  70

Query  356  CVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGW  535
            CVQNVLDSL+PALLADKNRKFIYVEQAFFQRWWR+QS A+QS V+ LV+SGQLEFINGG 
Sbjct  71   CVQNVLDSLVPALLADKNRKFIYVEQAFFQRWWRDQSEAVQSIVKQLVSSGQLEFINGGM  130

Query  536  CMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            CMHDEAATHYID+IDQTTLGH++IK++F+VTPRIG
Sbjct  131  CMHDEAATHYIDIIDQTTLGHRFIKKEFDVTPRIG  165



>ref|XP_008231241.1| PREDICTED: lysosomal alpha-mannosidase isoform X1 [Prunus mume]
 ref|XP_008231242.1| PREDICTED: lysosomal alpha-mannosidase isoform X1 [Prunus mume]
Length=1024

 Score =   280 bits (715),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  176  LTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGA  355
            L + VG L A+SK+++Y+TS  IVPGK+NVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGA
Sbjct  11   LIILVGFLVADSKFMIYNTSQGIVPGKINVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGA  70

Query  356  CVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGW  535
            CVQNVLDSL+PALLADKNRKFIYVEQAFFQRWWR+QS A+QS V+ LV+SGQLEFINGG 
Sbjct  71   CVQNVLDSLVPALLADKNRKFIYVEQAFFQRWWRDQSEAVQSIVKQLVSSGQLEFINGGM  130

Query  536  CMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            CMHDEAATHYID+IDQTTLGH++IK++F+VTPRIG
Sbjct  131  CMHDEAATHYIDIIDQTTLGHRFIKKEFDVTPRIG  165



>ref|XP_004297489.1| PREDICTED: alpha-mannosidase-like [Fragaria vesca subsp. vesca]
 ref|XP_011463213.1| PREDICTED: alpha-mannosidase-like [Fragaria vesca subsp. vesca]
 ref|XP_011463214.1| PREDICTED: alpha-mannosidase-like [Fragaria vesca subsp. vesca]
 ref|XP_011463215.1| PREDICTED: alpha-mannosidase-like [Fragaria vesca subsp. vesca]
 ref|XP_011463216.1| PREDICTED: alpha-mannosidase-like [Fragaria vesca subsp. vesca]
Length=1010

 Score =   279 bits (713),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            MA V ++ + L   V +  AE+KY+ Y+T++ +VPGKLNVHLVPHTHDDVGWLKTVDQYY
Sbjct  1    MAVVAYFPVVLVFTVFLYAAEAKYIQYNTTSVLVPGKLNVHLVPHTHDDVGWLKTVDQYY  60

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQGACVQNVLDSLIPALLADKNRKF+YVEQAFFQRWWR+QS  +Q TV+ LV+S
Sbjct  61   VGSNNSIQGACVQNVLDSLIPALLADKNRKFVYVEQAFFQRWWRDQSEEVQDTVKELVSS  120

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLE INGG CMHDEAA HYIDMIDQTTLGH++IKQ+FNVTPRIG
Sbjct  121  GQLELINGGMCMHDEAAPHYIDMIDQTTLGHRFIKQEFNVTPRIG  165



>ref|XP_006485097.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Citrus 
sinensis]
Length=990

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 143/159 (90%), Gaps = 6/159 (4%)
 Frame = +2

Query  164  WFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNS  343
            +FLSL      LC ESKY++Y+TSA IVPGK+NVHLVPH+HDDVGWLKTVDQYYVGSNNS
Sbjct  11   FFLSL------LCVESKYMMYNTSAGIVPGKINVHLVPHSHDDVGWLKTVDQYYVGSNNS  64

Query  344  IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFI  523
            IQ ACVQNVLDSLIPAL+ADKNRKFIYVEQAFFQRWWR+QS  +Q+ V+ LVNSGQLE I
Sbjct  65   IQVACVQNVLDSLIPALVADKNRKFIYVEQAFFQRWWRDQSEEVQNVVKQLVNSGQLELI  124

Query  524  NGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            NGG CMHDEAA HYIDMIDQTTLGH+YIK+QFNVTPRIG
Sbjct  125  NGGMCMHDEAAPHYIDMIDQTTLGHRYIKEQFNVTPRIG  163



>gb|KJB76312.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
Length=907

 Score =   277 bits (708),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            M  VE   + + L +GVLCAESKY+VY+TSA I  GK+NVHLVPHTHDDVGWLKTVDQYY
Sbjct  1    MGAVEL--IGVVLFLGVLCAESKYMVYNTSAGIDAGKINVHLVPHTHDDVGWLKTVDQYY  58

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQGACVQNVLDSL+PALLADKNRKFIYVEQAFFQRWW +QS   QS V+ LVNS
Sbjct  59   VGSNNSIQGACVQNVLDSLVPALLADKNRKFIYVEQAFFQRWWNDQSELTQSIVKKLVNS  118

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLEFINGG CMHDEA  HYIDMIDQTTLGH+++K++F VTPRIG
Sbjct  119  GQLEFINGGMCMHDEAVPHYIDMIDQTTLGHRFLKEEFGVTPRIG  163



>ref|XP_006485096.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Citrus 
sinensis]
Length=1010

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 143/159 (90%), Gaps = 6/159 (4%)
 Frame = +2

Query  164  WFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNS  343
            +FLSL      LC ESKY++Y+TSA IVPGK+NVHLVPH+HDDVGWLKTVDQYYVGSNNS
Sbjct  11   FFLSL------LCVESKYMMYNTSAGIVPGKINVHLVPHSHDDVGWLKTVDQYYVGSNNS  64

Query  344  IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFI  523
            IQ ACVQNVLDSLIPAL+ADKNRKFIYVEQAFFQRWWR+QS  +Q+ V+ LVNSGQLE I
Sbjct  65   IQVACVQNVLDSLIPALVADKNRKFIYVEQAFFQRWWRDQSEEVQNVVKQLVNSGQLELI  124

Query  524  NGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            NGG CMHDEAA HYIDMIDQTTLGH+YIK+QFNVTPRIG
Sbjct  125  NGGMCMHDEAAPHYIDMIDQTTLGHRYIKEQFNVTPRIG  163



>gb|KJB76306.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
Length=945

 Score =   277 bits (709),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            M  VE   + + L +GVLCAESKY+VY+TSA I  GK+NVHLVPHTHDDVGWLKTVDQYY
Sbjct  1    MGAVEL--IGVVLFLGVLCAESKYMVYNTSAGIDAGKINVHLVPHTHDDVGWLKTVDQYY  58

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQGACVQNVLDSL+PALLADKNRKFIYVEQAFFQRWW +QS   QS V+ LVNS
Sbjct  59   VGSNNSIQGACVQNVLDSLVPALLADKNRKFIYVEQAFFQRWWNDQSELTQSIVKKLVNS  118

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLEFINGG CMHDEA  HYIDMIDQTTLGH+++K++F VTPRIG
Sbjct  119  GQLEFINGGMCMHDEAVPHYIDMIDQTTLGHRFLKEEFGVTPRIG  163



>gb|KJB76311.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
Length=1027

 Score =   278 bits (711),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            M  VE   + + L +GVLCAESKY+VY+TSA I  GK+NVHLVPHTHDDVGWLKTVDQYY
Sbjct  1    MGAVEL--IGVVLFLGVLCAESKYMVYNTSAGIDAGKINVHLVPHTHDDVGWLKTVDQYY  58

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQGACVQNVLDSL+PALLADKNRKFIYVEQAFFQRWW +QS   QS V+ LVNS
Sbjct  59   VGSNNSIQGACVQNVLDSLVPALLADKNRKFIYVEQAFFQRWWNDQSELTQSIVKKLVNS  118

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLEFINGG CMHDEA  HYIDMIDQTTLGH+++K++F VTPRIG
Sbjct  119  GQLEFINGGMCMHDEAVPHYIDMIDQTTLGHRFLKEEFGVTPRIG  163



>gb|KJB76313.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
Length=1027

 Score =   278 bits (711),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            M  VE   + + L +GVLCAESKY+VY+TSA I  GK+NVHLVPHTHDDVGWLKTVDQYY
Sbjct  1    MGAVEL--IGVVLFLGVLCAESKYMVYNTSAGIDAGKINVHLVPHTHDDVGWLKTVDQYY  58

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQGACVQNVLDSL+PALLADKNRKFIYVEQAFFQRWW +QS   QS V+ LVNS
Sbjct  59   VGSNNSIQGACVQNVLDSLVPALLADKNRKFIYVEQAFFQRWWNDQSELTQSIVKKLVNS  118

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLEFINGG CMHDEA  HYIDMIDQTTLGH+++K++F VTPRIG
Sbjct  119  GQLEFINGGMCMHDEAVPHYIDMIDQTTLGHRFLKEEFGVTPRIG  163



>gb|KJB76308.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
Length=1024

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            M  VE   + + L +GVLCAESKY+VY+TSA I  GK+NVHLVPHTHDDVGWLKTVDQYY
Sbjct  1    MGAVEL--IGVVLFLGVLCAESKYMVYNTSAGIDAGKINVHLVPHTHDDVGWLKTVDQYY  58

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQGACVQNVLDSL+PALLADKNRKFIYVEQAFFQRWW +QS   QS V+ LVNS
Sbjct  59   VGSNNSIQGACVQNVLDSLVPALLADKNRKFIYVEQAFFQRWWNDQSELTQSIVKKLVNS  118

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLEFINGG CMHDEA  HYIDMIDQTTLGH+++K++F VTPRIG
Sbjct  119  GQLEFINGGMCMHDEAVPHYIDMIDQTTLGHRFLKEEFGVTPRIG  163



>gb|KJB76304.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
Length=1025

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            M  VE   + + L +GVLCAESKY+VY+TSA I  GK+NVHLVPHTHDDVGWLKTVDQYY
Sbjct  1    MGAVEL--IGVVLFLGVLCAESKYMVYNTSAGIDAGKINVHLVPHTHDDVGWLKTVDQYY  58

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQGACVQNVLDSL+PALLADKNRKFIYVEQAFFQRWW +QS   QS V+ LVNS
Sbjct  59   VGSNNSIQGACVQNVLDSLVPALLADKNRKFIYVEQAFFQRWWNDQSELTQSIVKKLVNS  118

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLEFINGG CMHDEA  HYIDMIDQTTLGH+++K++F VTPRIG
Sbjct  119  GQLEFINGGMCMHDEAVPHYIDMIDQTTLGHRFLKEEFGVTPRIG  163



>gb|KJB76307.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
Length=1024

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            M  VE   + + L +GVLCAESKY+VY+TSA I  GK+NVHLVPHTHDDVGWLKTVDQYY
Sbjct  1    MGAVEL--IGVVLFLGVLCAESKYMVYNTSAGIDAGKINVHLVPHTHDDVGWLKTVDQYY  58

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQGACVQNVLDSL+PALLADKNRKFIYVEQAFFQRWW +QS   QS V+ LVNS
Sbjct  59   VGSNNSIQGACVQNVLDSLVPALLADKNRKFIYVEQAFFQRWWNDQSELTQSIVKKLVNS  118

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLEFINGG CMHDEA  HYIDMIDQTTLGH+++K++F VTPRIG
Sbjct  119  GQLEFINGGMCMHDEAVPHYIDMIDQTTLGHRFLKEEFGVTPRIG  163



>gb|KJB76305.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
 gb|KJB76309.1| hypothetical protein B456_012G082700 [Gossypium raimondii]
Length=944

 Score =   277 bits (708),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            M  VE   + + L +GVLCAESKY+VY+TSA I  GK+NVHLVPHTHDDVGWLKTVDQYY
Sbjct  1    MGAVEL--IGVVLFLGVLCAESKYMVYNTSAGIDAGKINVHLVPHTHDDVGWLKTVDQYY  58

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQGACVQNVLDSL+PALLADKNRKFIYVEQAFFQRWW +QS   QS V+ LVNS
Sbjct  59   VGSNNSIQGACVQNVLDSLVPALLADKNRKFIYVEQAFFQRWWNDQSELTQSIVKKLVNS  118

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLEFINGG CMHDEA  HYIDMIDQTTLGH+++K++F VTPRIG
Sbjct  119  GQLEFINGGMCMHDEAVPHYIDMIDQTTLGHRFLKEEFGVTPRIG  163



>ref|XP_004501750.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Cicer 
arietinum]
Length=1012

 Score =   276 bits (707),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +2

Query  164  WFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNS  343
            W L L L   +  +ESKY+ Y+T++ IVPGKLNVHLVPHTHDDVGWLKT+DQYYVGSNNS
Sbjct  10   WIL-LFLVGFIHSSESKYIAYNTTSTIVPGKLNVHLVPHTHDDVGWLKTIDQYYVGSNNS  68

Query  344  IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFI  523
            IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWR QS  +Q TV+ LVNSGQLEFI
Sbjct  69   IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWREQSEVVQKTVKQLVNSGQLEFI  128

Query  524  NGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            NGG CMHDEAATHYIDMIDQTTLGH++IK++F VTPRIG
Sbjct  129  NGGMCMHDEAATHYIDMIDQTTLGHRFIKEEFGVTPRIG  167



>ref|XP_004501751.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Cicer 
arietinum]
Length=1004

 Score =   276 bits (707),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +2

Query  164  WFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNS  343
            W L L L   +  +ESKY+ Y+T++ IVPGKLNVHLVPHTHDDVGWLKT+DQYYVGSNNS
Sbjct  10   WIL-LFLVGFIHSSESKYIAYNTTSTIVPGKLNVHLVPHTHDDVGWLKTIDQYYVGSNNS  68

Query  344  IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFI  523
            IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWR QS  +Q TV+ LVNSGQLEFI
Sbjct  69   IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWREQSEVVQKTVKQLVNSGQLEFI  128

Query  524  NGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            NGG CMHDEAATHYIDMIDQTTLGH++IK++F VTPRIG
Sbjct  129  NGGMCMHDEAATHYIDMIDQTTLGHRFIKEEFGVTPRIG  167



>ref|XP_007137859.1| hypothetical protein PHAVU_009G161600g [Phaseolus vulgaris]
 gb|ESW09853.1| hypothetical protein PHAVU_009G161600g [Phaseolus vulgaris]
Length=730

 Score =   272 bits (696),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  194  VLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVL  373
            V+ +ESKY+ Y+T++ IVPGKLNVHLVPHTHDDVGWLKT+DQYYVGSNNSIQGACVQNVL
Sbjct  19   VIFSESKYIRYNTTSTIVPGKLNVHLVPHTHDDVGWLKTIDQYYVGSNNSIQGACVQNVL  78

Query  374  DSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEA  553
            DSL+PALLADKNRKFIYVEQAFFQRWWR QS  +Q+ V+ LV SGQLEFINGG+CMHDEA
Sbjct  79   DSLVPALLADKNRKFIYVEQAFFQRWWREQSDDIQNIVKELVKSGQLEFINGGFCMHDEA  138

Query  554  ATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            ATHYIDMIDQTTLGHQ++K++F VTPRIG
Sbjct  139  ATHYIDMIDQTTLGHQFLKEEFGVTPRIG  167



>ref|XP_007038135.1| Glycosyl hydrolase family 38 protein isoform 4 [Theobroma cacao]
 gb|EOY22636.1| Glycosyl hydrolase family 38 protein isoform 4 [Theobroma cacao]
Length=756

 Score =   273 bits (697),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  164  WFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNS  343
            W L   + V     ESKY+VY+T++ I PGKLNVHLV HTHDDVGWLKTVDQYYVGSNNS
Sbjct  6    WILIALMCVFWCEVESKYMVYNTTSKIAPGKLNVHLVAHTHDDVGWLKTVDQYYVGSNNS  65

Query  344  IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFI  523
            IQGACVQNVLDS++PALLADKNRKFIYVEQAFFQRWWR+QS A+Q TV+ L+NSGQLE I
Sbjct  66   IQGACVQNVLDSIVPALLADKNRKFIYVEQAFFQRWWRDQSEAVQETVKQLINSGQLELI  125

Query  524  NGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            NGG CMHDEAATHYIDMIDQTTLGH++IK +FNVTPRIG
Sbjct  126  NGGMCMHDEAATHYIDMIDQTTLGHRFIKSEFNVTPRIG  164



>ref|XP_011042968.1| PREDICTED: alpha-mannosidase-like [Populus euphratica]
Length=1008

 Score =   276 bits (706),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  176  LTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGA  355
            L + V +LC ESKY+ YDTS+ IVPGK+NVHLV HTHDDVGWLKTVDQYYVGSNNSIQGA
Sbjct  9    LFVLVSLLCVESKYIKYDTSSGIVPGKINVHLVAHTHDDVGWLKTVDQYYVGSNNSIQGA  68

Query  356  CVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGW  535
            CVQNVLDS++PALLADKNRKFIYVEQAFFQRWWR+QS  +Q+ V+ LV SGQLE INGG 
Sbjct  69   CVQNVLDSIVPALLADKNRKFIYVEQAFFQRWWRDQSEEVQNVVKQLVISGQLELINGGM  128

Query  536  CMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            CMHDEAA HYIDMIDQTTLGHQ+IK++FNVTPRIG
Sbjct  129  CMHDEAAPHYIDMIDQTTLGHQFIKEEFNVTPRIG  163



>ref|XP_010249227.1| PREDICTED: lysosomal alpha-mannosidase-like [Nelumbo nucifera]
 ref|XP_010249228.1| PREDICTED: lysosomal alpha-mannosidase-like [Nelumbo nucifera]
Length=1018

 Score =   276 bits (706),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  176  LTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGA  355
            L++  G LCA+S+Y+ Y+TS  IVPGK+NVHLVPHTHDDVGWLKTVDQYYVGSNNSIQ A
Sbjct  9    LSVFAGFLCADSEYIAYNTSQRIVPGKINVHLVPHTHDDVGWLKTVDQYYVGSNNSIQVA  68

Query  356  CVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGW  535
            CVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWR+QS A+QS V+ L++SGQLE INGG 
Sbjct  69   CVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRDQSEAVQSIVKQLISSGQLELINGGM  128

Query  536  CMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            CMHDEA THYIDMIDQTTLGH++IKQ+F VTPRIG
Sbjct  129  CMHDEATTHYIDMIDQTTLGHRFIKQEFGVTPRIG  163



>ref|XP_007038136.1| Glycosyl hydrolase family 38 protein isoform 5 [Theobroma cacao]
 gb|EOY22637.1| Glycosyl hydrolase family 38 protein isoform 5 [Theobroma cacao]
Length=765

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  164  WFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNS  343
            W L   + V     ESKY+VY+T++ I PGKLNVHLV HTHDDVGWLKTVDQYYVGSNNS
Sbjct  6    WILIALMCVFWCEVESKYMVYNTTSKIAPGKLNVHLVAHTHDDVGWLKTVDQYYVGSNNS  65

Query  344  IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFI  523
            IQGACVQNVLDS++PALLADKNRKFIYVEQAFFQRWWR+QS A+Q TV+ L+NSGQLE I
Sbjct  66   IQGACVQNVLDSIVPALLADKNRKFIYVEQAFFQRWWRDQSEAVQETVKQLINSGQLELI  125

Query  524  NGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            NGG CMHDEAATHYIDMIDQTTLGH++IK +FNVTPRIG
Sbjct  126  NGGMCMHDEAATHYIDMIDQTTLGHRFIKSEFNVTPRIG  164



>ref|XP_002318770.1| hypothetical protein POPTR_0012s10830g [Populus trichocarpa]
 gb|EEE96990.1| hypothetical protein POPTR_0012s10830g [Populus trichocarpa]
Length=1012

 Score =   276 bits (705),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  176  LTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGA  355
            L + V +LC ESKY+ YDTS+ IVPGK+NVHLV HTHDDVGWLKTVDQYYVGSNNSIQGA
Sbjct  9    LFVLVSLLCVESKYIKYDTSSVIVPGKINVHLVAHTHDDVGWLKTVDQYYVGSNNSIQGA  68

Query  356  CVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGW  535
            CVQNVLDS++PALLADKNRKFIYVEQAFFQRWWR+QS  +Q+ V+ LV SGQLE INGG 
Sbjct  69   CVQNVLDSIVPALLADKNRKFIYVEQAFFQRWWRDQSEEVQNVVKQLVISGQLELINGGM  128

Query  536  CMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            CMHDEAA HYIDMIDQTTLGHQ+IK++FNVTPRIG
Sbjct  129  CMHDEAAPHYIDMIDQTTLGHQFIKEEFNVTPRIG  163



>ref|XP_002511094.1| lysosomal alpha-mannosidase, putative [Ricinus communis]
 gb|EEF51696.1| lysosomal alpha-mannosidase, putative [Ricinus communis]
Length=1012

 Score =   274 bits (700),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = +2

Query  155  VEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGS  334
            ++  FL +  ++  L  ESKY+VY+T+A+IVPGK+NVHLVPHTHDDVGWLKT+DQYYVGS
Sbjct  3    IQACFLIVLSSIFCLSVESKYMVYNTTASIVPGKINVHLVPHTHDDVGWLKTMDQYYVGS  62

Query  335  NNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQL  514
            NNSIQGACVQN+LDSL+PALLADKNRKFIYVEQAFFQRWW  QS  +Q  V+ LV+SGQL
Sbjct  63   NNSIQGACVQNILDSLVPALLADKNRKFIYVEQAFFQRWWNEQSEEVQKIVKKLVSSGQL  122

Query  515  EFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            E INGG CMHDEAATHYIDMIDQTTLGH++IKQ+FN+TPRIG
Sbjct  123  ELINGGMCMHDEAATHYIDMIDQTTLGHKFIKQEFNLTPRIG  164



>ref|XP_007038134.1| Glycosyl hydrolase family 38 protein isoform 3 [Theobroma cacao]
 gb|EOY22635.1| Glycosyl hydrolase family 38 protein isoform 3 [Theobroma cacao]
Length=988

 Score =   273 bits (698),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  164  WFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNS  343
            W L   + V     ESKY+VY+T++ I PGKLNVHLV HTHDDVGWLKTVDQYYVGSNNS
Sbjct  6    WILIALMCVFWCEVESKYMVYNTTSKIAPGKLNVHLVAHTHDDVGWLKTVDQYYVGSNNS  65

Query  344  IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFI  523
            IQGACVQNVLDS++PALLADKNRKFIYVEQAFFQRWWR+QS A+Q TV+ L+NSGQLE I
Sbjct  66   IQGACVQNVLDSIVPALLADKNRKFIYVEQAFFQRWWRDQSEAVQETVKQLINSGQLELI  125

Query  524  NGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            NGG CMHDEAATHYIDMIDQTTLGH++IK +FNVTPRIG
Sbjct  126  NGGMCMHDEAATHYIDMIDQTTLGHRFIKSEFNVTPRIG  164



>ref|XP_007038133.1| Glycosyl hydrolase family 38 protein isoform 2 [Theobroma cacao]
 gb|EOY22634.1| Glycosyl hydrolase family 38 protein isoform 2 [Theobroma cacao]
Length=994

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  164  WFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNS  343
            W L   + V     ESKY+VY+T++ I PGKLNVHLV HTHDDVGWLKTVDQYYVGSNNS
Sbjct  6    WILIALMCVFWCEVESKYMVYNTTSKIAPGKLNVHLVAHTHDDVGWLKTVDQYYVGSNNS  65

Query  344  IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFI  523
            IQGACVQNVLDS++PALLADKNRKFIYVEQAFFQRWWR+QS A+Q TV+ L+NSGQLE I
Sbjct  66   IQGACVQNVLDSIVPALLADKNRKFIYVEQAFFQRWWRDQSEAVQETVKQLINSGQLELI  125

Query  524  NGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            NGG CMHDEAATHYIDMIDQTTLGH++IK +FNVTPRIG
Sbjct  126  NGGMCMHDEAATHYIDMIDQTTLGHRFIKSEFNVTPRIG  164



>ref|XP_007038132.1| Glycosyl hydrolase family 38 protein isoform 1 [Theobroma cacao]
 gb|EOY22633.1| Glycosyl hydrolase family 38 protein isoform 1 [Theobroma cacao]
Length=1010

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  164  WFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNS  343
            W L   + V     ESKY+VY+T++ I PGKLNVHLV HTHDDVGWLKTVDQYYVGSNNS
Sbjct  6    WILIALMCVFWCEVESKYMVYNTTSKIAPGKLNVHLVAHTHDDVGWLKTVDQYYVGSNNS  65

Query  344  IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFI  523
            IQGACVQNVLDS++PALLADKNRKFIYVEQAFFQRWWR+QS A+Q TV+ L+NSGQLE I
Sbjct  66   IQGACVQNVLDSIVPALLADKNRKFIYVEQAFFQRWWRDQSEAVQETVKQLINSGQLELI  125

Query  524  NGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            NGG CMHDEAATHYIDMIDQTTLGH++IK +FNVTPRIG
Sbjct  126  NGGMCMHDEAATHYIDMIDQTTLGHRFIKSEFNVTPRIG  164



>gb|KDP22539.1| hypothetical protein JCGZ_26370 [Jatropha curcas]
Length=1011

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  176  LTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGA  355
            L +    L  ESKY+ Y+T++ IVPGK+NVHLVPHTHDDVGWLKT+DQYYVGSNNSIQGA
Sbjct  8    LMILSSFLYVESKYISYNTTSGIVPGKINVHLVPHTHDDVGWLKTIDQYYVGSNNSIQGA  67

Query  356  CVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGW  535
            CVQNVLDSL+PALLADKNRKFIYVEQAFFQRWWR QS  +Q+ V+ LV SGQLE INGG+
Sbjct  68   CVQNVLDSLVPALLADKNRKFIYVEQAFFQRWWREQSEDVQTIVKKLVGSGQLELINGGY  127

Query  536  CMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            CMHDEA THYIDMIDQTTLGH++IKQ+FNVTPRIG
Sbjct  128  CMHDEATTHYIDMIDQTTLGHRFIKQEFNVTPRIG  162



>gb|KJB19726.1| hypothetical protein B456_003G116600 [Gossypium raimondii]
Length=1008

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  164  WFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNS  343
            W L L   + + C E KY++Y+T++ IV GKLNVHLV HTHDDVGWLKTVDQYYVGSNNS
Sbjct  7    WILILVTLMSIWCVEPKYIIYNTTSKIVSGKLNVHLVAHTHDDVGWLKTVDQYYVGSNNS  66

Query  344  IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFI  523
            IQGACVQNVLDS++PALLADKNRKFIYVEQAFFQRWWR+QS  +Q TV+ L+NSGQLE I
Sbjct  67   IQGACVQNVLDSIVPALLADKNRKFIYVEQAFFQRWWRDQSETVQETVKRLLNSGQLELI  126

Query  524  NGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            NGG CMHDEAA HYIDMIDQTTLGH++IK++FN+TPRIG
Sbjct  127  NGGMCMHDEAAPHYIDMIDQTTLGHRFIKREFNITPRIG  165



>ref|XP_007210406.1| hypothetical protein PRUPE_ppa000755mg [Prunus persica]
 gb|EMJ11605.1| hypothetical protein PRUPE_ppa000755mg [Prunus persica]
Length=1014

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  203  AESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  382
            AE KYV Y+T++ +VPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL
Sbjct  19   AEPKYVQYNTTSRLVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  78

Query  383  IPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATH  562
            +PALLADKNRKFIYVEQAFFQRWWR QS   Q+TVR LVN+GQLE INGG CMHDEAA H
Sbjct  79   VPALLADKNRKFIYVEQAFFQRWWREQSEGTQNTVRRLVNNGQLELINGGMCMHDEAAPH  138

Query  563  YIDMIDQTTLGHQYIKQQFNVTPRIG  640
            YIDMIDQTTLGHQ+IK++FN+TPRIG
Sbjct  139  YIDMIDQTTLGHQFIKEEFNMTPRIG  164



>ref|XP_011083026.1| PREDICTED: alpha-mannosidase-like [Sesamum indicum]
Length=1014

 Score =   272 bits (696),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +2

Query  206  ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI  385
            E KY+VY+TS  IVPGK+NVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI
Sbjct  21   ECKYMVYNTSQGIVPGKINVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI  80

Query  386  PALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHY  565
            PALLADKNRKF+YVEQAFFQRWWR QS A++   + LV SGQLE INGGWCMHDEAATHY
Sbjct  81   PALLADKNRKFVYVEQAFFQRWWRQQSEAVKKIAQMLVTSGQLELINGGWCMHDEAATHY  140

Query  566  IDMIDQTTLGHQYIKQQFNVTPRIG  640
            IDMIDQTTLGH++IK+QFNVTPRIG
Sbjct  141  IDMIDQTTLGHKFIKEQFNVTPRIG  165



>ref|XP_010550227.1| PREDICTED: lysosomal alpha-mannosidase [Tarenaya hassleriana]
Length=1016

 Score =   272 bits (695),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  188  VGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQN  367
            +G+LCAES+Y++Y+TS  IVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQ ACVQN
Sbjct  14   LGILCAESRYMIYNTSQTIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQIACVQN  73

Query  368  VLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHD  547
            VLDS++PALLADKNR+FIYVEQAFFQRWWR QS A +  V+ LV+SGQLE INGG CMHD
Sbjct  74   VLDSIVPALLADKNRRFIYVEQAFFQRWWREQSEATKHVVKELVHSGQLELINGGMCMHD  133

Query  548  EAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            EAA HYIDMIDQTTLGH++I ++FNVTPRIG
Sbjct  134  EAAPHYIDMIDQTTLGHRFISREFNVTPRIG  164



>gb|KDO51267.1| hypothetical protein CISIN_1g001813mg [Citrus sinensis]
Length=990

 Score =   271 bits (694),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +2

Query  206  ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI  385
            ESKY++Y+TSA IVPGK+NVHLVPH+HDDVGWLKTVDQYYVGSNNSIQ ACVQNVLDSLI
Sbjct  19   ESKYMMYNTSAGIVPGKINVHLVPHSHDDVGWLKTVDQYYVGSNNSIQVACVQNVLDSLI  78

Query  386  PALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHY  565
            PAL+ADKNRKFIYVEQAFFQRWWR+QS  +Q+ V+ LVNSGQLE INGG CMHDEAA HY
Sbjct  79   PALVADKNRKFIYVEQAFFQRWWRDQSEEVQNVVKQLVNSGQLELINGGMCMHDEAAPHY  138

Query  566  IDMIDQTTLGHQYIKQQFNVTPRIG  640
            IDMIDQTTLGH+YIK+QFNVTPRIG
Sbjct  139  IDMIDQTTLGHRYIKEQFNVTPRIG  163



>ref|XP_008239559.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Prunus 
mume]
Length=1017

 Score =   272 bits (695),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  203  AESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  382
            AE KYV Y+T++ +VPGKLNVHLVPHTHDDVGWLKT+DQYYVGSNNSIQGACVQNVLDSL
Sbjct  19   AEPKYVQYNTTSRLVPGKLNVHLVPHTHDDVGWLKTIDQYYVGSNNSIQGACVQNVLDSL  78

Query  383  IPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATH  562
            +PALLADKNRKFIYVEQAFFQRWWR QS   Q+TVR LVN+GQLE INGG CMHDEAA H
Sbjct  79   VPALLADKNRKFIYVEQAFFQRWWREQSEGTQNTVRRLVNNGQLELINGGMCMHDEAAPH  138

Query  563  YIDMIDQTTLGHQYIKQQFNVTPRIG  640
            YIDMIDQTTLGH++IK++FNVTPRIG
Sbjct  139  YIDMIDQTTLGHRFIKEEFNVTPRIG  164



>ref|XP_008239561.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Prunus 
mume]
Length=1014

 Score =   271 bits (694),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  203  AESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  382
            AE KYV Y+T++ +VPGKLNVHLVPHTHDDVGWLKT+DQYYVGSNNSIQGACVQNVLDSL
Sbjct  19   AEPKYVQYNTTSRLVPGKLNVHLVPHTHDDVGWLKTIDQYYVGSNNSIQGACVQNVLDSL  78

Query  383  IPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATH  562
            +PALLADKNRKFIYVEQAFFQRWWR QS   Q+TVR LVN+GQLE INGG CMHDEAA H
Sbjct  79   VPALLADKNRKFIYVEQAFFQRWWREQSEGTQNTVRRLVNNGQLELINGGMCMHDEAAPH  138

Query  563  YIDMIDQTTLGHQYIKQQFNVTPRIG  640
            YIDMIDQTTLGH++IK++FNVTPRIG
Sbjct  139  YIDMIDQTTLGHRFIKEEFNVTPRIG  164



>ref|XP_003526925.1| PREDICTED: lysosomal alpha-mannosidase-like [Glycine max]
Length=1012

 Score =   271 bits (693),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 142/158 (90%), Gaps = 1/158 (1%)
 Frame = +2

Query  167  FLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSI  346
            F+ L L   V+ +E KY+ Y+T++ IVPGKLNVHLVPHTHDDVGWLKT+DQYYVGSNNSI
Sbjct  11   FILLLLGC-VISSECKYIRYNTTSTIVPGKLNVHLVPHTHDDVGWLKTIDQYYVGSNNSI  69

Query  347  QGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFIN  526
            QGACVQNVLDSL+ ALLADKNRKFIYVEQAFFQRWWR QS  +Q+ V+ LVNSGQLEFIN
Sbjct  70   QGACVQNVLDSLVTALLADKNRKFIYVEQAFFQRWWREQSDDIQNIVKELVNSGQLEFIN  129

Query  527  GGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GG+CMHDEAATHYIDMIDQTTLGHQ+IK++F VTPRIG
Sbjct  130  GGFCMHDEAATHYIDMIDQTTLGHQFIKEEFGVTPRIG  167



>gb|KDO51266.1| hypothetical protein CISIN_1g001813mg [Citrus sinensis]
Length=1010

 Score =   271 bits (693),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +2

Query  206  ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI  385
            ESKY++Y+TSA IVPGK+NVHLVPH+HDDVGWLKTVDQYYVGSNNSIQ ACVQNVLDSLI
Sbjct  19   ESKYMMYNTSAGIVPGKINVHLVPHSHDDVGWLKTVDQYYVGSNNSIQVACVQNVLDSLI  78

Query  386  PALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHY  565
            PAL+ADKNRKFIYVEQAFFQRWWR+QS  +Q+ V+ LVNSGQLE INGG CMHDEAA HY
Sbjct  79   PALVADKNRKFIYVEQAFFQRWWRDQSEEVQNVVKQLVNSGQLELINGGMCMHDEAAPHY  138

Query  566  IDMIDQTTLGHQYIKQQFNVTPRIG  640
            IDMIDQTTLGH+YIK+QFNVTPRIG
Sbjct  139  IDMIDQTTLGHRYIKEQFNVTPRIG  163



>gb|KDP41855.1| hypothetical protein JCGZ_26873 [Jatropha curcas]
Length=1026

 Score =   271 bits (693),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +2

Query  206  ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI  385
            ESKY+VY+TS  IVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI
Sbjct  21   ESKYMVYNTSQGIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI  80

Query  386  PALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHY  565
            P+LLADKNRKFIYVE AFFQRWWR+QS AMQ  V+ LV+SGQLEFINGG CMHDEA THY
Sbjct  81   PSLLADKNRKFIYVETAFFQRWWRDQSEAMQHVVKQLVSSGQLEFINGGMCMHDEAVTHY  140

Query  566  IDMIDQTTLGHQYIKQQFNVTPRIG  640
            IDMIDQTTLGH++IK++F++TPRIG
Sbjct  141  IDMIDQTTLGHRFIKKEFDMTPRIG  165



>gb|KHN09713.1| Lysosomal alpha-mannosidase [Glycine soja]
Length=1016

 Score =   271 bits (693),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 142/158 (90%), Gaps = 1/158 (1%)
 Frame = +2

Query  167  FLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSI  346
            F+ L L   V+ +E KY+ Y+T++ IVPGKLNVHLVPHTHDDVGWLKT+DQYYVGSNNSI
Sbjct  11   FILLLLGC-VISSECKYIRYNTTSTIVPGKLNVHLVPHTHDDVGWLKTIDQYYVGSNNSI  69

Query  347  QGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFIN  526
            QGACVQNVLDSL+ ALLADKNRKFIYVEQAFFQRWWR QS  +Q+ V+ LVNSGQLEFIN
Sbjct  70   QGACVQNVLDSLVTALLADKNRKFIYVEQAFFQRWWREQSDDIQNIVKELVNSGQLEFIN  129

Query  527  GGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GG+CMHDEAATHYIDMIDQTTLGHQ+IK++F VTPRIG
Sbjct  130  GGFCMHDEAATHYIDMIDQTTLGHQFIKEEFGVTPRIG  167



>gb|KDO51268.1| hypothetical protein CISIN_1g001813mg [Citrus sinensis]
Length=929

 Score =   270 bits (691),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +2

Query  206  ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI  385
            ESKY++Y+TSA IVPGK+NVHLVPH+HDDVGWLKTVDQYYVGSNNSIQ ACVQNVLDSLI
Sbjct  19   ESKYMMYNTSAGIVPGKINVHLVPHSHDDVGWLKTVDQYYVGSNNSIQVACVQNVLDSLI  78

Query  386  PALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHY  565
            PAL+ADKNRKFIYVEQAFFQRWWR+QS  +Q+ V+ LVNSGQLE INGG CMHDEAA HY
Sbjct  79   PALVADKNRKFIYVEQAFFQRWWRDQSEEVQNVVKQLVNSGQLELINGGMCMHDEAAPHY  138

Query  566  IDMIDQTTLGHQYIKQQFNVTPRIG  640
            IDMIDQTTLGH+YIK+QFNVTPRIG
Sbjct  139  IDMIDQTTLGHRYIKEQFNVTPRIG  163



>ref|XP_009339045.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Pyrus 
x bretschneideri]
Length=993

 Score =   271 bits (692),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  194  VLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVL  373
            +L AESKY+ Y+T++ +V GKLNVHLVPH+HDDVGWLKT+DQYYVGSNNSIQGACVQNVL
Sbjct  27   ILSAESKYMQYNTTSGLVAGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNSIQGACVQNVL  86

Query  374  DSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEA  553
            DSL+PALLADKNRKFIYVEQAFFQRWWR QS   Q+ V+ LVN GQLE INGG CMHDEA
Sbjct  87   DSLVPALLADKNRKFIYVEQAFFQRWWREQSEGTQNIVKQLVNDGQLELINGGMCMHDEA  146

Query  554  ATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            ATHYIDMIDQTTLGH++IKQ+FNVTPRIG
Sbjct  147  ATHYIDMIDQTTLGHRFIKQEFNVTPRIG  175



>ref|XP_009339044.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Pyrus 
x bretschneideri]
Length=1022

 Score =   271 bits (692),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  194  VLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVL  373
            +L AESKY+ Y+T++ +V GKLNVHLVPH+HDDVGWLKT+DQYYVGSNNSIQGACVQNVL
Sbjct  27   ILSAESKYMQYNTTSGLVAGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNSIQGACVQNVL  86

Query  374  DSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEA  553
            DSL+PALLADKNRKFIYVEQAFFQRWWR QS   Q+ V+ LVN GQLE INGG CMHDEA
Sbjct  87   DSLVPALLADKNRKFIYVEQAFFQRWWREQSEGTQNIVKQLVNDGQLELINGGMCMHDEA  146

Query  554  ATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            ATHYIDMIDQTTLGH++IKQ+FNVTPRIG
Sbjct  147  ATHYIDMIDQTTLGHRFIKQEFNVTPRIG  175



>gb|KDO43591.1| hypothetical protein CISIN_1g0150281mg, partial [Citrus sinensis]
Length=184

 Score =   249 bits (636),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = +2

Query  179  TLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGAC  358
            T+  GV+  +S+Y+ Y+T+A IVP K+NVHLVPH+HDDVGWLKTVDQYYVG+NNSI+GAC
Sbjct  12   TILAGVINGKSEYIAYNTTAGIVPDKINVHLVPHSHDDVGWLKTVDQYYVGANNSIRGAC  71

Query  359  VQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWC  538
            VQNVLDS+I AL  DKNRKFIYVE AFFQRWWR QS AM+  V+GLV+SGQLEFINGG C
Sbjct  72   VQNVLDSVISALFEDKNRKFIYVEMAFFQRWWRQQSKAMKVKVKGLVDSGQLEFINGGMC  131

Query  539  MHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            MHDEA+ HYIDMIDQTTLGH +IK  F   PR+G
Sbjct  132  MHDEASPHYIDMIDQTTLGHWFIKDSFGKLPRVG  165



>ref|XP_010249229.1| PREDICTED: lysosomal alpha-mannosidase-like [Nelumbo nucifera]
Length=1017

 Score =   269 bits (687),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  176  LTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGA  355
            L L     CAESKY+ Y+TS  +VPGKLNVHLVPH+HDDVGWLKTVDQYYVG+NNSI+GA
Sbjct  9    LVLLASFFCAESKYIAYNTSQRVVPGKLNVHLVPHSHDDVGWLKTVDQYYVGANNSIRGA  68

Query  356  CVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGW  535
            CVQN+LDS++ ALLADKNRKFIYVEQAFFQRWWR QS A+QS VR LVN+GQLEFINGG 
Sbjct  69   CVQNILDSVVSALLADKNRKFIYVEQAFFQRWWRQQSEAVQSIVRQLVNAGQLEFINGGM  128

Query  536  CMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            CMHDEA  HYIDMIDQTTLGH++IKQ+F+  PR+G
Sbjct  129  CMHDEATPHYIDMIDQTTLGHRFIKQEFDQIPRVG  163



>ref|XP_010028936.1| PREDICTED: lysosomal alpha-mannosidase [Eucalyptus grandis]
 gb|KCW55767.1| hypothetical protein EUGRSUZ_I01600 [Eucalyptus grandis]
Length=1016

 Score =   268 bits (686),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 137/157 (87%), Gaps = 1/157 (1%)
 Frame = +2

Query  170  LSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQ  349
             +L LA G+LCAESK++ Y+TSA I  GKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQ
Sbjct  8    FALVLA-GILCAESKFMSYNTSAGIDHGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQ  66

Query  350  GACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFING  529
            GACVQNVLDSL PALLADKNRKFIYVE AFFQRWWR QS  +Q+ VR  VNSGQLE ING
Sbjct  67   GACVQNVLDSLWPALLADKNRKFIYVEMAFFQRWWRGQSETIQNIVRQFVNSGQLELING  126

Query  530  GWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            G CMHDEA  HYIDMIDQTTLGH++IK++F VTPRIG
Sbjct  127  GMCMHDEAVPHYIDMIDQTTLGHRFIKEEFGVTPRIG  163



>ref|XP_011468215.1| PREDICTED: alpha-mannosidase isoform X2 [Fragaria vesca subsp. 
vesca]
Length=1000

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +2

Query  200  CAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  379
             A+SK++VY+TS  IVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS
Sbjct  18   VADSKFMVYETSQGIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  77

Query  380  LIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAAT  559
            LIPALLADK+RKF+YVE AFFQRWWR QS A+Q   + LV+SGQLEFINGG CMHDEAAT
Sbjct  78   LIPALLADKSRKFVYVEIAFFQRWWREQSDAVQRITKDLVSSGQLEFINGGMCMHDEAAT  137

Query  560  HYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HY+DM+DQTTLGH+++K++FNVTPRIG
Sbjct  138  HYVDMVDQTTLGHRFLKREFNVTPRIG  164



>ref|XP_010682967.1| PREDICTED: alpha-mannosidase-like [Beta vulgaris subsp. vulgaris]
Length=1028

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +2

Query  206  ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI  385
            ESK++VY+TSA IVP K+NVHLVPHTHDD GWLKTVDQYYVGSNNSIQGACVQNVLDSLI
Sbjct  31   ESKFMVYNTSAKIVPDKINVHLVPHTHDDAGWLKTVDQYYVGSNNSIQGACVQNVLDSLI  90

Query  386  PALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHY  565
            PALLADKNRKF+YVEQAFF+RWWR QS AMQ  V+ LV SGQLEFINGG  MHDEAATHY
Sbjct  91   PALLADKNRKFVYVEQAFFERWWREQSEAMQKIVKELVKSGQLEFINGGMVMHDEAATHY  150

Query  566  IDMIDQTTLGHQYIKQQFNVTPRIG  640
            IDMIDQTTLGHQ++K++F VTPRIG
Sbjct  151  IDMIDQTTLGHQFLKKEFGVTPRIG  175



>gb|KDO43582.1| hypothetical protein CISIN_1g0020361mg, partial [Citrus sinensis]
 gb|KDO43583.1| hypothetical protein CISIN_1g0020361mg, partial [Citrus sinensis]
 gb|KDO43584.1| hypothetical protein CISIN_1g0020361mg, partial [Citrus sinensis]
 gb|KDO43585.1| hypothetical protein CISIN_1g0020361mg, partial [Citrus sinensis]
 gb|KDO43586.1| hypothetical protein CISIN_1g0020361mg, partial [Citrus sinensis]
Length=697

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  200  CAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  379
            C ++KY VY+TS  IVPGKLNVHLV HTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS
Sbjct  21   CVQAKYRVYNTSQGIVPGKLNVHLVAHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  80

Query  380  LIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAAT  559
            +IP LLADKNRKFIYVEQAFFQRWW  QS AMQ  V+ LV SGQLEFINGG CMHDEA T
Sbjct  81   VIPELLADKNRKFIYVEQAFFQRWWDEQSEAMQHEVKQLVGSGQLEFINGGMCMHDEAVT  140

Query  560  HYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HYIDMIDQTTLGH++IK +F VTPRIG
Sbjct  141  HYIDMIDQTTLGHRFIKNEFGVTPRIG  167



>ref|XP_004304565.1| PREDICTED: alpha-mannosidase isoform X1 [Fragaria vesca subsp. 
vesca]
Length=1022

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +2

Query  200  CAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  379
             A+SK++VY+TS  IVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS
Sbjct  18   VADSKFMVYETSQGIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  77

Query  380  LIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAAT  559
            LIPALLADK+RKF+YVE AFFQRWWR QS A+Q   + LV+SGQLEFINGG CMHDEAAT
Sbjct  78   LIPALLADKSRKFVYVEIAFFQRWWREQSDAVQRITKDLVSSGQLEFINGGMCMHDEAAT  137

Query  560  HYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HY+DM+DQTTLGH+++K++FNVTPRIG
Sbjct  138  HYVDMVDQTTLGHRFLKREFNVTPRIG  164



>ref|XP_002276092.2| PREDICTED: alpha-mannosidase isoform X2 [Vitis vinifera]
 emb|CBI21276.3| unnamed protein product [Vitis vinifera]
Length=1025

 Score =   267 bits (682),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 1/158 (1%)
 Frame = +2

Query  167  FLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSI  346
            F  L LA G+  AESK++VYDTS  +VPGK+NVHLV HTHDDVGWLKTVDQYYVGSNNSI
Sbjct  6    FFVLLLA-GIFHAESKFMVYDTSPRLVPGKINVHLVAHTHDDVGWLKTVDQYYVGSNNSI  64

Query  347  QGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFIN  526
            QGACV+NVLDS++ ALLADKNRKFIYVEQAFFQRWWR+QS  +Q  V+ LV SGQLEFIN
Sbjct  65   QGACVENVLDSMVTALLADKNRKFIYVEQAFFQRWWRDQSETVQGIVKQLVRSGQLEFIN  124

Query  527  GGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GG CMHDEAATHYIDM+DQTTLGH+++K++F VTPRIG
Sbjct  125  GGMCMHDEAATHYIDMVDQTTLGHRFLKKEFGVTPRIG  162



>ref|XP_002512840.1| lysosomal alpha-mannosidase, putative [Ricinus communis]
 gb|EEF49343.1| lysosomal alpha-mannosidase, putative [Ricinus communis]
Length=977

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +2

Query  161  FWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNN  340
             +F+ L L + +   +SKY+VY+TS  IVP KLNVHLV HTHDDVGWLKTVDQYYVGSNN
Sbjct  6    LFFVFLYLGIAISWVDSKYIVYNTSQGIVPDKLNVHLVAHTHDDVGWLKTVDQYYVGSNN  65

Query  341  SIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEF  520
            SIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQ   +Q  V+ LV+SGQLEF
Sbjct  66   SIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQRETLQQVVKKLVSSGQLEF  125

Query  521  INGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            INGG CMHDEA  HYIDMIDQTTLGH++IK +F V PRIG
Sbjct  126  INGGMCMHDEAVVHYIDMIDQTTLGHRFIKNEFGVIPRIG  165



>ref|XP_010660680.1| PREDICTED: alpha-mannosidase isoform X1 [Vitis vinifera]
Length=1027

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 1/158 (1%)
 Frame = +2

Query  167  FLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSI  346
            F  L LA G+  AESK++VYDTS  +VPGK+NVHLV HTHDDVGWLKTVDQYYVGSNNSI
Sbjct  6    FFVLLLA-GIFHAESKFMVYDTSPRLVPGKINVHLVAHTHDDVGWLKTVDQYYVGSNNSI  64

Query  347  QGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFIN  526
            QGACV+NVLDS++ ALLADKNRKFIYVEQAFFQRWWR+QS  +Q  V+ LV SGQLEFIN
Sbjct  65   QGACVENVLDSMVTALLADKNRKFIYVEQAFFQRWWRDQSETVQGIVKQLVRSGQLEFIN  124

Query  527  GGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GG CMHDEAATHYIDM+DQTTLGH+++K++F VTPRIG
Sbjct  125  GGMCMHDEAATHYIDMVDQTTLGHRFLKKEFGVTPRIG  162



>gb|KHG03548.1| Lysosomal alpha-mannosidase [Gossypium arboreum]
Length=997

 Score =   266 bits (679),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 138/159 (87%), Gaps = 3/159 (2%)
 Frame = +2

Query  164  WFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNS  343
            W L L   + + C E KY++Y+T++ IVPGKLNVHLV HTHDDVGWLKTVDQYYVGSNNS
Sbjct  7    WILILVTLMSIWCVEPKYIIYNTTSKIVPGKLNVHLVAHTHDDVGWLKTVDQYYVGSNNS  66

Query  344  IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFI  523
            IQGACVQNVLDS++PALLADKNRKFIY   AFFQRWWR+QS  +Q TV+ L+NSGQLE I
Sbjct  67   IQGACVQNVLDSIVPALLADKNRKFIY---AFFQRWWRDQSETVQETVKRLINSGQLELI  123

Query  524  NGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            NGG CMHDEAA HYIDMIDQTTLGH++IK++FN+TPRIG
Sbjct  124  NGGMCMHDEAAPHYIDMIDQTTLGHRFIKREFNITPRIG  162



>ref|XP_004143760.1| PREDICTED: lysosomal alpha-mannosidase-like [Cucumis sativus]
 gb|KGN51129.1| hypothetical protein Csa_5G458290 [Cucumis sativus]
Length=1020

 Score =   266 bits (680),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 143/162 (88%), Gaps = 1/162 (1%)
 Frame = +2

Query  155  VEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGS  334
            +  +FL++ L+V +  AESK++VY+TS  +VP KLNVHLV HTHDDVGWLKTVDQYYVGS
Sbjct  5    LRLFFLAILLSV-LFGAESKFMVYNTSQTLVPEKLNVHLVAHTHDDVGWLKTVDQYYVGS  63

Query  335  NNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQL  514
            NNSIQGACVQNVLDS++ ALLADKNRKFIYVEQAFFQRWWR+QS  +Q  VR LVNSGQL
Sbjct  64   NNSIQGACVQNVLDSMVSALLADKNRKFIYVEQAFFQRWWRDQSETVQDVVRKLVNSGQL  123

Query  515  EFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            EFINGG CMHDEA THYIDMIDQTTLGH++IK++F+VTP +G
Sbjct  124  EFINGGMCMHDEATTHYIDMIDQTTLGHRFIKEEFDVTPTVG  165



>ref|XP_011098968.1| PREDICTED: alpha-mannosidase isoform X3 [Sesamum indicum]
Length=1027

 Score =   266 bits (679),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPA  391
            KY+VY+TS AIVP KLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL+ A
Sbjct  30   KYMVYNTSQAIVPNKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLVSA  89

Query  392  LLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYID  571
            LLADKNRKFIYVEQAFFQRWWR QS A+Q  VR LV+SGQLEFINGG CMHDEA THYID
Sbjct  90   LLADKNRKFIYVEQAFFQRWWREQSEAIQLIVRQLVSSGQLEFINGGMCMHDEATTHYID  149

Query  572  MIDQTTLGHQYIKQQFNVTPRIG  640
            MIDQTTLGH++IK+QF VTPR+G
Sbjct  150  MIDQTTLGHRFIKEQFGVTPRVG  172



>ref|XP_011098966.1| PREDICTED: alpha-mannosidase isoform X1 [Sesamum indicum]
Length=1038

 Score =   266 bits (679),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPA  391
            KY+VY+TS AIVP KLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL+ A
Sbjct  30   KYMVYNTSQAIVPNKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLVSA  89

Query  392  LLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYID  571
            LLADKNRKFIYVEQAFFQRWWR QS A+Q  VR LV+SGQLEFINGG CMHDEA THYID
Sbjct  90   LLADKNRKFIYVEQAFFQRWWREQSEAIQLIVRQLVSSGQLEFINGGMCMHDEATTHYID  149

Query  572  MIDQTTLGHQYIKQQFNVTPRIG  640
            MIDQTTLGH++IK+QF VTPR+G
Sbjct  150  MIDQTTLGHRFIKEQFGVTPRVG  172



>ref|XP_011098967.1| PREDICTED: alpha-mannosidase isoform X2 [Sesamum indicum]
Length=1034

 Score =   266 bits (679),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPA  391
            KY+VY+TS AIVP KLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL+ A
Sbjct  30   KYMVYNTSQAIVPNKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLVSA  89

Query  392  LLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYID  571
            LLADKNRKFIYVEQAFFQRWWR QS A+Q  VR LV+SGQLEFINGG CMHDEA THYID
Sbjct  90   LLADKNRKFIYVEQAFFQRWWREQSEAIQLIVRQLVSSGQLEFINGGMCMHDEATTHYID  149

Query  572  MIDQTTLGHQYIKQQFNVTPRIG  640
            MIDQTTLGH++IK+QF VTPR+G
Sbjct  150  MIDQTTLGHRFIKEQFGVTPRVG  172



>ref|XP_003602752.1| Lysosomal alpha-mannosidase [Medicago truncatula]
 gb|AES73003.1| glycoside hydrolase family 38 amino-terminal domain protein [Medicago 
truncatula]
Length=1016

 Score =   265 bits (678),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  188  VGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQN  367
            V +  +ES Y+ Y+T++ IVPGKLNVHLVPH+HDDVGWLKT+DQYYVGSNN+IQGACVQN
Sbjct  18   VCITSSESNYIRYNTNSTIVPGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNTIQGACVQN  77

Query  368  VLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHD  547
            VLDSLIPALLADKNRKFIYVEQAFFQRWWR QS  +Q  V+ LVNSGQLEFINGG CMHD
Sbjct  78   VLDSLIPALLADKNRKFIYVEQAFFQRWWREQSGEVQKIVKQLVNSGQLEFINGGMCMHD  137

Query  548  EAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            EAA HYIDMIDQTTLGH++IK+ F +TPRIG
Sbjct  138  EAAAHYIDMIDQTTLGHRFIKEVFGITPRIG  168



>ref|XP_003602753.1| Lysosomal alpha-mannosidase [Medicago truncatula]
Length=1023

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  188  VGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQN  367
            V +  +ES Y+ Y+T++ IVPGKLNVHLVPH+HDDVGWLKT+DQYYVGSNN+IQGACVQN
Sbjct  18   VCITSSESNYIRYNTNSTIVPGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNTIQGACVQN  77

Query  368  VLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHD  547
            VLDSLIPALLADKNRKFIYVEQAFFQRWWR QS  +Q  V+ LVNSGQLEFINGG CMHD
Sbjct  78   VLDSLIPALLADKNRKFIYVEQAFFQRWWREQSGEVQKIVKQLVNSGQLEFINGGMCMHD  137

Query  548  EAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            EAA HYIDMIDQTTLGH++IK+ F +TPRIG
Sbjct  138  EAAAHYIDMIDQTTLGHRFIKEVFGITPRIG  168



>ref|XP_010039003.1| PREDICTED: lysosomal alpha-mannosidase-like [Eucalyptus grandis]
Length=948

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +2

Query  200  CAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  379
            CA+SKY+ Y+T++ +VPGKLNVHLVPHTHDDVGW KTVDQYYVGSNN+IQGACVQN LDS
Sbjct  18   CAQSKYIAYNTTSRVVPGKLNVHLVPHTHDDVGWKKTVDQYYVGSNNTIQGACVQNELDS  77

Query  380  LIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAAT  559
            ++PALLA+K+RKFIY EQAFFQRWWR+QS  +Q+TV+ LV+SGQLEFINGG CMHDEA T
Sbjct  78   IVPALLANKDRKFIYAEQAFFQRWWRDQSEQVQNTVKQLVSSGQLEFINGGMCMHDEATT  137

Query  560  HYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HYIDMIDQTTLGH++IK++F VTPRIG
Sbjct  138  HYIDMIDQTTLGHRFIKEEFGVTPRIG  164



>ref|XP_006468891.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Citrus 
sinensis]
Length=1026

 Score =   263 bits (673),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  200  CAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  379
            C ++KY VY+TS  IVPGKLNVHLV HTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS
Sbjct  21   CVQAKYRVYNTSQGIVPGKLNVHLVAHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  80

Query  380  LIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAAT  559
            +IP LLADKNRKFIYVEQAFFQRWW  QS AMQ  V+ LV SGQLEFINGG CMHDEA T
Sbjct  81   VIPELLADKNRKFIYVEQAFFQRWWDEQSEAMQHEVKQLVGSGQLEFINGGMCMHDEAVT  140

Query  560  HYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HYIDMIDQTTLGH++IK +F VTPRIG
Sbjct  141  HYIDMIDQTTLGHRFIKNEFGVTPRIG  167



>ref|XP_006436953.1| hypothetical protein CICLE_v10030627mg [Citrus clementina]
 gb|ESR50193.1| hypothetical protein CICLE_v10030627mg [Citrus clementina]
Length=988

 Score =   263 bits (672),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = +2

Query  218  VVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPALL  397
            ++Y+TSA IVPGK+NVHLVPH+HDDVGWLKTVDQYYVGSNNSIQ ACVQNVLDSLIPAL+
Sbjct  1    MMYNTSAGIVPGKINVHLVPHSHDDVGWLKTVDQYYVGSNNSIQVACVQNVLDSLIPALV  60

Query  398  ADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDMI  577
            ADKNRKFIYVEQAFFQRWWR+QS  +Q+ V+ LVNSGQLE INGG CMHDEAA HYIDMI
Sbjct  61   ADKNRKFIYVEQAFFQRWWRDQSEEVQNVVKQLVNSGQLELINGGMCMHDEAAPHYIDMI  120

Query  578  DQTTLGHQYIKQQFNVTPRIG  640
            DQTTLGH+YIK+QFNVTPRIG
Sbjct  121  DQTTLGHRYIKEQFNVTPRIG  141



>gb|AGX24942.1| a-mannosidase [Cucumis melo]
Length=1020

 Score =   263 bits (671),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            MA     F  + L   +   +SK++VY+TS  +VPGKLNVHLV HTHDDVGWLKTVDQYY
Sbjct  1    MATTFRLFFGVILLSLLFGVQSKFMVYNTSQTVVPGKLNVHLVAHTHDDVGWLKTVDQYY  60

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQGACVQNVLDS++ ALLADKNRKFIYVEQAFFQRWWR+QS  +Q  VR LVNS
Sbjct  61   VGSNNSIQGACVQNVLDSMVSALLADKNRKFIYVEQAFFQRWWRDQSEIVQDVVRKLVNS  120

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLEFINGG CMHDEA THYIDMIDQTTLGH++IK++F+VTP +G
Sbjct  121  GQLEFINGGMCMHDEAVTHYIDMIDQTTLGHRFIKEEFDVTPTVG  165



>ref|XP_008465523.1| PREDICTED: lysosomal alpha-mannosidase [Cucumis melo]
Length=1020

 Score =   263 bits (671),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            MA     F  + L   +   +SK++VY+TS  +VPGKLNVHLV HTHDDVGWLKTVDQYY
Sbjct  1    MATTFRLFFGVILLSLLFGVQSKFMVYNTSQTVVPGKLNVHLVAHTHDDVGWLKTVDQYY  60

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQGACVQNVLDS++ ALLADKNRKFIYVEQAFFQRWWR+QS  +Q  VR LVNS
Sbjct  61   VGSNNSIQGACVQNVLDSMVSALLADKNRKFIYVEQAFFQRWWRDQSEIVQDVVRKLVNS  120

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLEFINGG CMHDEA THYIDMIDQTTLGH++IK++F+VTP +G
Sbjct  121  GQLEFINGGMCMHDEAVTHYIDMIDQTTLGHRFIKEEFDVTPTVG  165



>ref|XP_006844480.1| hypothetical protein AMTR_s00016p00106660 [Amborella trichopoda]
 gb|ERN06155.1| hypothetical protein AMTR_s00016p00106660 [Amborella trichopoda]
Length=1020

 Score =   263 bits (671),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 132/152 (87%), Gaps = 3/152 (2%)
 Frame = +2

Query  194  VLC---AESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQ  364
            V C   A  K++ Y+TS   VPGK+NVHLV HTHDDVGWLKTVDQYYVGSNNSIQGA VQ
Sbjct  14   VFCNGSAYGKFIAYNTSQRTVPGKINVHLVAHTHDDVGWLKTVDQYYVGSNNSIQGASVQ  73

Query  365  NVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMH  544
            NVLDSLIPALLADKNRKFIYVEQAFFQRWWR QS AMQ+ V+ LVNSGQLEFINGG CMH
Sbjct  74   NVLDSLIPALLADKNRKFIYVEQAFFQRWWREQSEAMQAVVKALVNSGQLEFINGGMCMH  133

Query  545  DEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            DEAA HYIDMIDQTTLGH++IKQ+F  TPRIG
Sbjct  134  DEAAPHYIDMIDQTTLGHRFIKQEFGKTPRIG  165



>tpg|DAA42034.1| TPA: alpha-mannosidase, partial [Zea mays]
Length=664

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            Y+ Y+TSA +VPGKLNVH+VPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL
Sbjct  23   YIPYNTSAGVVPGKLNVHVVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  82

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
            L D+NRKFIYVEQAFFQRWWRNQ+  ++ TV+GL++SG+LE INGG CMHDEAA HYIDM
Sbjct  83   LKDENRKFIYVEQAFFQRWWRNQNDMIKDTVKGLISSGRLELINGGMCMHDEAAVHYIDM  142

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH+YIK++F   PRIG
Sbjct  143  IDQTTLGHKYIKEEFGQIPRIG  164



>ref|XP_010453503.1| PREDICTED: lysosomal alpha-mannosidase-like [Camelina sativa]
Length=1024

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 140/165 (85%), Gaps = 3/165 (2%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            +AK   W   + L +G+   ESKY+VY+TS  IVPGKLNVH+VPH+HDDVGWLKTVDQYY
Sbjct  3    LAKFLCW---VVLLLGISLVESKYMVYNTSHTIVPGKLNVHVVPHSHDDVGWLKTVDQYY  59

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQ ACVQNVLDSL+PALLADKNRKFIYVEQAFFQRWW  QS  ++  V+ L++S
Sbjct  60   VGSNNSIQVACVQNVLDSLVPALLADKNRKFIYVEQAFFQRWWNEQSETIKRIVKDLIHS  119

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLE INGG CMHDEAA HYIDMIDQTTLGH++I ++FNVTPRIG
Sbjct  120  GQLELINGGMCMHDEAAPHYIDMIDQTTLGHRFIIREFNVTPRIG  164



>ref|XP_011033760.1| PREDICTED: alpha-mannosidase-like isoform X1 [Populus euphratica]
Length=1021

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  194  VLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVL  373
            +   E+KY+VY+TS  IV  K+NVHLV HTHDDVGWLKTVDQYYVGSNNSIQGACVQNVL
Sbjct  18   LFMVEAKYMVYNTSQGIVKDKINVHLVAHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVL  77

Query  374  DSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEA  553
            DSLIPALLADKNRKFIYVEQAFFQRWWR+QS  MQ  V+ LV+SGQLEFINGG CMHDEA
Sbjct  78   DSLIPALLADKNRKFIYVEQAFFQRWWRDQSETMQHVVKQLVSSGQLEFINGGMCMHDEA  137

Query  554  ATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
             THYIDMIDQTTLGH++IK+ F VTPR+G
Sbjct  138  VTHYIDMIDQTTLGHRFIKKDFGVTPRVG  166



>ref|XP_006446932.1| hypothetical protein CICLE_v10014123mg [Citrus clementina]
 gb|ESR60172.1| hypothetical protein CICLE_v10014123mg [Citrus clementina]
Length=973

 Score =   260 bits (665),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  200  CAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  379
            C ++KY VY+TS  IVPGKLNVHLV HTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS
Sbjct  21   CVQAKYRVYNTSQGIVPGKLNVHLVAHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  80

Query  380  LIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAAT  559
            +IP LLADKNRKFIYVEQAFFQRWW  QS AMQ  V+ LV  GQLEFINGG CMHDEA T
Sbjct  81   VIPELLADKNRKFIYVEQAFFQRWWDEQSEAMQHEVKQLVGLGQLEFINGGMCMHDEAVT  140

Query  560  HYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HYIDMIDQTTLGH++IK +F VTPRIG
Sbjct  141  HYIDMIDQTTLGHRFIKNEFGVTPRIG  167



>ref|XP_010420018.1| PREDICTED: lysosomal alpha-mannosidase-like [Camelina sativa]
Length=1024

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  176  LTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGA  355
            + L +G+   ESKY+VY+TS  IVPGKLNVH+VPH+HDDVGWLKTVDQYYVGSNNSIQ A
Sbjct  10   VVLLLGISLVESKYMVYNTSHTIVPGKLNVHVVPHSHDDVGWLKTVDQYYVGSNNSIQVA  69

Query  356  CVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGW  535
            CVQNVLDSL+PALLADKNRKFIYVEQAFFQRWW  QS  ++  V+ L++SGQLE INGG 
Sbjct  70   CVQNVLDSLVPALLADKNRKFIYVEQAFFQRWWNEQSETIKRIVKDLIHSGQLELINGGM  129

Query  536  CMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            CMHDEAA HYIDMIDQTTLGH++I ++FNVTPRIG
Sbjct  130  CMHDEAAPHYIDMIDQTTLGHRFIIREFNVTPRIG  164



>ref|XP_006446933.1| hypothetical protein CICLE_v10014123mg [Citrus clementina]
 gb|ESR60173.1| hypothetical protein CICLE_v10014123mg [Citrus clementina]
Length=1026

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  200  CAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  379
            C ++KY VY+TS  IVPGKLNVHLV HTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS
Sbjct  21   CVQAKYRVYNTSQGIVPGKLNVHLVAHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  80

Query  380  LIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAAT  559
            +IP LLADKNRKFIYVEQAFFQRWW  QS AMQ  V+ LV  GQLEFINGG CMHDEA T
Sbjct  81   VIPELLADKNRKFIYVEQAFFQRWWDEQSEAMQHEVKQLVGLGQLEFINGGMCMHDEAVT  140

Query  560  HYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HYIDMIDQTTLGH++IK +F VTPRIG
Sbjct  141  HYIDMIDQTTLGHRFIKNEFGVTPRIG  167



>gb|KFK25632.1| hypothetical protein AALP_AA8G139900 [Arabis alpina]
Length=1021

 Score =   260 bits (664),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 140/165 (85%), Gaps = 3/165 (2%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            +AK   W   + L VG+   ESKY+VY+TS +IVPGKLNVH+VPH+HDDVGWLKTVDQYY
Sbjct  3    LAKFLCW---VVLVVGISSVESKYMVYNTSHSIVPGKLNVHVVPHSHDDVGWLKTVDQYY  59

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQ ACV+NVLDS++PALLADKNRKFIYVEQAFFQRWW  QS  ++  V+ L+ S
Sbjct  60   VGSNNSIQVACVRNVLDSIVPALLADKNRKFIYVEQAFFQRWWNEQSETIKGIVKELIKS  119

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLE INGG CMHDEAA HYIDMIDQTTLGH++I ++FNVTPRIG
Sbjct  120  GQLEHINGGMCMHDEAAPHYIDMIDQTTLGHRFIVREFNVTPRIG  164



>ref|XP_002449583.1| hypothetical protein SORBIDRAFT_05g019600 [Sorghum bicolor]
 gb|EES08571.1| hypothetical protein SORBIDRAFT_05g019600 [Sorghum bicolor]
Length=1019

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  200  CAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  379
              E+ Y+ Y+TSA +VPGKLNVH+VPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS
Sbjct  20   VGEAVYIPYNTSAGVVPGKLNVHVVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  79

Query  380  LIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAAT  559
            LIPALL D+NRKFIYVEQAFFQRWWRNQ+  ++ TV+GL++SG+LE INGG CMHDEAA 
Sbjct  80   LIPALLKDENRKFIYVEQAFFQRWWRNQNDMIKDTVKGLISSGRLELINGGMCMHDEAAV  139

Query  560  HYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HYIDMIDQTTLGH+YIK++F   PRIG
Sbjct  140  HYIDMIDQTTLGHRYIKEEFGQIPRIG  166



>ref|XP_006399901.1| hypothetical protein EUTSA_v10012546mg [Eutrema salsugineum]
 gb|ESQ41354.1| hypothetical protein EUTSA_v10012546mg [Eutrema salsugineum]
Length=914

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 138/168 (82%), Gaps = 9/168 (5%)
 Frame = +2

Query  164  WFLSLTLAVGVLCA---------ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVD  316
            WF  + LA  + C          ES+Y+VY+TS  +VPGKLNVH+VPH+HDDVGWLKTVD
Sbjct  3    WFERMDLAKFLCCVVLLRGISSVESRYMVYNTSHTMVPGKLNVHVVPHSHDDVGWLKTVD  62

Query  317  QYYVGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGL  496
            QYYVGSNNSIQ ACVQNVLDS++PALLADKNRKFIYVEQAFFQRWWR QS  ++  V+ L
Sbjct  63   QYYVGSNNSIQVACVQNVLDSIVPALLADKNRKFIYVEQAFFQRWWREQSEEIKRIVKDL  122

Query  497  VNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            + SGQLE INGG CMHDEAA HYIDMIDQTTLGH++I ++FNVTPRIG
Sbjct  123  IRSGQLELINGGMCMHDEAAPHYIDMIDQTTLGHRFIIREFNVTPRIG  170



>ref|XP_006399902.1| hypothetical protein EUTSA_v10012546mg [Eutrema salsugineum]
 gb|ESQ41355.1| hypothetical protein EUTSA_v10012546mg [Eutrema salsugineum]
Length=1026

 Score =   259 bits (662),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 138/168 (82%), Gaps = 9/168 (5%)
 Frame = +2

Query  164  WFLSLTLAV---------GVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVD  316
            WF  + LA          G+   ES+Y+VY+TS  +VPGKLNVH+VPH+HDDVGWLKTVD
Sbjct  3    WFERMDLAKFLCCVVLLRGISSVESRYMVYNTSHTMVPGKLNVHVVPHSHDDVGWLKTVD  62

Query  317  QYYVGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGL  496
            QYYVGSNNSIQ ACVQNVLDS++PALLADKNRKFIYVEQAFFQRWWR QS  ++  V+ L
Sbjct  63   QYYVGSNNSIQVACVQNVLDSIVPALLADKNRKFIYVEQAFFQRWWREQSEEIKRIVKDL  122

Query  497  VNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            + SGQLE INGG CMHDEAA HYIDMIDQTTLGH++I ++FNVTPRIG
Sbjct  123  IRSGQLELINGGMCMHDEAAPHYIDMIDQTTLGHRFIIREFNVTPRIG  170



>ref|NP_001031878.1| Glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
 gb|AED91970.1| Glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
Length=921

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 140/165 (85%), Gaps = 3/165 (2%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            +AK   W   + L +G+   ES+Y+VY+TS  IVPGKLNVH+VPH+HDDVGWLKTVDQYY
Sbjct  3    LAKFLCW---IVLLLGISLVESRYMVYNTSHTIVPGKLNVHVVPHSHDDVGWLKTVDQYY  59

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQ ACVQNVLDS++PALLADKNRKFIYVEQAFFQRWW  QS  ++  V+ L++S
Sbjct  60   VGSNNSIQVACVQNVLDSIVPALLADKNRKFIYVEQAFFQRWWNEQSEEIKRIVKELIHS  119

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLE INGG CMHDEAA HYIDMIDQTTLGH++I ++FNVTPRIG
Sbjct  120  GQLELINGGMCMHDEAAPHYIDMIDQTTLGHRFIIREFNVTPRIG  164



>ref|XP_006289410.1| hypothetical protein CARUB_v10002909mg [Capsella rubella]
 gb|EOA22308.1| hypothetical protein CARUB_v10002909mg [Capsella rubella]
Length=1024

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  188  VGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQN  367
            +GV  AES+Y+ Y+TS  IVPGKLNVH+VPH+HDDVGWLKTVDQYYVGSNNSIQ ACVQN
Sbjct  14   LGVSLAESRYIAYNTSHTIVPGKLNVHVVPHSHDDVGWLKTVDQYYVGSNNSIQVACVQN  73

Query  368  VLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHD  547
            VLDS++PALLADKNRKFIYVEQAFFQRWW  QS  ++  V+ L++SGQLE INGG CMHD
Sbjct  74   VLDSIVPALLADKNRKFIYVEQAFFQRWWNEQSETIKRIVKDLIHSGQLELINGGMCMHD  133

Query  548  EAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            EAA HYIDMIDQTTLGH++I ++FNVTPRIG
Sbjct  134  EAAPHYIDMIDQTTLGHRFIIREFNVTPRIG  164



>ref|XP_011463212.1| PREDICTED: alpha-mannosidase-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=1021

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 138/157 (88%), Gaps = 2/157 (1%)
 Frame = +2

Query  176  LTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQG-  352
            L + V  L AESK++ Y+T++ IVPGKLNVHLVPHTHDDVGW+KTVDQYY G+NNS+ G 
Sbjct  11   LMVLVVFLFAESKFIAYNTTSQIVPGKLNVHLVPHTHDDVGWVKTVDQYYTGANNSLLGS  70

Query  353  -ACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFING  529
             A V+NVLDSL+PALLADKNRKFIY EQAFFQ WWR QS A+Q TV+ LV+SGQLEFING
Sbjct  71   PASVRNVLDSLVPALLADKNRKFIYAEQAFFQLWWREQSEAIQDTVKQLVSSGQLEFING  130

Query  530  GWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            G CMHDEAATHYIDMIDQTTLGH++IKQ+FNVTPR+G
Sbjct  131  GMCMHDEAATHYIDMIDQTTLGHRFIKQEFNVTPRVG  167



>dbj|BAB11126.1| alpha-mannosidase [Arabidopsis thaliana]
Length=1030

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 140/165 (85%), Gaps = 3/165 (2%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            +AK   W   + L +G+   ES+Y+VY+TS  IVPGKLNVH+VPH+HDDVGWLKTVDQYY
Sbjct  3    LAKFLCW---IVLLLGISLVESRYMVYNTSHTIVPGKLNVHVVPHSHDDVGWLKTVDQYY  59

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQ ACVQNVLDS++PALLADKNRKFIYVEQAFFQRWW  QS  ++  V+ L++S
Sbjct  60   VGSNNSIQVACVQNVLDSIVPALLADKNRKFIYVEQAFFQRWWNEQSEEIKRIVKELIHS  119

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLE INGG CMHDEAA HYIDMIDQTTLGH++I ++FNVTPRIG
Sbjct  120  GQLELINGGMCMHDEAAPHYIDMIDQTTLGHRFIIREFNVTPRIG  164



>ref|NP_196902.2| Glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
 ref|NP_851037.2| Glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
 gb|AAM20555.1| alpha-mannosidase [Arabidopsis thaliana]
 gb|AAN15620.1| alpha-mannosidase [Arabidopsis thaliana]
 gb|AED91968.1| Glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
 gb|AED91969.1| Glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
Length=1024

 Score =   258 bits (660),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 140/165 (85%), Gaps = 3/165 (2%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            +AK   W   + L +G+   ES+Y+VY+TS  IVPGKLNVH+VPH+HDDVGWLKTVDQYY
Sbjct  3    LAKFLCW---IVLLLGISLVESRYMVYNTSHTIVPGKLNVHVVPHSHDDVGWLKTVDQYY  59

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQ ACVQNVLDS++PALLADKNRKFIYVEQAFFQRWW  QS  ++  V+ L++S
Sbjct  60   VGSNNSIQVACVQNVLDSIVPALLADKNRKFIYVEQAFFQRWWNEQSEEIKRIVKELIHS  119

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLE INGG CMHDEAA HYIDMIDQTTLGH++I ++FNVTPRIG
Sbjct  120  GQLELINGGMCMHDEAAPHYIDMIDQTTLGHRFIIREFNVTPRIG  164



>ref|XP_008670747.1| PREDICTED: lysosomal alpha-mannosidase [Zea mays]
 tpg|DAA42032.1| TPA: alpha-mannosidase [Zea mays]
Length=1016

 Score =   258 bits (660),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            Y+ Y+TSA +VPGKLNVH+VPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL
Sbjct  23   YIPYNTSAGVVPGKLNVHVVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  82

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
            L D+NRKFIYVEQAFFQRWWRNQ+  ++ TV+GL++SG+LE INGG CMHDEAA HYIDM
Sbjct  83   LKDENRKFIYVEQAFFQRWWRNQNDMIKDTVKGLISSGRLELINGGMCMHDEAAVHYIDM  142

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH+YIK++F   PRIG
Sbjct  143  IDQTTLGHKYIKEEFGQIPRIG  164



>ref|XP_009415848.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1025

 Score =   258 bits (660),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  203  AESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  382
            AESKY+ Y+T+  IV  KLNVH+V HTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS+
Sbjct  24   AESKYIAYNTTQRIVADKLNVHIVAHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSI  83

Query  383  IPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATH  562
            IPALLADKNR+FIYVEQAFFQRWWR QS  ++STV+ L++SGQLEFINGG CMHDEAA H
Sbjct  84   IPALLADKNRRFIYVEQAFFQRWWRQQSDEIKSTVKELLSSGQLEFINGGMCMHDEAAVH  143

Query  563  YIDMIDQTTLGHQYIKQQFNVTPRIG  640
            YIDMIDQTTLGH++IKQ+F + PRIG
Sbjct  144  YIDMIDQTTLGHRFIKQEFGIIPRIG  169



>ref|XP_009415849.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1023

 Score =   258 bits (660),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  203  AESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  382
            AESKY+ Y+T+  IV  KLNVH+V HTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS+
Sbjct  24   AESKYIAYNTTQRIVADKLNVHIVAHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSI  83

Query  383  IPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATH  562
            IPALLADKNR+FIYVEQAFFQRWWR QS  ++STV+ L++SGQLEFINGG CMHDEAA H
Sbjct  84   IPALLADKNRRFIYVEQAFFQRWWRQQSDEIKSTVKELLSSGQLEFINGGMCMHDEAAVH  143

Query  563  YIDMIDQTTLGHQYIKQQFNVTPRIG  640
            YIDMIDQTTLGH++IKQ+F + PRIG
Sbjct  144  YIDMIDQTTLGHRFIKQEFGIIPRIG  169



>tpg|DAA42033.1| TPA: alpha-mannosidase [Zea mays]
Length=1036

 Score =   258 bits (660),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            Y+ Y+TSA +VPGKLNVH+VPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL
Sbjct  23   YIPYNTSAGVVPGKLNVHVVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  82

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
            L D+NRKFIYVEQAFFQRWWRNQ+  ++ TV+GL++SG+LE INGG CMHDEAA HYIDM
Sbjct  83   LKDENRKFIYVEQAFFQRWWRNQNDMIKDTVKGLISSGRLELINGGMCMHDEAAVHYIDM  142

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH+YIK++F   PRIG
Sbjct  143  IDQTTLGHKYIKEEFGQIPRIG  164



>ref|XP_011463211.1| PREDICTED: alpha-mannosidase-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=1063

 Score =   258 bits (660),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 138/157 (88%), Gaps = 2/157 (1%)
 Frame = +2

Query  176  LTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQG-  352
            L + V  L AESK++ Y+T++ IVPGKLNVHLVPHTHDDVGW+KTVDQYY G+NNS+ G 
Sbjct  11   LMVLVVFLFAESKFIAYNTTSQIVPGKLNVHLVPHTHDDVGWVKTVDQYYTGANNSLLGS  70

Query  353  -ACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFING  529
             A V+NVLDSL+PALLADKNRKFIY EQAFFQ WWR QS A+Q TV+ LV+SGQLEFING
Sbjct  71   PASVRNVLDSLVPALLADKNRKFIYAEQAFFQLWWREQSEAIQDTVKQLVSSGQLEFING  130

Query  530  GWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            G CMHDEAATHYIDMIDQTTLGH++IKQ+FNVTPR+G
Sbjct  131  GMCMHDEAATHYIDMIDQTTLGHRFIKQEFNVTPRVG  167



>ref|XP_008374165.1| PREDICTED: lysosomal alpha-mannosidase-like [Malus domestica]
Length=1000

 Score =   258 bits (658),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  203  AESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  382
             ESKY+VY+T++ + PGKLNVHLVPHTHDDVGW KTVDQYY GSNNS+Q ACV+ VLDSL
Sbjct  24   GESKYMVYNTTSRLXPGKLNVHLVPHTHDDVGWKKTVDQYYTGSNNSLQVACVRMVLDSL  83

Query  383  IPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATH  562
            +PALLADKNRKFIYVEQ FFQRWWR+Q+ A Q+TV+ LV+SGQLE INGG CMHDEAA H
Sbjct  84   VPALLADKNRKFIYVEQVFFQRWWRDQTEATQNTVKQLVSSGQLELINGGMCMHDEAAAH  143

Query  563  YIDMIDQTTLGHQYIKQQFNVTPRIG  640
            YIDMIDQTTLGH++IKQ+FNVTPRIG
Sbjct  144  YIDMIDQTTLGHRFIKQEFNVTPRIG  169



>ref|XP_010492186.1| PREDICTED: lysosomal alpha-mannosidase-like [Camelina sativa]
Length=1024

 Score =   257 bits (657),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 138/165 (84%), Gaps = 3/165 (2%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            +AK   W   + L +G+   ESKY+VY+TS  IVPGKLNVH+VPH+HDDVGWLKTVDQYY
Sbjct  3    LAKFLCW---VVLLLGISLVESKYMVYNTSHTIVPGKLNVHVVPHSHDDVGWLKTVDQYY  59

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQ ACVQNVLDSL+PALLADKNRKFIYVEQAFFQRWW  QS  ++  V+ L+ S
Sbjct  60   VGSNNSIQVACVQNVLDSLVPALLADKNRKFIYVEQAFFQRWWNEQSETIKRIVKDLIRS  119

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
             QLE INGG CMHDEAA HYIDMIDQTTLGH++I ++FNVTPRIG
Sbjct  120  CQLELINGGMCMHDEAAPHYIDMIDQTTLGHRFIIREFNVTPRIG  164



>ref|XP_002871594.1| glycosyl hydrolase family 38 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47853.1| glycosyl hydrolase family 38 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=1024

 Score =   257 bits (656),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 140/165 (85%), Gaps = 3/165 (2%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            +AK   W   + L +G+   ES+Y+VY+TS  +VPGKLNVH+VPH+HDDVGWLKTVDQYY
Sbjct  3    LAKFLCW---VVLLLGISFVESRYMVYNTSHTMVPGKLNVHVVPHSHDDVGWLKTVDQYY  59

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQ ACVQNVLDS++PALLADKNRKFIYVEQAFFQRWW  QS  ++  V+ L++S
Sbjct  60   VGSNNSIQVACVQNVLDSIVPALLADKNRKFIYVEQAFFQRWWNEQSETIKRIVKELIHS  119

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLE INGG CMHDEAA HYIDMIDQTTLGH++I ++FNVTPRIG
Sbjct  120  GQLELINGGMCMHDEAAPHYIDMIDQTTLGHRFIIREFNVTPRIG  164



>gb|KJB33198.1| hypothetical protein B456_006G000300 [Gossypium raimondii]
Length=680

 Score =   252 bits (644),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = +2

Query  167  FLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSI  346
             +++ LA GV  AES Y+ Y+T+  IVPGK+NVHLVPH+HDDVGWLKTVDQYY G NNSI
Sbjct  13   LVAILLAGGVSSAESSYIEYNTTQRIVPGKINVHLVPHSHDDVGWLKTVDQYYFGGNNSI  72

Query  347  QGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFIN  526
            +GACVQNVLDS+I AL  DKNRKFIYVE AFFQRWWR QS A +  V+ LVNSGQLEFIN
Sbjct  73   RGACVQNVLDSVISALFDDKNRKFIYVEMAFFQRWWRQQSNAKKIKVKELVNSGQLEFIN  132

Query  527  GGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GG CMHDEA  HYID+IDQTTLGH+YIK +FN  PR+G
Sbjct  133  GGMCMHDEATPHYIDLIDQTTLGHKYIKDEFNQIPRVG  170



>ref|XP_010663638.1| PREDICTED: alpha-mannosidase [Vitis vinifera]
Length=1060

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = +2

Query  131  CHLQPMAKVEFWFLSLTLAVG-VLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLK  307
             H  PMA   F   SL L +   L AESK++VY T  ++VPGKLNVHLVPHTH+DVGW K
Sbjct  30   SHQMPMAMTPFRLCSLVLFLSCALVAESKFMVYKTGQSVVPGKLNVHLVPHTHNDVGWRK  89

Query  308  TVDQYYVGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTV  487
            TVDQYYVGSN +    CV+N+LDSLIPALLA+KNR+FIYVEQAFFQRWWR+QS  +Q+ V
Sbjct  90   TVDQYYVGSNYTADEGCVENILDSLIPALLANKNRRFIYVEQAFFQRWWRDQSKIVQNIV  149

Query  488  RGLVNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            + LV+SGQLEFINGG CMHDEAAT+YIDMIDQTTLGH++IK +F VTPRIG
Sbjct  150  KQLVSSGQLEFINGGMCMHDEAATNYIDMIDQTTLGHRFIKDEFGVTPRIG  200



>gb|KDP41856.1| hypothetical protein JCGZ_26874 [Jatropha curcas]
Length=1015

 Score =   256 bits (654),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 137/165 (83%), Gaps = 1/165 (1%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            M+ + F+ L++ LA+ +LC ESKY+ Y+T+  IVPGK+NVHLVPH+HDDVGWLKTVDQYY
Sbjct  1    MSIIAFYSLTIYLAL-ILCVESKYIAYNTTGTIVPGKINVHLVPHSHDDVGWLKTVDQYY  59

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
             G NNSI+GACVQNVLDS+I AL  DKNRKFIYVE AFFQRWWR QS  M++ V+ LV S
Sbjct  60   FGGNNSIRGACVQNVLDSVISALFEDKNRKFIYVEMAFFQRWWRQQSETMKAKVKELVKS  119

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLEFINGG CMHDEA  HYID+IDQTTLGH++IK +F   PR+G
Sbjct  120  GQLEFINGGMCMHDEATPHYIDLIDQTTLGHRFIKNEFAQFPRVG  164



>ref|XP_006446930.1| hypothetical protein CICLE_v10017635mg, partial [Citrus clementina]
 gb|ESR60170.1| hypothetical protein CICLE_v10017635mg, partial [Citrus clementina]
Length=749

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = +2

Query  179  TLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGAC  358
            T+  GV+  +S+Y+ Y+T+A IVP K+NVHLVPH+HDDVGWLKTVDQYYVG+NNSI+GAC
Sbjct  12   TILAGVINGKSEYIAYNTTAGIVPDKINVHLVPHSHDDVGWLKTVDQYYVGANNSIRGAC  71

Query  359  VQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWC  538
            VQNVLDS+I AL  DKNRKFIYVE AFFQRWWR QS AM+  V+GLV+SGQLEFINGG C
Sbjct  72   VQNVLDSVISALFEDKNRKFIYVEMAFFQRWWRQQSKAMKVKVKGLVDSGQLEFINGGMC  131

Query  539  MHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            MHDEA+ HYIDMIDQTTLGH +IK  F   PR+G
Sbjct  132  MHDEASPHYIDMIDQTTLGHWFIKDSFGKLPRVG  165



>gb|EPS72042.1| alpha-mannosidase, partial [Genlisea aurea]
Length=953

 Score =   254 bits (650),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  VYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPALLA  400
            VY+TS  IVPGK+NVHLVPHTHDDVGWLKT+DQYYVG NNSIQGACVQNVLDS+IPALLA
Sbjct  1    VYNTSGRIVPGKINVHLVPHTHDDVGWLKTIDQYYVGLNNSIQGACVQNVLDSVIPALLA  60

Query  401  DKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDMID  580
            D+NR+FIYVEQAFFQRWWR+QS   +S V+GLV SG+LEFINGG CMHDEA THYIDMID
Sbjct  61   DRNRRFIYVEQAFFQRWWRDQSEETKSIVKGLVYSGRLEFINGGICMHDEATTHYIDMID  120

Query  581  QTTLGHQYIKQQFNVTPRIG  640
            QTTLGH+++K +F VTPRIG
Sbjct  121  QTTLGHRFLKDEFGVTPRIG  140



>ref|XP_003577518.1| PREDICTED: lysosomal alpha-mannosidase-like [Brachypodium distachyon]
Length=1011

 Score =   255 bits (651),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  185  AVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQ  364
            ++ +L AE+ Y+ Y+TSA +V GKLNVH+V HTHDDVGWLKTVDQYYVGSNNSIQ ACVQ
Sbjct  15   SMSLLGAEAAYIRYNTSAGVVKGKLNVHMVAHTHDDVGWLKTVDQYYVGSNNSIQDACVQ  74

Query  365  NVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMH  544
            NVLDS++PALL DKNRKFIYVEQAFFQRWWR QS  ++ TV+GLV+SGQLEF NGG CMH
Sbjct  75   NVLDSMVPALLKDKNRKFIYVEQAFFQRWWREQSDIIKDTVKGLVSSGQLEFTNGGMCMH  134

Query  545  DEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            DEAA HYIDMIDQTTLGH++IK++F   PRIG
Sbjct  135  DEAAVHYIDMIDQTTLGHRFIKEEFAQIPRIG  166



>ref|XP_003548858.1| PREDICTED: lysosomal alpha-mannosidase-like isoform 1 [Glycine 
max]
Length=1030

 Score =   254 bits (650),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  200  CAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  379
            C +SK++VY+TS  IVPGKLNVHLV HTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS
Sbjct  30   CGQSKFMVYNTSQGIVPGKLNVHLVAHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  89

Query  380  LIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAAT  559
            ++ ALLADKNRKFIYVE AFF+RWWR+QS A+Q  V+ LV+SGQLEFING   MHDEA T
Sbjct  90   MVHALLADKNRKFIYVEMAFFKRWWRDQSEAVQDVVKKLVSSGQLEFINGAMAMHDEAVT  149

Query  560  HYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HYIDMIDQT LGHQ++K++F VTPRIG
Sbjct  150  HYIDMIDQTALGHQFLKEEFGVTPRIG  176



>emb|CDX70531.1| BnaC03g06150D [Brassica napus]
Length=1020

 Score =   254 bits (649),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +2

Query  176  LTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGA  355
            L L +     ES+Y+VY+TS  +V GKLNVH+VPH+HDDVGWLKTVDQYYVGSNNSIQ A
Sbjct  12   LLLGIFFSTVESRYMVYNTSHTMVQGKLNVHVVPHSHDDVGWLKTVDQYYVGSNNSIQVA  71

Query  356  CVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGW  535
            CVQNVLDS++PALLADKNR+FIYVEQAFFQRWWR QS  +++ V GL+ SGQLE INGG 
Sbjct  72   CVQNVLDSIVPALLADKNRRFIYVEQAFFQRWWREQSEEIKTIVNGLIRSGQLEHINGGM  131

Query  536  CMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            CMHDEAA HYIDMIDQTTLGH++I ++FNVTPRIG
Sbjct  132  CMHDEAAPHYIDMIDQTTLGHRFIIREFNVTPRIG  166



>ref|XP_007161620.1| hypothetical protein PHAVU_001G084700g [Phaseolus vulgaris]
 gb|ESW33614.1| hypothetical protein PHAVU_001G084700g [Phaseolus vulgaris]
Length=1029

 Score =   254 bits (649),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  200  CAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  379
            C +SK++VY+TS  IVPGKLNVHLV HTHDDVGWLKTVDQYYVGSNNSIQGACV+NVLDS
Sbjct  29   CGQSKFMVYNTSQGIVPGKLNVHLVAHTHDDVGWLKTVDQYYVGSNNSIQGACVENVLDS  88

Query  380  LIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAAT  559
            ++ ALLADKNRKFIYVE AFF+RWWR+QS A+Q  V+ LV+SGQLEFING   MHDEA T
Sbjct  89   MVHALLADKNRKFIYVEMAFFKRWWRDQSEAVQDVVKKLVSSGQLEFINGAMSMHDEAVT  148

Query  560  HYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HYIDMIDQT LGHQ++K++F VTPRIG
Sbjct  149  HYIDMIDQTALGHQFLKEEFGVTPRIG  175



>ref|XP_007161616.1| hypothetical protein PHAVU_001G084400g [Phaseolus vulgaris]
 gb|ESW33610.1| hypothetical protein PHAVU_001G084400g [Phaseolus vulgaris]
Length=511

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  194  VLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVL  373
            +  AES+Y+ Y+T+  IVP K+NVHLVPH+HDDVGWLKTVDQYYVG+NNSI+GACVQNVL
Sbjct  15   IWVAESEYIEYNTTQRIVPDKINVHLVPHSHDDVGWLKTVDQYYVGANNSIRGACVQNVL  74

Query  374  DSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEA  553
            DS+I +LL DKNRKFIYVE AFFQRWWR QS AM+  V+ LVNSGQLEFINGG CMHDEA
Sbjct  75   DSVISSLLEDKNRKFIYVEMAFFQRWWRQQSKAMKIKVKELVNSGQLEFINGGMCMHDEA  134

Query  554  ATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
              HYID+IDQTTLGHQ+IK++F   PR+G
Sbjct  135  TPHYIDLIDQTTLGHQFIKEEFGKVPRVG  163



>gb|KCW48512.1| hypothetical protein EUGRSUZ_K02195 [Eucalyptus grandis]
Length=1013

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 134/147 (91%), Gaps = 3/147 (2%)
 Frame = +2

Query  200  CAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  379
            CA+SKY+ Y+T++ +VPGKLNVHLVPHTHDDVGW KTVDQYYVGSNN+IQGACVQN LDS
Sbjct  18   CAQSKYIAYNTTSRVVPGKLNVHLVPHTHDDVGWKKTVDQYYVGSNNTIQGACVQNELDS  77

Query  380  LIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAAT  559
            ++PALLA+K+RKFIY   AFFQRWWR+QS  +Q+TV+ LV+SGQLEFINGG CMHDEA T
Sbjct  78   IVPALLANKDRKFIY---AFFQRWWRDQSEQVQNTVKQLVSSGQLEFINGGMCMHDEATT  134

Query  560  HYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HYIDMIDQTTLGH++IK++F VTPRIG
Sbjct  135  HYIDMIDQTTLGHRFIKEEFGVTPRIG  161



>ref|XP_010942369.1| PREDICTED: alpha-mannosidase-like [Elaeis guineensis]
Length=1022

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 131/151 (87%), Gaps = 1/151 (1%)
 Frame = +2

Query  191  GVLC-AESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQN  367
            G+ C  ESKYV Y+T+  IVP KLNVHLV H+HDDVGWLKTVDQYYVGSNNSIQGACVQN
Sbjct  21   GICCQVESKYVAYNTTQRIVPDKLNVHLVAHSHDDVGWLKTVDQYYVGSNNSIQGACVQN  80

Query  368  VLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHD  547
            VLDS++ ALLADKNR+FIY E AFFQRWWR QS A++  V+ LV+SGQLEFINGG CMHD
Sbjct  81   VLDSMVTALLADKNRRFIYAEMAFFQRWWRQQSDAIKKMVKELVSSGQLEFINGGMCMHD  140

Query  548  EAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            EAA HYIDMIDQTTLGH++IKQ+F  TPRIG
Sbjct  141  EAAVHYIDMIDQTTLGHRFIKQEFGQTPRIG  171



>ref|XP_010682958.1| PREDICTED: alpha-mannosidase [Beta vulgaris subsp. vulgaris]
Length=1012

 Score =   253 bits (646),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +2

Query  200  CAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  379
             AES+Y+ Y+ SA IVPGK+NVHLVPHTHDDVGWLKT+DQYY G+NNSI+GACVQNVLDS
Sbjct  20   AAESEYIAYNNSAKIVPGKINVHLVPHTHDDVGWLKTIDQYYAGANNSIRGACVQNVLDS  79

Query  380  LIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAAT  559
            +I ALL D+NRKFIYVE AFFQRWWR QSP ++  V+ LV SGQLEFINGG CMHDEA T
Sbjct  80   VISALLEDENRKFIYVEMAFFQRWWRRQSPKLKVKVKELVKSGQLEFINGGMCMHDEATT  139

Query  560  HYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HYID+IDQTTLGH++IK +FN  PR+G
Sbjct  140  HYIDLIDQTTLGHRFIKSEFNQIPRVG  166



>emb|CDX78550.1| BnaA03g04620D [Brassica napus]
Length=1020

 Score =   253 bits (646),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +2

Query  176  LTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGA  355
            L L +     ES+Y+VY+TS  +V GKLNVH+VPH+HDDVGWLKTVDQYYVGSNNSIQ A
Sbjct  12   LLLGIFFSRVESRYMVYNTSHTMVQGKLNVHVVPHSHDDVGWLKTVDQYYVGSNNSIQVA  71

Query  356  CVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGW  535
            CVQNVLDS++PALLADKNR+FIYVEQAFFQRWW  QS  ++S V+GL+ SGQLE INGG 
Sbjct  72   CVQNVLDSIVPALLADKNRRFIYVEQAFFQRWWNEQSEEIKSIVKGLIRSGQLEHINGGM  131

Query  536  CMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            CMHDEAA HYIDMIDQTTLGH++I ++FNVTPRIG
Sbjct  132  CMHDEAAPHYIDMIDQTTLGHRFIIREFNVTPRIG  166



>gb|KHG00745.1| Lysosomal alpha-mannosidase [Gossypium arboreum]
Length=1022

 Score =   253 bits (645),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = +2

Query  167  FLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSI  346
              ++ LA GV  AES Y+ Y+T+  IVPGK+NVHLVPH+HDDVGWLKTVDQYY G NNSI
Sbjct  13   LFAILLARGVSSAESSYIEYNTTQRIVPGKINVHLVPHSHDDVGWLKTVDQYYFGGNNSI  72

Query  347  QGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFIN  526
            +GACVQNVLDS+I AL  DKNRKFIYVE AFFQRWWR QS A +  V+ LVNSGQLEFIN
Sbjct  73   RGACVQNVLDSVISALFDDKNRKFIYVEMAFFQRWWRQQSNAKKIKVKELVNSGQLEFIN  132

Query  527  GGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GG CMHDEA  HYID+IDQTTLGH+YIK +FN  PR+G
Sbjct  133  GGMCMHDEATPHYIDLIDQTTLGHKYIKDEFNQIPRVG  170



>gb|KJB33199.1| hypothetical protein B456_006G000300 [Gossypium raimondii]
Length=919

 Score =   251 bits (642),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = +2

Query  167  FLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSI  346
             +++ LA GV  AES Y+ Y+T+  IVPGK+NVHLVPH+HDDVGWLKTVDQYY G NNSI
Sbjct  13   LVAILLAGGVSSAESSYIEYNTTQRIVPGKINVHLVPHSHDDVGWLKTVDQYYFGGNNSI  72

Query  347  QGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFIN  526
            +GACVQNVLDS+I AL  DKNRKFIYVE AFFQRWWR QS A +  V+ LVNSGQLEFIN
Sbjct  73   RGACVQNVLDSVISALFDDKNRKFIYVEMAFFQRWWRQQSNAKKIKVKELVNSGQLEFIN  132

Query  527  GGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GG CMHDEA  HYID+IDQTTLGH+YIK +FN  PR+G
Sbjct  133  GGMCMHDEATPHYIDLIDQTTLGHKYIKDEFNQIPRVG  170



>ref|XP_009131373.1| PREDICTED: lysosomal alpha-mannosidase [Brassica rapa]
Length=1020

 Score =   252 bits (644),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 137/157 (87%), Gaps = 2/157 (1%)
 Frame = +2

Query  176  LTLAVGVLCA--ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQ  349
            + L +G+  +  ES+Y+VY+TS  +V GKLNVH+VPH+HDDVGWLKTVDQYYVGSNNSIQ
Sbjct  10   VVLLLGIFSSRVESRYMVYNTSHTMVQGKLNVHVVPHSHDDVGWLKTVDQYYVGSNNSIQ  69

Query  350  GACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFING  529
             ACVQNVLDS++PALLADKNR+FIYVEQAFFQRWW  QS  +++ V+GL+ SGQLE ING
Sbjct  70   VACVQNVLDSIVPALLADKNRRFIYVEQAFFQRWWNEQSEEIKTIVKGLIRSGQLEHING  129

Query  530  GWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            G CMHDEAA HYIDMIDQTTLGH++I ++FNVTPRIG
Sbjct  130  GMCMHDEAAPHYIDMIDQTTLGHRFIIREFNVTPRIG  166



>gb|KJB33197.1| hypothetical protein B456_006G000300 [Gossypium raimondii]
Length=1022

 Score =   252 bits (644),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = +2

Query  167  FLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSI  346
             +++ LA GV  AES Y+ Y+T+  IVPGK+NVHLVPH+HDDVGWLKTVDQYY G NNSI
Sbjct  13   LVAILLAGGVSSAESSYIEYNTTQRIVPGKINVHLVPHSHDDVGWLKTVDQYYFGGNNSI  72

Query  347  QGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFIN  526
            +GACVQNVLDS+I AL  DKNRKFIYVE AFFQRWWR QS A +  V+ LVNSGQLEFIN
Sbjct  73   RGACVQNVLDSVISALFDDKNRKFIYVEMAFFQRWWRQQSNAKKIKVKELVNSGQLEFIN  132

Query  527  GGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GG CMHDEA  HYID+IDQTTLGH+YIK +FN  PR+G
Sbjct  133  GGMCMHDEATPHYIDLIDQTTLGHKYIKDEFNQIPRVG  170



>ref|XP_004979371.1| PREDICTED: lysosomal alpha-mannosidase-like [Setaria italica]
Length=1016

 Score =   251 bits (642),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +2

Query  203  AESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  382
             E+ Y+ Y+TSA +V GKLNVH+VPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL
Sbjct  20   GEAVYIPYNTSAGVVAGKLNVHVVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  79

Query  383  IPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATH  562
            IPALL D+NRKF+YVEQAFFQRWWRNQ+  ++ TV+GL++SG+LE INGG CMHDEA  H
Sbjct  80   IPALLKDENRKFVYVEQAFFQRWWRNQNDMIKDTVKGLISSGRLELINGGMCMHDEATVH  139

Query  563  YIDMIDQTTLGHQYIKQQFNVTPRIG  640
            YIDMIDQTTLGH+++K++F   PRIG
Sbjct  140  YIDMIDQTTLGHKFVKEEFGQIPRIG  165



>ref|XP_006468893.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Citrus 
sinensis]
Length=1017

 Score =   251 bits (641),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = +2

Query  179  TLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGAC  358
            T+  GV+  +S+Y+ Y+T+A IVP K+NVHL+PH+HDDVGWLKTVDQYYVG+NNSI+GAC
Sbjct  12   TILAGVVNGKSEYIAYNTTAGIVPEKINVHLIPHSHDDVGWLKTVDQYYVGANNSIRGAC  71

Query  359  VQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWC  538
            VQNVLDS+I AL  DKNRKFIYVE AFFQRWWR QS AM+  V+GLV+SGQLEFINGG C
Sbjct  72   VQNVLDSVISALFEDKNRKFIYVEMAFFQRWWRQQSKAMKVKVKGLVDSGQLEFINGGMC  131

Query  539  MHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            MHDEA+ HYIDMIDQTTLGH +IK  F   PR+G
Sbjct  132  MHDEASPHYIDMIDQTTLGHWFIKDSFGKLPRVG  165



>ref|XP_006468894.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Citrus 
sinensis]
Length=1019

 Score =   251 bits (640),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = +2

Query  179  TLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGAC  358
            T+  GV+  +S+Y+ Y+T+A IVP K+NVHL+PH+HDDVGWLKTVDQYYVG+NNSI+GAC
Sbjct  12   TILAGVVNGKSEYIAYNTTAGIVPEKINVHLIPHSHDDVGWLKTVDQYYVGANNSIRGAC  71

Query  359  VQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWC  538
            VQNVLDS+I AL  DKNRKFIYVE AFFQRWWR QS AM+  V+GLV+SGQLEFINGG C
Sbjct  72   VQNVLDSVISALFEDKNRKFIYVEMAFFQRWWRQQSKAMKVKVKGLVDSGQLEFINGGMC  131

Query  539  MHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            MHDEA+ HYIDMIDQTTLGH +IK  F   PR+G
Sbjct  132  MHDEASPHYIDMIDQTTLGHWFIKDSFGKLPRVG  165



>ref|XP_002280858.1| PREDICTED: alpha-mannosidase [Vitis vinifera]
 emb|CBI15752.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score =   251 bits (640),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  200  CAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  379
            C +SK++ Y+TS  +VPGKLNVHLVPH+HDDVGWLKT+DQYYVGSNNSIQGACV+NVLDS
Sbjct  20   CGDSKFIAYNTSHGVVPGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNSIQGACVENVLDS  79

Query  380  LIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAAT  559
            L+ ALL++ +RKFIYVEQAFFQRWW +QS  +Q  VR  ++SGQLE INGG CMHDEA +
Sbjct  80   LVTALLSNPDRKFIYVEQAFFQRWWGDQSEIIQGLVRKFISSGQLELINGGMCMHDEATS  139

Query  560  HYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HYIDMIDQTTLGH++IK +FN+TPRIG
Sbjct  140  HYIDMIDQTTLGHRFIKNEFNLTPRIG  166



>ref|XP_010660681.1| PREDICTED: alpha-mannosidase [Vitis vinifera]
 emb|CBI21275.3| unnamed protein product [Vitis vinifera]
Length=1013

 Score =   251 bits (640),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 134/160 (84%), Gaps = 3/160 (2%)
 Frame = +2

Query  170  LSLTLAV---GVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNN  340
            +S+ LAV    V   ES Y+ Y+T+  IVPGK+NVHLVPH+HDDVGWLKTVDQYYVG+NN
Sbjct  3    ISMLLAVLLAAVSFGESSYIAYNTTGGIVPGKINVHLVPHSHDDVGWLKTVDQYYVGANN  62

Query  341  SIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEF  520
            SI+GACVQNV+DS+I ALL D+NRKFIYVE AFFQRWWR QS  +Q+ V+ LV SGQLEF
Sbjct  63   SIRGACVQNVIDSVISALLDDENRKFIYVEMAFFQRWWRQQSKKLQTRVKQLVKSGQLEF  122

Query  521  INGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            INGG CMHDEA THYID+IDQTTLGH+YIK +F  TPR+G
Sbjct  123  INGGMCMHDEATTHYIDLIDQTTLGHRYIKDEFGQTPRVG  162



>ref|XP_003577519.1| PREDICTED: lysosomal alpha-mannosidase-like [Brachypodium distachyon]
Length=1019

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +2

Query  203  AESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  382
            AE  Y+ Y+TSA +V GKLNVH+VPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL
Sbjct  23   AEGLYIPYNTSAGVVKGKLNVHVVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  82

Query  383  IPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATH  562
            +PALL D+NRKFIYVEQAFFQRWWR Q+  ++ T++GL++SG+LE INGG CMHDEA  H
Sbjct  83   VPALLKDENRKFIYVEQAFFQRWWRQQNDIIKDTIKGLLSSGRLELINGGMCMHDEATVH  142

Query  563  YIDMIDQTTLGHQYIKQQFNVTPRIG  640
            YIDMIDQTTLGH++IK++F + PRIG
Sbjct  143  YIDMIDQTTLGHRFIKEEFGLIPRIG  168



>ref|XP_002321075.2| glycosyl hydrolase family 38 family protein [Populus trichocarpa]
 gb|EEE99390.2| glycosyl hydrolase family 38 family protein [Populus trichocarpa]
Length=1009

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 129/149 (87%), Gaps = 3/149 (2%)
 Frame = +2

Query  194  VLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVL  373
            +   E+KY+VY+TS  IV  K+NVHLV HTHDDVGWLKTVDQYYVGSNNSIQGACVQNVL
Sbjct  18   LFVVEAKYMVYNTSQGIVKDKINVHLVAHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVL  77

Query  374  DSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEA  553
            DSLIPALLADKNRKFIY   AFFQRWWR+QS  MQ  V+ LV+SGQLEFINGG CMHDEA
Sbjct  78   DSLIPALLADKNRKFIY---AFFQRWWRDQSETMQHVVKQLVSSGQLEFINGGMCMHDEA  134

Query  554  ATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
             THYIDMIDQTTLGH++IK+ F VTPR+G
Sbjct  135  VTHYIDMIDQTTLGHRFIKKDFGVTPRVG  163



>ref|XP_002301760.2| glycosyl hydrolase family 38 family protein [Populus trichocarpa]
 gb|EEE81033.2| glycosyl hydrolase family 38 family protein [Populus trichocarpa]
Length=1020

 Score =   250 bits (638),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 135/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  149  AKVEFWFLSLTLAVGV-LCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            A +  W L++ L  G+ L  ESKY+ Y+T+ +IVPGK+NVHLVPH+HDDVGWLKTVDQYY
Sbjct  4    AGMLLWCLTIYLQGGLWLSVESKYIAYNTTGSIVPGKINVHLVPHSHDDVGWLKTVDQYY  63

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
             G NNSI+GACVQNV+DS++ +L  DKNRKFIYVE AFFQRWWR QS AM+  V+ LVNS
Sbjct  64   FGGNNSIRGACVQNVIDSVMSSLFEDKNRKFIYVEMAFFQRWWRQQSEAMKIKVKDLVNS  123

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLEFINGG CMHDEA  HYID+IDQTTLGH+YIK +F   PR+G
Sbjct  124  GQLEFINGGMCMHDEATPHYIDLIDQTTLGHKYIKDEFGQLPRVG  168



>ref|XP_008379047.1| PREDICTED: lysosomal alpha-mannosidase [Malus domestica]
Length=1021

 Score =   250 bits (638),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 137/162 (85%), Gaps = 2/162 (1%)
 Frame = +2

Query  161  FWFLSLT--LAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGS  334
            F F + T  L  G+  A+S+Y+ Y+T A IVPGK+NVHLVPH+HDDVGWLKTVDQY+VG+
Sbjct  9    FLFTAXTAVLLAGLPGAKSEYIAYNTXAGIVPGKINVHLVPHSHDDVGWLKTVDQYFVGA  68

Query  335  NNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQL  514
            NNSI+GACVQNVLDS+I ALL +KNRKFIYVE AFFQRWWR QSPA+++ V+ LV+SGQL
Sbjct  69   NNSIRGACVQNVLDSVISALLEEKNRKFIYVEIAFFQRWWRQQSPALKAKVKELVSSGQL  128

Query  515  EFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            EFINGG CMHDEA  HY+D+IDQTTLGHQ+I ++F   PRIG
Sbjct  129  EFINGGMCMHDEATPHYMDLIDQTTLGHQFILKEFGQVPRIG  170



>gb|AES80719.2| glycoside hydrolase family 38 amino-terminal domain protein [Medicago 
truncatula]
Length=1061

 Score =   249 bits (637),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 138/166 (83%), Gaps = 1/166 (1%)
 Frame = +2

Query  143  PMAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQY  322
            PM K +  F+   L       ESK++ Y+TS  +V GKLNVHLV HTHDDVGWLKTVDQY
Sbjct  45   PMEK-KLIFVVTLLGFLFYGGESKFIEYNTSQGVVSGKLNVHLVAHTHDDVGWLKTVDQY  103

Query  323  YVGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVN  502
            YVGSNNSIQGACVQNVLDS++ ALLADKNRKFIYVE AFFQRWW +QS A+++ V+ LV+
Sbjct  104  YVGSNNSIQGACVQNVLDSMVHALLADKNRKFIYVEIAFFQRWWDDQSEAVKNIVKQLVS  163

Query  503  SGQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            SGQLEFINGG CMHDEA  HYIDMIDQTTLGH+++K++F++TPRIG
Sbjct  164  SGQLEFINGGMCMHDEAVVHYIDMIDQTTLGHRFLKEEFDLTPRIG  209



>ref|XP_003624501.1| Lysosomal alpha-mannosidase [Medicago truncatula]
Length=1082

 Score =   249 bits (636),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 138/166 (83%), Gaps = 1/166 (1%)
 Frame = +2

Query  143  PMAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQY  322
            PM K +  F+   L       ESK++ Y+TS  +V GKLNVHLV HTHDDVGWLKTVDQY
Sbjct  45   PMEK-KLIFVVTLLGFLFYGGESKFIEYNTSQGVVSGKLNVHLVAHTHDDVGWLKTVDQY  103

Query  323  YVGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVN  502
            YVGSNNSIQGACVQNVLDS++ ALLADKNRKFIYVE AFFQRWW +QS A+++ V+ LV+
Sbjct  104  YVGSNNSIQGACVQNVLDSMVHALLADKNRKFIYVEIAFFQRWWDDQSEAVKNIVKQLVS  163

Query  503  SGQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            SGQLEFINGG CMHDEA  HYIDMIDQTTLGH+++K++F++TPRIG
Sbjct  164  SGQLEFINGGMCMHDEAVVHYIDMIDQTTLGHRFLKEEFDLTPRIG  209



>gb|KEH23493.1| glycoside hydrolase family 38 amino-terminal domain protein [Medicago 
truncatula]
Length=815

 Score =   247 bits (631),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  167  FLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSI  346
            F+   L       ESK++ Y+TS  +V GKLNVHLV HTHDDVGWLKTVDQYYVGSNNSI
Sbjct  7    FVVTLLGFLFYGGESKFIEYNTSQGVVSGKLNVHLVAHTHDDVGWLKTVDQYYVGSNNSI  66

Query  347  QGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFIN  526
            QGACVQNVLDS++ ALLADKNRKFIYVE AFFQRWW +QS A+++ V+ LV+SGQLEFIN
Sbjct  67   QGACVQNVLDSMVHALLADKNRKFIYVEIAFFQRWWDDQSEAVKNIVKQLVSSGQLEFIN  126

Query  527  GGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GG CMHDEA  HYIDMIDQTTLGH+++K++F++TPRIG
Sbjct  127  GGMCMHDEAVVHYIDMIDQTTLGHRFLKEEFDLTPRIG  164



>ref|XP_007214915.1| hypothetical protein PRUPE_ppa000707mg [Prunus persica]
 gb|EMJ16114.1| hypothetical protein PRUPE_ppa000707mg [Prunus persica]
Length=1027

 Score =   249 bits (635),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +2

Query  206  ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI  385
            +++Y+ Y+T+A IVPGK+NVHLVPH+HDDVGWLKTVDQYYVG+NNSI+GACVQNVLDS+I
Sbjct  31   KAEYIAYNTTAGIVPGKINVHLVPHSHDDVGWLKTVDQYYVGANNSIRGACVQNVLDSVI  90

Query  386  PALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHY  565
             ALL DKNRKFIYVE AFFQRWWR QSPA++  V+ LVNSGQLEFINGG CMHDEA  HY
Sbjct  91   SALLEDKNRKFIYVEIAFFQRWWRQQSPALKIKVKELVNSGQLEFINGGMCMHDEATPHY  150

Query  566  IDMIDQTTLGHQYIKQQFNVTPRIG  640
            ID+IDQTTLGHQ+I ++F   PR+G
Sbjct  151  IDLIDQTTLGHQFILKEFGKVPRVG  175



>ref|XP_008231240.1| PREDICTED: lysosomal alpha-mannosidase [Prunus mume]
Length=1023

 Score =   248 bits (634),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +2

Query  206  ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI  385
            +++Y+ Y+T+A IVPGK+NVHLVPH+HDDVGWLKTVDQYYVG+NNSI+GACVQNVLDS+I
Sbjct  27   KAEYIAYNTTAGIVPGKINVHLVPHSHDDVGWLKTVDQYYVGANNSIRGACVQNVLDSVI  86

Query  386  PALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHY  565
             ALL DKNRKFIYVE AFFQRWWR QSPA++  V+ LVNSGQLEFINGG CMHDEA  HY
Sbjct  87   SALLEDKNRKFIYVEIAFFQRWWRQQSPALKIKVKELVNSGQLEFINGGMCMHDEATPHY  146

Query  566  IDMIDQTTLGHQYIKQQFNVTPRIG  640
            ID+IDQTTLGHQ+I ++F   PR+G
Sbjct  147  IDLIDQTTLGHQFILKEFGKVPRVG  171



>ref|XP_003548841.1| PREDICTED: lysosomal alpha-mannosidase-like [Glycine max]
 gb|KHN08387.1| Lysosomal alpha-mannosidase [Glycine soja]
Length=1012

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = +2

Query  191  GVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNV  370
            G L   +KY+ Y+T A+IVPGKLNVHLVPH+HDDVGWLKT+DQYYVGSNNSIQGACV+NV
Sbjct  19   GKLIVSAKYMKYNTGASIVPGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNSIQGACVENV  78

Query  371  LDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDE  550
            LDS++ +L  D NRKF++ E AFF RWW  QSP  Q  VR LV++GQLEFINGGWCMHDE
Sbjct  79   LDSVVVSLQKDPNRKFVFAEMAFFHRWWVEQSPETQEQVRKLVDAGQLEFINGGWCMHDE  138

Query  551  AATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            AATHYIDMIDQTTLGH++IK QFN TP +G
Sbjct  139  AATHYIDMIDQTTLGHRFIKDQFNKTPTVG  168



>ref|XP_008791035.1| PREDICTED: lysosomal alpha-mannosidase [Phoenix dactylifera]
Length=1024

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +2

Query  206  ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI  385
            ES+Y+ Y+T+  IVP KLNVHLV HTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS++
Sbjct  28   ESEYIAYNTTQRIVPDKLNVHLVAHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSMV  87

Query  386  PALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHY  565
             ALLAD+NR+FIYVE AFFQRWWR Q+ A++  V+ LV+SGQLEFINGG CMHDEAA HY
Sbjct  88   TALLADENRRFIYVETAFFQRWWRQQNNAIKKIVKELVSSGQLEFINGGMCMHDEAAVHY  147

Query  566  IDMIDQTTLGHQYIKQQFNVTPRIG  640
            IDMIDQTTLGH++IKQ+F  TPRIG
Sbjct  148  IDMIDQTTLGHRFIKQEFGQTPRIG  172



>ref|XP_003553307.2| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Glycine 
max]
 gb|KHN28589.1| Lysosomal alpha-mannosidase [Glycine soja]
Length=1024

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  194  VLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVL  373
            +  AES+Y+ Y+T+  IVP KLNVHLVPH+HDDVGWLKTVDQYYVG+NNSI+GACVQNVL
Sbjct  17   IWVAESEYIEYNTTQRIVPDKLNVHLVPHSHDDVGWLKTVDQYYVGANNSIRGACVQNVL  76

Query  374  DSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEA  553
            DS+I ALL DKNRKFIYVE AFFQRWWR QS A +  V+ LVNSGQLEFINGG CMHDEA
Sbjct  77   DSVISALLEDKNRKFIYVEMAFFQRWWRQQSKATKIKVKELVNSGQLEFINGGMCMHDEA  136

Query  554  ATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
              HYID+IDQTTLGHQ+IK++F+  PR+G
Sbjct  137  TPHYIDLIDQTTLGHQFIKEEFDKVPRVG  165



>ref|XP_002512839.1| lysosomal alpha-mannosidase, putative [Ricinus communis]
 gb|EEF49342.1| lysosomal alpha-mannosidase, putative [Ricinus communis]
Length=1016

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = +2

Query  161  FWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNN  340
             +FL++ LA G+   ESKY+ Y+T+  +VPGK+NVHLVPH+HDDVGWLKTVDQYY G NN
Sbjct  7    LFFLTIYLA-GICFTESKYIDYNTTGRVVPGKINVHLVPHSHDDVGWLKTVDQYYFGGNN  65

Query  341  SIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEF  520
            +I+GACVQNVLDS+I +L  DKNRKFIYVE AFFQRWWR QS AM+  V+ LVNSGQLEF
Sbjct  66   TIRGACVQNVLDSVISSLFEDKNRKFIYVEMAFFQRWWRQQSDAMKVKVKELVNSGQLEF  125

Query  521  INGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            INGG CMHDEA  HYID+IDQTTLGH++IK +F   PR+G
Sbjct  126  INGGMCMHDEATPHYIDLIDQTTLGHKFIKDEFGQLPRVG  165



>ref|XP_010929675.1| PREDICTED: alpha-mannosidase [Elaeis guineensis]
Length=1024

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +2

Query  206  ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI  385
            ES Y+ Y+T+  IVP KLNVHLV HTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS++
Sbjct  28   ESNYIAYNTTQRIVPDKLNVHLVAHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSMV  87

Query  386  PALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHY  565
             ALLADKNR+FIYVE AFFQRWWR Q+ A++  V+ LV+SGQLEFINGG CMHDEAA HY
Sbjct  88   TALLADKNRRFIYVEMAFFQRWWRQQNDAIKKIVKELVSSGQLEFINGGMCMHDEAAVHY  147

Query  566  IDMIDQTTLGHQYIKQQFNVTPRIG  640
            IDMIDQTTLGH+++K++F  TPRIG
Sbjct  148  IDMIDQTTLGHRFVKKEFGQTPRIG  172



>ref|XP_003520192.1| PREDICTED: lysosomal alpha-mannosidase-like isoform 1 [Glycine 
max]
Length=1012

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +2

Query  170  LSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQ  349
            L L    G L   +KY+ Y+T A +VPGKLNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQ
Sbjct  12   LLLLYFYGTLLVSAKYIKYNTGAGVVPGKLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQ  71

Query  350  GACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFING  529
            GACV+NVLDS++ +L  D NRKF++VE AFF RWW  QSP  Q  V+ LV+ GQLEFING
Sbjct  72   GACVENVLDSVVVSLQKDPNRKFVFVEMAFFHRWWVEQSPETQEQVKKLVDEGQLEFING  131

Query  530  GWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GWCMHDEAATHYIDMIDQTTLGH++IK +FN TP +G
Sbjct  132  GWCMHDEAATHYIDMIDQTTLGHRFIKDRFNKTPTVG  168



>ref|XP_006665027.1| PREDICTED: lysosomal alpha-mannosidase-like, partial [Oryza brachyantha]
Length=1008

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  203  AESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  382
             E  YV Y+TSA +V GKLNVH+VPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL
Sbjct  11   GECVYVPYNTSAGVVKGKLNVHVVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  70

Query  383  IPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATH  562
            +PALL D+NRKFIYVEQAFFQRWWR Q+  ++  V+GL+++G+LE INGG CMHDEAA H
Sbjct  71   VPALLKDENRKFIYVEQAFFQRWWRQQNDMIKDIVKGLISTGRLELINGGMCMHDEAAVH  130

Query  563  YIDMIDQTTLGHQYIKQQFNVTPRIG  640
            YIDMIDQTTLGH++IK++F   PRIG
Sbjct  131  YIDMIDQTTLGHRFIKEEFGQVPRIG  156



>ref|XP_011024751.1| PREDICTED: alpha-mannosidase isoform X1 [Populus euphratica]
Length=1020

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 131/161 (81%), Gaps = 1/161 (1%)
 Frame = +2

Query  161  FWFLSLTLAVGV-LCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSN  337
             W L++ L  G  L  ESKY+ Y+T+  IVPGK+NVHLVPH+HDDVGWLKTVDQYY G N
Sbjct  8    LWCLTICLQGGRWLPVESKYIAYNTTGRIVPGKINVHLVPHSHDDVGWLKTVDQYYFGGN  67

Query  338  NSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLE  517
            NSI+GACVQNV+DS++ +L  DKNRKFIYVE AFFQRWWR QS AM+  V+ LVNSGQLE
Sbjct  68   NSIRGACVQNVIDSVMSSLFEDKNRKFIYVEMAFFQRWWRQQSEAMKIKVKDLVNSGQLE  127

Query  518  FINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            FINGG CMHDEA  HYID+IDQTTLGH+YIK +F   PR+G
Sbjct  128  FINGGMCMHDEATPHYIDLIDQTTLGHKYIKDEFGQLPRVG  168



>gb|KHN00464.1| Lysosomal alpha-mannosidase [Glycine soja]
Length=1012

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +2

Query  170  LSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQ  349
            L L    G L   +KY+ Y+T A +VPGKLNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQ
Sbjct  12   LLLLYFYGTLLVSAKYIKYNTGAGVVPGKLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQ  71

Query  350  GACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFING  529
            GACV+NVLDS++ +L  D NRKF++VE AFF RWW  QSP  Q  V+ LV+ GQLEFING
Sbjct  72   GACVENVLDSVVVSLQKDPNRKFVFVEMAFFYRWWVEQSPETQEQVKKLVDEGQLEFING  131

Query  530  GWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GWCMHDEAATHYIDMIDQTTLGH++IK +FN TP +G
Sbjct  132  GWCMHDEAATHYIDMIDQTTLGHRFIKDRFNKTPTVG  168



>gb|KHN46850.1| Lysosomal alpha-mannosidase [Glycine soja]
Length=1007

 Score =   246 bits (629),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +2

Query  218  VVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPALL  397
            +VY+TS  IVPGKLNVHLV HTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS++ ALL
Sbjct  1    MVYNTSQGIVPGKLNVHLVAHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSMVHALL  60

Query  398  ADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDMI  577
            ADKNRKFIYVE AFF+RWWR+QS A+Q  V+ LV+SGQLEFING   MHDEA THYIDMI
Sbjct  61   ADKNRKFIYVEMAFFKRWWRDQSEAVQDVVKKLVSSGQLEFINGAMAMHDEAVTHYIDMI  120

Query  578  DQTTLGHQYIKQQFNVTPRIG  640
            DQT LGHQ++K++F VTPRIG
Sbjct  121  DQTALGHQFLKEEFGVTPRIG  141



>ref|XP_004306319.1| PREDICTED: alpha-mannosidase [Fragaria vesca subsp. vesca]
Length=1015

 Score =   246 bits (628),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +2

Query  206  ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI  385
            +S+Y+ Y+T+A IVP KLNVHLVPH+HDDVGWLKTVDQYYVG+NNSI+GACVQNV+DS+I
Sbjct  19   QSEYIAYNTTAGIVPEKLNVHLVPHSHDDVGWLKTVDQYYVGANNSIRGACVQNVIDSVI  78

Query  386  PALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHY  565
             +LL DKNRKFIYVE AFFQRWWR QSPA++  V+ LV+SGQLEFINGG CMHDEA  HY
Sbjct  79   SSLLEDKNRKFIYVEIAFFQRWWRQQSPALKIKVKELVSSGQLEFINGGMCMHDEATAHY  138

Query  566  IDMIDQTTLGHQYIKQQFNVTPRIG  640
            ID+IDQTTLGHQ+I ++F  TPR+G
Sbjct  139  IDLIDQTTLGHQFILKEFGQTPRVG  163



>ref|NP_001067993.1| Os11g0525600 [Oryza sativa Japonica Group]
 gb|ABA94007.1| Glycosyl hydrolases family 38 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28356.1| Os11g0525600 [Oryza sativa Japonica Group]
 dbj|BAG90901.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52198.1| hypothetical protein OsJ_34079 [Oryza sativa Japonica Group]
Length=1020

 Score =   246 bits (627),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  200  CAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  379
              E  Y+ Y+TSA +V GKLNVH+VPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS
Sbjct  22   VGECVYIPYNTSAGVVGGKLNVHVVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  81

Query  380  LIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAAT  559
            L+PALL D+NRKF+YVEQAFFQRWWR QS  ++  V+GL+++G+LE INGG CMHDEA  
Sbjct  82   LVPALLKDENRKFVYVEQAFFQRWWRQQSDMIKDIVKGLISTGRLELINGGMCMHDEATV  141

Query  560  HYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HYIDMIDQTTLGH++IK++F   PRIG
Sbjct  142  HYIDMIDQTTLGHRFIKEEFGQIPRIG  168



>gb|EEC68272.1| hypothetical protein OsI_36309 [Oryza sativa Indica Group]
Length=1022

 Score =   246 bits (627),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  200  CAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  379
              E  Y+ Y+TSA +V GKLNVH+VPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS
Sbjct  24   VGECVYIPYNTSAGVVGGKLNVHVVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  83

Query  380  LIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAAT  559
            L+PALL D+NRKF+YVEQAFFQRWWR QS  ++  V+GL+++G+LE INGG CMHDEA  
Sbjct  84   LVPALLKDENRKFVYVEQAFFQRWWRQQSDMIKDIVKGLISTGRLELINGGMCMHDEATV  143

Query  560  HYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HYIDMIDQTTLGH++IK++F   PRIG
Sbjct  144  HYIDMIDQTTLGHRFIKEEFGQIPRIG  170



>gb|ABG22500.1| Glycosyl hydrolases family 38 protein, expressed [Oryza sativa 
Japonica Group]
Length=1018

 Score =   246 bits (627),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  200  CAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  379
              E  Y+ Y+TSA +V GKLNVH+VPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS
Sbjct  22   VGECVYIPYNTSAGVVGGKLNVHVVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  81

Query  380  LIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAAT  559
            L+PALL D+NRKF+YVEQAFFQRWWR QS  ++  V+GL+++G+LE INGG CMHDEA  
Sbjct  82   LVPALLKDENRKFVYVEQAFFQRWWRQQSDMIKDIVKGLISTGRLELINGGMCMHDEATV  141

Query  560  HYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HYIDMIDQTTLGH++IK++F   PRIG
Sbjct  142  HYIDMIDQTTLGHRFIKEEFGQIPRIG  168



>gb|AIX48008.1| LMann protein, partial [synthetic construct]
Length=987

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPA  391
            KY+ Y+T A+IVPGKLNVHLVPH+HDDVGWLKT+DQYYVGSNNSIQGACV+NVLDS++ +
Sbjct  1    KYMKYNTGASIVPGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNSIQGACVENVLDSVVVS  60

Query  392  LLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYID  571
            L  D NRKF++ E AFF RWW  QSP  Q  VR LV++GQLEFINGGWCMHDEAATHYID
Sbjct  61   LQKDPNRKFVFAEMAFFHRWWVEQSPETQEQVRKLVDAGQLEFINGGWCMHDEAATHYID  120

Query  572  MIDQTTLGHQYIKQQFNVTPRIG  640
            MIDQTTLGH++IK QFN TP +G
Sbjct  121  MIDQTTLGHRFIKDQFNKTPTVG  143



>gb|KCW53178.1| hypothetical protein EUGRSUZ_J02455 [Eucalyptus grandis]
Length=776

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            YV Y+TSAA+V GKLNVHLVPH+HDDVGWLKT+DQYYVGSNNSIQGACV+NVLDS++ AL
Sbjct  27   YVKYNTSAAVVEGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNSIQGACVENVLDSVVEAL  86

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
              D NRKFI+ E AFFQRWW  QSP  +  +R LVN+GQLEFINGGWCMHDEA THYIDM
Sbjct  87   SRDPNRKFIFAEMAFFQRWWLEQSPETKEQMRKLVNAGQLEFINGGWCMHDEATTHYIDM  146

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH  IK QFN  PR+G
Sbjct  147  IDQTTLGHGLIKSQFNKVPRVG  168



>ref|XP_004493076.1| PREDICTED: lysosomal alpha-mannosidase-like [Cicer arietinum]
Length=1023

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = +2

Query  167  FLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSI  346
             L + L   +  A+S+Y+ Y+T+  IVP K+NVHLVPH+HDDVGWLKTVDQYYVG+NNSI
Sbjct  7    LLFVVLVAAICAAKSEYIDYNTTHRIVPHKINVHLVPHSHDDVGWLKTVDQYYVGANNSI  66

Query  347  QGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFIN  526
            +GACVQNVLDS+I ALL D+NRKFIYVE AFFQRWWR QS A +  V+ LVNSGQLEFIN
Sbjct  67   RGACVQNVLDSVISALLEDQNRKFIYVEMAFFQRWWRQQSKAKKLKVKELVNSGQLEFIN  126

Query  527  GGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GG CMHDEA  HYID+IDQTTLGHQ+IK +F   PR+G
Sbjct  127  GGMCMHDEATPHYIDLIDQTTLGHQFIKDEFGKIPRVG  164



>ref|XP_010096026.1| Lysosomal alpha-mannosidase [Morus notabilis]
 gb|EXB62832.1| Lysosomal alpha-mannosidase [Morus notabilis]
Length=891

 Score =   243 bits (621),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +2

Query  203  AESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  382
             ES+Y+ Y+T+  IVPGK+NVHLVPH+HDDVGWLKTVDQYYVG+NNSI+GACVQNVLDS+
Sbjct  14   GESEYIEYNTTHRIVPGKINVHLVPHSHDDVGWLKTVDQYYVGANNSIRGACVQNVLDSV  73

Query  383  IPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATH  562
            I ALL DKNRKFIYVE AFFQRWWR QS A+++ V+ LVNSGQLEFINGG  MHDEA  H
Sbjct  74   ISALLEDKNRKFIYVEIAFFQRWWRQQSKALKAKVKELVNSGQLEFINGGMSMHDEATPH  133

Query  563  YIDMIDQTTLGHQYIKQQFNVTPRIG  640
            Y+D+IDQTTLGHQ+IK +F   PR+G
Sbjct  134  YVDLIDQTTLGHQFIKNEFGQIPRVG  159



>ref|XP_008646753.1| PREDICTED: lysosomal alpha-mannosidase-like [Zea mays]
Length=209

 Score =   227 bits (579),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +2

Query  236  AAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPALLADKNRK  415
            A +V GKLNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQGACV N LDS++ AL  D  RK
Sbjct  37   ATVVAGKLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQGACVMNTLDSVVDALARDPARK  96

Query  416  FIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDMIDQTTLG  595
            F+ VEQAFFQRWW  + P +Q+ VR LV+SGQLEFINGGWCMHDEAA HYIDMIDQTTLG
Sbjct  97   FVVVEQAFFQRWWAEKIPNIQAVVRKLVDSGQLEFINGGWCMHDEAAVHYIDMIDQTTLG  156

Query  596  HQYIKQQFNVTPRIG  640
            H+ IK+QFN TPR G
Sbjct  157  HRMIKKQFNKTPRAG  171



>gb|KCW53177.1| hypothetical protein EUGRSUZ_J02455 [Eucalyptus grandis]
Length=1010

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            YV Y+TSAA+V GKLNVHLVPH+HDDVGWLKT+DQYYVGSNNSIQGACV+NVLDS++ AL
Sbjct  27   YVKYNTSAAVVEGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNSIQGACVENVLDSVVEAL  86

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
              D NRKFI+ E AFFQRWW  QSP  +  +R LVN+GQLEFINGGWCMHDEA THYIDM
Sbjct  87   SRDPNRKFIFAEMAFFQRWWLEQSPETKEQMRKLVNAGQLEFINGGWCMHDEATTHYIDM  146

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH  IK QFN  PR+G
Sbjct  147  IDQTTLGHGLIKSQFNKVPRVG  168



>ref|XP_010033509.1| PREDICTED: lysosomal alpha-mannosidase-like [Eucalyptus grandis]
 gb|KCW53176.1| hypothetical protein EUGRSUZ_J02455 [Eucalyptus grandis]
Length=1011

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            YV Y+TSAA+V GKLNVHLVPH+HDDVGWLKT+DQYYVGSNNSIQGACV+NVLDS++ AL
Sbjct  27   YVKYNTSAAVVEGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNSIQGACVENVLDSVVEAL  86

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
              D NRKFI+ E AFFQRWW  QSP  +  +R LVN+GQLEFINGGWCMHDEA THYIDM
Sbjct  87   SRDPNRKFIFAEMAFFQRWWLEQSPETKEQMRKLVNAGQLEFINGGWCMHDEATTHYIDM  146

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH  IK QFN  PR+G
Sbjct  147  IDQTTLGHGLIKSQFNKVPRVG  168



>gb|KJB17632.1| hypothetical protein B456_003G008600 [Gossypium raimondii]
Length=1007

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +2

Query  203  AESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  382
            A + Y  YDT A IVPGKLNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS+
Sbjct  23   AGTVYAKYDTGARIVPGKLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSV  82

Query  383  IPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATH  562
            + ALL D NRKF++ E AFFQRWW  QS  +Q  V+ LV++G+LEF+NGGWCMHDEAATH
Sbjct  83   VDALLRDPNRKFVFAEMAFFQRWWTEQSSEIQEQVKELVDAGRLEFVNGGWCMHDEAATH  142

Query  563  YIDMIDQTTLGHQYIKQQFNVTPRIG  640
            YIDMIDQTTLGH+ IK+QFN  PR G
Sbjct  143  YIDMIDQTTLGHRAIKEQFNNVPRAG  168



>ref|XP_008788433.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Phoenix 
dactylifera]
Length=999

 Score =   243 bits (621),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            MA+    FL + LA+        Y+ Y+TSA IV GKLNVHLV H+HDDVGWLKTVDQYY
Sbjct  1    MARSAMAFLCIFLAISACYG--GYIRYNTSAGIVAGKLNVHLVAHSHDDVGWLKTVDQYY  58

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQGACV +VLDS++ ALL D NRKF++ EQAFFQRWWR+Q+   Q  VR LV+S
Sbjct  59   VGSNNSIQGACVMSVLDSVVDALLKDPNRKFVFAEQAFFQRWWRDQNEQTQEVVRKLVDS  118

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLEFINGGWCMHDEA  HY+DMIDQTTLGH+ IK+QFN  PR+G
Sbjct  119  GQLEFINGGWCMHDEATVHYVDMIDQTTLGHRMIKKQFNKVPRVG  163



>gb|KJB17633.1| hypothetical protein B456_003G008600 [Gossypium raimondii]
Length=915

 Score =   243 bits (620),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +2

Query  203  AESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  382
            A + Y  YDT A IVPGKLNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS+
Sbjct  23   AGTVYAKYDTGARIVPGKLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSV  82

Query  383  IPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATH  562
            + ALL D NRKF++ E AFFQRWW  QS  +Q  V+ LV++G+LEF+NGGWCMHDEAATH
Sbjct  83   VDALLRDPNRKFVFAEMAFFQRWWTEQSSEIQEQVKELVDAGRLEFVNGGWCMHDEAATH  142

Query  563  YIDMIDQTTLGHQYIKQQFNVTPRIG  640
            YIDMIDQTTLGH+ IK+QFN  PR G
Sbjct  143  YIDMIDQTTLGHRAIKEQFNNVPRAG  168



>ref|XP_008788432.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Phoenix 
dactylifera]
Length=1000

 Score =   243 bits (621),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            MA+    FL + LA+        Y+ Y+TSA IV GKLNVHLV H+HDDVGWLKTVDQYY
Sbjct  1    MARSAMAFLCIFLAISACYG--GYIRYNTSAGIVAGKLNVHLVAHSHDDVGWLKTVDQYY  58

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQGACV +VLDS++ ALL D NRKF++ EQAFFQRWWR+Q+   Q  VR LV+S
Sbjct  59   VGSNNSIQGACVMSVLDSVVDALLKDPNRKFVFAEQAFFQRWWRDQNEQTQEVVRKLVDS  118

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLEFINGGWCMHDEA  HY+DMIDQTTLGH+ IK+QFN  PR+G
Sbjct  119  GQLEFINGGWCMHDEATVHYVDMIDQTTLGHRMIKKQFNKVPRVG  163



>gb|KHG14504.1| Lysosomal alpha-mannosidase [Gossypium arboreum]
Length=1007

 Score =   243 bits (621),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +2

Query  203  AESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  382
            A + Y  YDT A IVPGKLNVHLVPH+HDDVGWLKT+DQYYVGSNNSIQGACVQNVLDS+
Sbjct  23   AGTVYAKYDTGARIVPGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNSIQGACVQNVLDSV  82

Query  383  IPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATH  562
            + ALL D NRKF++ E AFFQRWW  QS  +Q  V+ LV++G+LEF+NGGWCMHDEAATH
Sbjct  83   VDALLRDPNRKFVFAEMAFFQRWWTEQSSEIQEQVKELVDAGRLEFVNGGWCMHDEAATH  142

Query  563  YIDMIDQTTLGHQYIKQQFNVTPRIG  640
            YIDMIDQTTLGH+ IK+QFN  PR G
Sbjct  143  YIDMIDQTTLGHRAIKEQFNNVPRAG  168



>ref|XP_007032026.1| Glycosyl hydrolase family 38 protein [Theobroma cacao]
 gb|EOY02952.1| Glycosyl hydrolase family 38 protein [Theobroma cacao]
Length=1015

 Score =   243 bits (621),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = +2

Query  167  FLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSI  346
              ++ LA  V  A+S Y+ Y+T+  I+PGK+NVHLVPH+HDDVGWLKTVDQYY G NNSI
Sbjct  6    LFAILLAGVVNSAKSSYIEYNTTQRIIPGKINVHLVPHSHDDVGWLKTVDQYYFGGNNSI  65

Query  347  QGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFIN  526
            +GACVQNVLDS+I ALL DKNRKFIYVE AFFQRWWR QS A +  V+ LV+SGQLEFIN
Sbjct  66   RGACVQNVLDSVISALLEDKNRKFIYVEMAFFQRWWRQQSNAKKIKVKELVDSGQLEFIN  125

Query  527  GGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GG CMHDEA  HYID+IDQTTLGH+YIK +F   PR+G
Sbjct  126  GGMCMHDEATPHYIDLIDQTTLGHKYIKDEFGQIPRVG  163



>ref|XP_010920132.1| PREDICTED: alpha-mannosidase-like [Elaeis guineensis]
Length=999

 Score =   243 bits (620),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            MA++   FL + +A+        Y+ Y+TSA IV GKLNVHLV H+HDDVGWLKT+DQYY
Sbjct  1    MARLAVAFLCILMAIS--ACNGGYIRYNTSAGIVAGKLNVHLVAHSHDDVGWLKTIDQYY  58

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQGACV NVLDS++ AL+ D NRKFI+ EQAFFQRWWR Q+   Q  VR LV+S
Sbjct  59   VGSNNSIQGACVMNVLDSVVHALMKDPNRKFIFAEQAFFQRWWREQNEQTQGVVRKLVDS  118

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLEF+NGGWCMHDEA  HYIDMIDQTTLGH  IK+QFN  PR+G
Sbjct  119  GQLEFVNGGWCMHDEATVHYIDMIDQTTLGHGMIKKQFNKVPRVG  163



>gb|KCW53175.1| hypothetical protein EUGRSUZ_J02454 [Eucalyptus grandis]
Length=1008

 Score =   243 bits (620),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 128/164 (78%), Gaps = 2/164 (1%)
 Frame = +2

Query  155  VEFWFLSLTLAVGVLCA--ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYV  328
            V  WF  + L +  L    +  YV Y+T A +V GKLNVHLVPH+H+DVGWLKT+DQYYV
Sbjct  5    VACWFAVVILVIVGLYGGVDGAYVKYNTCAGVVEGKLNVHLVPHSHNDVGWLKTIDQYYV  64

Query  329  GSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSG  508
            GSNNSIQGACV+NVLDS+I AL  D NRKF++ E AFFQRWW  QSP MQ  VR LVN+G
Sbjct  65   GSNNSIQGACVENVLDSVIEALARDPNRKFVFAEMAFFQRWWLEQSPEMQELVRKLVNAG  124

Query  509  QLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            QLEFINGGWCMHDEA THYIDMIDQTTLGH  IK +FN  PR+G
Sbjct  125  QLEFINGGWCMHDEATTHYIDMIDQTTLGHGLIKSEFNKVPRVG  168



>ref|XP_010034699.1| PREDICTED: lysosomal alpha-mannosidase-like [Eucalyptus grandis]
Length=1011

 Score =   243 bits (619),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 128/164 (78%), Gaps = 2/164 (1%)
 Frame = +2

Query  155  VEFWFLSLTLAVGVLCA--ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYV  328
            V  WF  + L +  L    +  YV Y+T A +V GKLNVHLVPH+H+DVGWLKT+DQYYV
Sbjct  5    VACWFAVVILVIVGLYGGVDGAYVKYNTCAGVVEGKLNVHLVPHSHNDVGWLKTIDQYYV  64

Query  329  GSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSG  508
            GSNNSIQGACV+NVLDS+I AL  D NRKF++ E AFFQRWW  QSP MQ  VR LVN+G
Sbjct  65   GSNNSIQGACVENVLDSVIEALARDPNRKFVFAEMAFFQRWWLEQSPEMQELVRKLVNAG  124

Query  509  QLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            QLEFINGGWCMHDEA THYIDMIDQTTLGH  IK +FN  PR+G
Sbjct  125  QLEFINGGWCMHDEATTHYIDMIDQTTLGHGLIKSEFNKVPRVG  168



>ref|XP_007156173.1| hypothetical protein PHAVU_003G264400g [Phaseolus vulgaris]
 gb|ESW28167.1| hypothetical protein PHAVU_003G264400g [Phaseolus vulgaris]
Length=1012

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +2

Query  176  LTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGA  355
            L L+       +KY+ Y+T AAIVP KLNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQGA
Sbjct  14   LLLSFYATLVSTKYINYNTGAAIVPAKLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQGA  73

Query  356  CVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGW  535
            CV+NVLDS++ +L  D NRKF++ E AFF RWW  QSP  Q  VR LV++GQLE INGGW
Sbjct  74   CVENVLDSVVVSLQKDPNRKFVFAEMAFFHRWWVEQSPETQEEVRKLVDAGQLEIINGGW  133

Query  536  CMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            CMHDEAATHYIDMIDQTTLGH++IK +FN TP +G
Sbjct  134  CMHDEAATHYIDMIDQTTLGHRFIKDEFNKTPTVG  168



>ref|XP_004232502.1| PREDICTED: lysosomal alpha-mannosidase [Solanum lycopersicum]
Length=1009

 Score =   241 bits (615),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 131/168 (78%), Gaps = 1/168 (1%)
 Frame = +2

Query  137  LQPMAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVD  316
            + P +   F F S     G + A ++Y+ Y+T   IV  KLNVHLVPH+HDDVGWLKTVD
Sbjct  5    VNPASVFLFIFCSTVCVYGAIGA-NRYLKYNTGGNIVESKLNVHLVPHSHDDVGWLKTVD  63

Query  317  QYYVGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGL  496
            QYYVGSNNSIQGACV+NVLDS++ +L  D+NRKF++ E AFF RWW  QSP +Q+ V+ L
Sbjct  64   QYYVGSNNSIQGACVENVLDSVVMSLRRDRNRKFVFAEMAFFHRWWIRQSPEIQAEVKNL  123

Query  497  VNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            V SGQLEF+NGGWCMHDEA THYIDMIDQTTLGHQ IK +FN+TPR G
Sbjct  124  VASGQLEFVNGGWCMHDEATTHYIDMIDQTTLGHQLIKNEFNITPRAG  171



>ref|XP_007157901.1| hypothetical protein PHAVU_002G1073000g, partial [Phaseolus vulgaris]
 gb|ESW29895.1| hypothetical protein PHAVU_002G1073000g, partial [Phaseolus vulgaris]
Length=692

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 130/160 (81%), Gaps = 5/160 (3%)
 Frame = +2

Query  161  FWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNN  340
            F FL L L   V+C     V Y+T A+IVPGKLNVHLV H+HDDVGWLKTVDQYYVGSNN
Sbjct  13   FVFLLLCLCGSVVC-----VKYNTGASIVPGKLNVHLVAHSHDDVGWLKTVDQYYVGSNN  67

Query  341  SIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEF  520
            +IQGACV+NVLDS++ +L  D+NRKF++ E AFF RWW  Q+P +Q+ V  LVN+GQLEF
Sbjct  68   NIQGACVENVLDSVVMSLQRDQNRKFVFAEMAFFSRWWVEQTPQIQAQVTKLVNAGQLEF  127

Query  521  INGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            +NGGWCMHDEAATHY+DMIDQTTLGH++IK QFN  PR G
Sbjct  128  VNGGWCMHDEAATHYVDMIDQTTLGHRFIKNQFNKVPRAG  167



>gb|KCW53184.1| hypothetical protein EUGRSUZ_J02460 [Eucalyptus grandis]
Length=991

 Score =   240 bits (613),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +2

Query  206  ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI  385
            +  YV Y+T A +V GKLNVHLVPH+HDDVGWLKT+DQYYVGSNNSIQGAC++NVLDS+I
Sbjct  24   DGAYVKYNTVAGVVEGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNSIQGACIENVLDSVI  83

Query  386  PALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHY  565
             AL  D NRKF++ E AFFQRWW  QSP  Q  VR LVN+GQ EFINGGWCMHDEA THY
Sbjct  84   KALARDPNRKFVFAEMAFFQRWWLEQSPETQEQVRKLVNAGQFEFINGGWCMHDEATTHY  143

Query  566  IDMIDQTTLGHQYIKQQFNVTPRIG  640
            IDMIDQTTLGH  IK QFN  PR+G
Sbjct  144  IDMIDQTTLGHGLIKSQFNKVPRVG  168



>ref|XP_010920133.1| PREDICTED: alpha-mannosidase-like [Elaeis guineensis]
Length=999

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            MA++   FL + +A+        Y+ Y+TSA IV GKLNVHLV H+HDDVGWLKT+DQYY
Sbjct  1    MARLAVAFLCILMAIS--ACNGGYIRYNTSAGIVAGKLNVHLVAHSHDDVGWLKTIDQYY  58

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQGACV NVLDS++ ALL   NRKFI+ EQAFFQRWWR Q+   Q  V  LV+S
Sbjct  59   VGSNNSIQGACVMNVLDSVVDALLKGPNRKFIFAEQAFFQRWWREQNEQTQEVVGKLVDS  118

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLEF+NGGWCMHDEA  HYIDMIDQTTLGH+ IK+QFN  PR+G
Sbjct  119  GQLEFVNGGWCMHDEATAHYIDMIDQTTLGHRTIKKQFNKVPRVG  163



>emb|CDP01879.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +2

Query  209  SKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIP  388
            S Y+ Y+T   IV GKLNVHLVPH+HDDVGWLKT+DQYYVGSNNSIQGACV+NVLDS+I 
Sbjct  27   SGYMKYNTGGGIVGGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNSIQGACVENVLDSVIT  86

Query  389  ALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYI  568
            +L  D NRKF+YVE AFF RWW  QS  ++  VR LV+SGQLEFINGGWCMHDEAATHYI
Sbjct  87   SLGRDPNRKFVYVEMAFFSRWWETQSSEIKQQVRRLVDSGQLEFINGGWCMHDEAATHYI  146

Query  569  DMIDQTTLGHQYIKQQFNVTPRIG  640
            DMIDQTTLGHQ IK QFN TPR G
Sbjct  147  DMIDQTTLGHQLIKSQFNKTPRAG  170



>ref|XP_010066409.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal alpha-mannosidase-like 
[Eucalyptus grandis]
Length=1032

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 127/149 (85%), Gaps = 5/149 (3%)
 Frame = +2

Query  209  SKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIP  388
            S +V Y+TSA I PGKLNVHLVPH+HDDVGWLKTVDQY+VG+NNSI+GACVQNVLDS+I 
Sbjct  34   STHVAYNTSAGIAPGKLNVHLVPHSHDDVGWLKTVDQYFVGANNSIRGACVQNVLDSVIS  93

Query  389  ALLA-----DKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEA  553
            ALL      DKNRKFIYVE AFFQRWWR QS AM+  V+ LV+SG+LEFINGG CMHDEA
Sbjct  94   ALLXXESQDDKNRKFIYVEMAFFQRWWRQQSEAMRIKVKELVDSGRLEFINGGMCMHDEA  153

Query  554  ATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            + HYID+IDQTTLGH YIK++FN  PR+G
Sbjct  154  SPHYIDLIDQTTLGHWYIKKEFNQVPRVG  182



>ref|XP_010040832.1| PREDICTED: lysosomal alpha-mannosidase-like [Eucalyptus grandis]
 gb|KCW44882.1| hypothetical protein EUGRSUZ_L01536 [Eucalyptus grandis]
Length=588

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +2

Query  206  ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI  385
            +  YV Y+T A +V GKLNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQGAC++NVLDS++
Sbjct  24   DGAYVKYNTGARVVEGKLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQGACIENVLDSVV  83

Query  386  PALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHY  565
             AL  D NRKF++ E AFFQRWW  QSP  Q  VR LV++GQ EFINGGWCMHDEA  HY
Sbjct  84   KALARDPNRKFVFAEMAFFQRWWLEQSPETQEQVRKLVDAGQFEFINGGWCMHDEATAHY  143

Query  566  IDMIDQTTLGHQYIKQQFNVTPRIG  640
            IDMIDQTTLGH  IK QF+  PR+G
Sbjct  144  IDMIDQTTLGHGLIKSQFDKVPRVG  168



>ref|XP_006380603.1| hypothetical protein POPTR_0007s09730g [Populus trichocarpa]
 gb|ERP58400.1| hypothetical protein POPTR_0007s09730g [Populus trichocarpa]
Length=1011

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            YV Y+T   +VPGKLNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQGACV+NVLDS++ +L
Sbjct  34   YVDYNTGGGVVPGKLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQGACVENVLDSVVESL  93

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
              D NRKF++VE AFFQRWW  QS  +Q  VR LV++GQLEF+NGGWCMHDEA  HYIDM
Sbjct  94   RRDSNRKFVFVEMAFFQRWWVEQSEEIQEQVRKLVDAGQLEFVNGGWCMHDEATCHYIDM  153

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH+ IK+QFN TPR G
Sbjct  154  IDQTTLGHRAIKEQFNKTPRAG  175



>ref|XP_006340752.1| PREDICTED: lysosomal alpha-mannosidase-like [Solanum tuberosum]
Length=1008

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 126/160 (79%), Gaps = 1/160 (1%)
 Frame = +2

Query  161  FWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNN  340
            F F S   A G +     Y+ Y+T   IV  KLNVHLVPH+HDDVGWLKT+DQYYVGSNN
Sbjct  13   FIFYSTVCAYGAIGVNG-YLKYNTGGNIVESKLNVHLVPHSHDDVGWLKTIDQYYVGSNN  71

Query  341  SIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEF  520
            SIQGACV+NVLDS++ +L  D+NRKF++ E AFF RWW  QSP +Q+ VR LV SGQLEF
Sbjct  72   SIQGACVENVLDSVVMSLRRDRNRKFVFAEMAFFHRWWIRQSPEIQAEVRNLVASGQLEF  131

Query  521  INGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            +NGGWCMHDEA THYIDMIDQTTLGHQ IK +FN+TPR G
Sbjct  132  VNGGWCMHDEATTHYIDMIDQTTLGHQLIKNEFNITPRAG  171



>ref|XP_009379378.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Pyrus 
x bretschneideri]
Length=1016

 Score =   238 bits (608),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 124/153 (81%), Gaps = 3/153 (2%)
 Frame = +2

Query  191  GVLCAES---KYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACV  361
            G LC E+    YV Y+T + +V GKLNVHLV H+HDDVGWLKTVDQYYVGSNNSIQGACV
Sbjct  20   GCLCREAVGGGYVKYETGSGVVEGKLNVHLVAHSHDDVGWLKTVDQYYVGSNNSIQGACV  79

Query  362  QNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCM  541
            +N LDS++ +L  D NRKF++ E AFFQRWW  QSP +Q+ VR LV+ GQLEF+NGGWCM
Sbjct  80   ENTLDSVVESLARDPNRKFVFAEMAFFQRWWLTQSPEIQALVRKLVDDGQLEFVNGGWCM  139

Query  542  HDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HDEA THYIDMIDQTTLGH+ IK QFN TPR G
Sbjct  140  HDEATTHYIDMIDQTTLGHRAIKAQFNKTPRAG  172



>ref|XP_009379379.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Pyrus 
x bretschneideri]
Length=1014

 Score =   238 bits (608),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 124/153 (81%), Gaps = 3/153 (2%)
 Frame = +2

Query  191  GVLCAES---KYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACV  361
            G LC E+    YV Y+T + +V GKLNVHLV H+HDDVGWLKTVDQYYVGSNNSIQGACV
Sbjct  20   GCLCREAVGGGYVKYETGSGVVEGKLNVHLVAHSHDDVGWLKTVDQYYVGSNNSIQGACV  79

Query  362  QNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCM  541
            +N LDS++ +L  D NRKF++ E AFFQRWW  QSP +Q+ VR LV+ GQLEF+NGGWCM
Sbjct  80   ENTLDSVVESLARDPNRKFVFAEMAFFQRWWLTQSPEIQALVRKLVDDGQLEFVNGGWCM  139

Query  542  HDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HDEA THYIDMIDQTTLGH+ IK QFN TPR G
Sbjct  140  HDEATTHYIDMIDQTTLGHRAIKAQFNKTPRAG  172



>ref|XP_008354624.1| PREDICTED: lysosomal alpha-mannosidase-like [Malus domestica]
Length=1016

 Score =   238 bits (608),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 126/153 (82%), Gaps = 3/153 (2%)
 Frame = +2

Query  191  GVLCAES---KYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACV  361
            G LC E+    +V Y+T + +V GKLNVHLV H+HDDVGWLKTVDQYYVGSNNSIQGACV
Sbjct  20   GCLCREAVGGGFVKYETGSGVVEGKLNVHLVAHSHDDVGWLKTVDQYYVGSNNSIQGACV  79

Query  362  QNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCM  541
            +N LDS++ +L+ D NRKF++ E AFFQRWW  QSP +Q+ VR LV++GQLEF+NGGWCM
Sbjct  80   ENTLDSVVESLVRDPNRKFVFAEMAFFQRWWLTQSPXIQALVRKLVDAGQLEFVNGGWCM  139

Query  542  HDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HDEA THYIDMIDQTTLGH+ IK QFN TPR G
Sbjct  140  HDEATTHYIDMIDQTTLGHRAIKAQFNKTPRAG  172



>ref|XP_003624502.1| Lysosomal alpha-mannosidase [Medicago truncatula]
 gb|AES80720.1| glycoside hydrolase family 38 amino-terminal domain protein [Medicago 
truncatula]
Length=1022

 Score =   238 bits (608),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 127/156 (81%), Gaps = 1/156 (1%)
 Frame = +2

Query  176  LTLAVGVL-CAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQG  352
             T+ V V+    S+Y+ Y+ +  I+P K+NVHLVPH+HDDVGWLKTVDQYYVGSNNSI+G
Sbjct  9    FTVLVAVIHVVNSEYIEYNITQRIIPDKINVHLVPHSHDDVGWLKTVDQYYVGSNNSIRG  68

Query  353  ACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGG  532
            ACVQNVLDS+I +LL D NRKFIYVE AFFQRWWR QS A +  V+ LVNSGQLEFINGG
Sbjct  69   ACVQNVLDSVISSLLEDPNRKFIYVEMAFFQRWWRQQSKAKKLKVKDLVNSGQLEFINGG  128

Query  533  WCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
             CMHDEA  HYID+IDQTTLGHQ+IK +F   PR+G
Sbjct  129  MCMHDEATPHYIDLIDQTTLGHQFIKDEFGKNPRVG  164



>ref|XP_008242061.1| PREDICTED: lysosomal alpha-mannosidase [Prunus mume]
Length=1013

 Score =   238 bits (607),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 131/173 (76%), Gaps = 9/173 (5%)
 Frame = +2

Query  146  MAKVE-----FWFLSLTLAVGVLCAE---SKYVVYDTSAAIVPGKLNVHLVPHTHDDVGW  301
            M KVE     F FL + +AV  LC E   S YV Y T   +V GKLNVHLV H+HDDVGW
Sbjct  1    MRKVETLASGFQFLLVFVAV-CLCKEAVGSGYVRYKTGGGVVEGKLNVHLVAHSHDDVGW  59

Query  302  LKTVDQYYVGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQS  481
            LKT+DQYYVGSNNSIQGACV+N LDS+I +L+ D NRKF++ E AFFQRWW  Q   +Q 
Sbjct  60   LKTIDQYYVGSNNSIQGACVENTLDSVIESLVRDPNRKFVFAEMAFFQRWWSTQRAGIQE  119

Query  482  TVRGLVNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
             VR LV++GQLEF+NGGWCMHDEA  HYIDMIDQTTLGH+ IKQQFN TPR G
Sbjct  120  IVRKLVDAGQLEFVNGGWCMHDEATVHYIDMIDQTTLGHRAIKQQFNKTPRAG  172



>ref|XP_011098969.1| PREDICTED: alpha-mannosidase [Sesamum indicum]
Length=1019

 Score =   238 bits (606),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 130/161 (81%), Gaps = 3/161 (2%)
 Frame = +2

Query  167  FLSLTLAVGVLCA---ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSN  337
            FL   +A G+  A    S Y+ Y+T++AI P K+NVHLVPH+HDDVGWLKTVDQYYVG+N
Sbjct  8    FLFRIVAAGICFATHLHSTYIPYNTTSAIAPSKINVHLVPHSHDDVGWLKTVDQYYVGAN  67

Query  338  NSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLE  517
            NSI+GACVQNVLDS+I ALL D NR+FIYVE AFFQRWWR QS  +++ V+ LVNSGQLE
Sbjct  68   NSIRGACVQNVLDSVISALLDDNNRRFIYVEMAFFQRWWRQQSDTLKAKVKHLVNSGQLE  127

Query  518  FINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            FINGG CMHDEA  HYID+IDQTTLGH++I  +F   PR+G
Sbjct  128  FINGGMCMHDEATPHYIDLIDQTTLGHRFILDEFGKKPRVG  168



>gb|KFK28275.1| hypothetical protein AALP_AA8G495400 [Arabis alpina]
Length=1035

 Score =   238 bits (606),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            YV Y T   +VPGKLNVHLVPH+HDDVGWLKTVDQY++GSNNSIQ ACV+NVLDS++ +L
Sbjct  37   YVKYGTEGRVVPGKLNVHLVPHSHDDVGWLKTVDQYFIGSNNSIQSACVRNVLDSVVDSL  96

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
              D NRKF++ E AFF RWW  QSP +Q  V+GLV SGQLEF+NGGW MHDEAA+HYIDM
Sbjct  97   RRDPNRKFVFAEMAFFTRWWEEQSPQIQEQVKGLVKSGQLEFVNGGWSMHDEAASHYIDM  156

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTT+GH++IKQ FN+TPR G
Sbjct  157  IDQTTMGHRFIKQNFNITPRAG  178



>ref|XP_008440841.1| PREDICTED: lysosomal alpha-mannosidase [Cucumis melo]
Length=1007

 Score =   237 bits (605),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = +2

Query  155  VEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGS  334
            + F FL L L    +  +  +V YDT   +V GKLNVHLV H+HDDVGWLKT+DQYYVGS
Sbjct  9    LPFSFLVLVLIFFCVEVDCNFVNYDTGGGVVDGKLNVHLVAHSHDDVGWLKTIDQYYVGS  68

Query  335  NNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQL  514
            NNSIQGACVQNVLDS++ +LL D NRKF++ E AFFQRWW  Q+P +Q  VR LV  GQL
Sbjct  69   NNSIQGACVQNVLDSVVDSLLRDSNRKFVFAEMAFFQRWWSQQNPTVQKRVRELVEDGQL  128

Query  515  EFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            EFINGGWCMHDEA +HYIDMIDQTTLGH  IK++FN  PR G
Sbjct  129  EFINGGWCMHDEATSHYIDMIDQTTLGHSVIKEEFNKVPRAG  170



>ref|XP_003629280.1| Lysosomal alpha-mannosidase [Medicago truncatula]
 gb|AET03756.1| glycoside hydrolase family 38 protein [Medicago truncatula]
Length=1018

 Score =   237 bits (605),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 124/158 (78%), Gaps = 2/158 (1%)
 Frame = +2

Query  167  FLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSI  346
            FL L    G +   S Y  Y+T A IV GKLNVHLVPH+HDDVGWLKTVDQYYVGSNNSI
Sbjct  17   FLLLICYYGTIV--SAYTKYNTGAGIVKGKLNVHLVPHSHDDVGWLKTVDQYYVGSNNSI  74

Query  347  QGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFIN  526
            QGACV+NVLDS++ +L  D NRKF++ E AFF RWW  QSP +Q  V+ LV +GQLEF+N
Sbjct  75   QGACVENVLDSIVFSLQKDPNRKFVFAEMAFFHRWWVEQSPEIQEQVKRLVAAGQLEFVN  134

Query  527  GGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GGWCMHDEA  HYIDMIDQTTLGH++IK QFN TPR G
Sbjct  135  GGWCMHDEATVHYIDMIDQTTLGHRFIKDQFNTTPRAG  172



>ref|XP_009412777.1| PREDICTED: lysosomal alpha-mannosidase [Musa acuminata subsp. 
malaccensis]
Length=1024

 Score =   237 bits (605),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +2

Query  203  AESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  382
            A++ Y+ Y+TS  +V GKLNVHLVPH+HDDVGWLKT+DQYYVGSNNSIQGAC+QNVLDS+
Sbjct  26   ADAAYIAYNTSGGVVLGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNSIQGACIQNVLDSV  85

Query  383  IPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATH  562
            + ALLADK+RKFI+VE AFF RWWR QS   +  V+ LVNSGQLEFINGGWCMHDEA  H
Sbjct  86   VEALLADKSRKFIFVEMAFFIRWWRQQSDKTKKLVKKLVNSGQLEFINGGWCMHDEAVVH  145

Query  563  YIDMIDQTTLGHQYIKQQFNVTPRIG  640
            YIDMIDQTTLGH+++KQ+F+  PRIG
Sbjct  146  YIDMIDQTTLGHRFLKQEFDQLPRIG  171



>ref|XP_010040831.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal alpha-mannosidase-like 
[Eucalyptus grandis]
Length=1011

 Score =   237 bits (605),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            YV Y+TSAA+V GKLNVHLVPH+HDDVGWLKT+DQYYVGSNNSIQGACV+NVLDS++ AL
Sbjct  27   YVKYNTSAAVVEGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNSIQGACVENVLDSVVEAL  86

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
              D NRKFI+ E AFFQRWW  QSP  +  VR LVN+GQLEFINGGWCMHDEA THYIDM
Sbjct  87   SRDPNRKFIFAEMAFFQRWWLEQSPETKEQVRKLVNAGQLEFINGGWCMHDEATTHYIDM  146

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTL    IK QFN  PR+G
Sbjct  147  IDQTTLVIALIKSQFNKVPRVG  168



>ref|XP_010528132.1| PREDICTED: lysosomal alpha-mannosidase [Tarenaya hassleriana]
Length=1017

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 129/160 (81%), Gaps = 3/160 (2%)
 Frame = +2

Query  161  FWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNN  340
            F F++  +  GV    S+Y+ YDT+  IVP K+NVHLVPH+HDDVGWLKTVDQYYVG+NN
Sbjct  8    FLFVATIVVGGV---HSEYIAYDTTPRIVPDKINVHLVPHSHDDVGWLKTVDQYYVGANN  64

Query  341  SIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEF  520
            SI+GACVQNVLDS+I +LL D NRKFIYVE AFFQRWWR QS A +  V+ LV++GQLEF
Sbjct  65   SIRGACVQNVLDSVIASLLDDPNRKFIYVEMAFFQRWWRQQSKATKIKVKRLVDTGQLEF  124

Query  521  INGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            INGG  MHDEA  HYIDMIDQTTLGHQ+IK +F   PR+G
Sbjct  125  INGGMSMHDEATPHYIDMIDQTTLGHQFIKSEFGQVPRVG  164



>ref|XP_011008830.1| PREDICTED: alpha-mannosidase isoform X2 [Populus euphratica]
Length=971

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            YV Y+T   +VPGKLNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQGACV+NVLDS++ +L
Sbjct  34   YVDYNTGGGVVPGKLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQGACVENVLDSVVESL  93

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
              D NRKF++VE AFFQRWW  QS  +Q  VR LV +GQLEF+NGGWCMHDEA  HYIDM
Sbjct  94   RRDSNRKFVFVEMAFFQRWWVEQSEEIQEQVRKLVEAGQLEFVNGGWCMHDEATCHYIDM  153

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH  IK+QFN TPR G
Sbjct  154  IDQTTLGHLAIKEQFNKTPRAG  175



>ref|XP_011008829.1| PREDICTED: alpha-mannosidase isoform X1 [Populus euphratica]
Length=1011

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            YV Y+T   +VPGKLNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQGACV+NVLDS++ +L
Sbjct  34   YVDYNTGGGVVPGKLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQGACVENVLDSVVESL  93

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
              D NRKF++VE AFFQRWW  QS  +Q  VR LV +GQLEF+NGGWCMHDEA  HYIDM
Sbjct  94   RRDSNRKFVFVEMAFFQRWWVEQSEEIQEQVRKLVEAGQLEFVNGGWCMHDEATCHYIDM  153

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH  IK+QFN TPR G
Sbjct  154  IDQTTLGHLAIKEQFNKTPRAG  175



>gb|KFK33593.1| hypothetical protein AALP_AA5G034100 [Arabis alpina]
Length=1022

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 128/160 (80%), Gaps = 0/160 (0%)
 Frame = +2

Query  161  FWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNN  340
             + L     +G+    S+Y+ Y+T   IVP K+NVHLVPH+HDDVGWLKTVDQYYVG+NN
Sbjct  11   LYLLLAATVIGIGGVYSEYIEYNTKPRIVPEKINVHLVPHSHDDVGWLKTVDQYYVGANN  70

Query  341  SIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEF  520
            SI+GACVQNVLDS+I +LL D+NRKFIYVE AFFQRWWR QS A +  V+ LV+SGQLEF
Sbjct  71   SIRGACVQNVLDSVIASLLDDENRKFIYVEMAFFQRWWRQQSNAKKVKVKKLVDSGQLEF  130

Query  521  INGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            INGG CMHDEA  HYIDMIDQTTLGHQ+IK +F   PR+G
Sbjct  131  INGGMCMHDEATPHYIDMIDQTTLGHQFIKSEFGQVPRVG  170



>ref|XP_006830303.1| hypothetical protein AMTR_s00121p00111530 [Amborella trichopoda]
 gb|ERM97719.1| hypothetical protein AMTR_s00121p00111530 [Amborella trichopoda]
Length=976

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +2

Query  200  CAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDS  379
            C    Y+ Y+TSA  V GKLNVHLV H+HDDVGWLKT+DQYYVGSNNSIQGACV+NVLDS
Sbjct  19   CGHGAYITYNTSAGPVKGKLNVHLVAHSHDDVGWLKTIDQYYVGSNNSIQGACVRNVLDS  78

Query  380  LIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAAT  559
            +I +L+ D NRKF++ EQAFFQRWW  Q  A+Q  V+ LV+SGQLEFINGGWCMHDEA  
Sbjct  79   VIVSLVNDPNRKFVFAEQAFFQRWWVEQCAAVQEQVKKLVDSGQLEFINGGWCMHDEATC  138

Query  560  HYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HYIDMIDQTTLGH+ IK+QFN  PR+G
Sbjct  139  HYIDMIDQTTLGHRLIKKQFNKVPRVG  165



>ref|XP_009591889.1| PREDICTED: lysosomal alpha-mannosidase-like, partial [Nicotiana 
tomentosiformis]
Length=671

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = +2

Query  125  IGCHLQPMAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWL  304
            +G  + P + + F F  +  A G +     YV Y+T   IV GKLNVHLVPH+HDDVGWL
Sbjct  1    MGTFVAPASVLLFIFY-IICAFGSIGVNG-YVKYNTGDGIVEGKLNVHLVPHSHDDVGWL  58

Query  305  KTVDQYYVGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQST  484
            KT+DQYYVGSNN+IQGACV+NVLDS++ +L  D NRKF++ E AFF +WW  QSP +Q  
Sbjct  59   KTIDQYYVGSNNTIQGACVENVLDSVVMSLRRDLNRKFVFAEMAFFHQWWIRQSPEVQEE  118

Query  485  VRGLVNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            VR LV SGQLEFINGGWCMHDEA  HYIDMIDQTTLGHQ IK +FN+TPR G
Sbjct  119  VRNLVASGQLEFINGGWCMHDEATCHYIDMIDQTTLGHQLIKNEFNITPRAG  170



>ref|XP_007203420.1| hypothetical protein PRUPE_ppa021513mg [Prunus persica]
 gb|EMJ04619.1| hypothetical protein PRUPE_ppa021513mg [Prunus persica]
Length=1015

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 131/173 (76%), Gaps = 9/173 (5%)
 Frame = +2

Query  146  MAKVE-----FWFLSLTLAVGVLCAE---SKYVVYDTSAAIVPGKLNVHLVPHTHDDVGW  301
            M KVE     F F+ + +AV  LC E   S YV Y T   +V GKLNVHLV H+HDDVGW
Sbjct  1    MRKVETLASGFQFVLVFVAV-CLCKEAVGSGYVRYKTGGGVVEGKLNVHLVAHSHDDVGW  59

Query  302  LKTVDQYYVGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQS  481
            LKT+DQYYVGSNNSIQGACV+N LDS+I +L+ D NRKF++ E AFFQRWW  Q   +Q 
Sbjct  60   LKTIDQYYVGSNNSIQGACVENTLDSVIESLVRDPNRKFVFAEMAFFQRWWSTQRAGIQE  119

Query  482  TVRGLVNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
             VR LV++GQLEF+NGGWCMHDEA  HYIDMIDQTTLGH+ IKQQFN TPR G
Sbjct  120  IVRKLVDAGQLEFVNGGWCMHDEATVHYIDMIDQTTLGHRAIKQQFNKTPRAG  172



>ref|NP_189306.1| glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
 emb|CAA66821.1| alpha-mannosidase [Arabidopsis thaliana]
 emb|CAA72432.1| alpha-mannosidase precursor [Arabidopsis thaliana]
 dbj|BAB01735.1| alpha-mannosidase [Arabidopsis thaliana]
 gb|AAK62592.1| AT3g26720/MLJ15_12 [Arabidopsis thaliana]
 gb|AAM47314.1| AT3g26720/MLJ15_12 [Arabidopsis thaliana]
 gb|AEE77203.1| glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
Length=1019

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 132/163 (81%), Gaps = 1/163 (1%)
 Frame = +2

Query  155  VEFWFLSLTLAVGVLCA-ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVG  331
            V+ + L L LA  V+    S+Y+ Y+T   IVP K+NVHLVPH+HDDVGWLKTVDQYYVG
Sbjct  3    VKCFSLYLILAAIVIGGVTSEYIEYNTKPRIVPEKINVHLVPHSHDDVGWLKTVDQYYVG  62

Query  332  SNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQ  511
            SNNSI+GACVQNVLDS+I +LL D+NRKFIYVE AFFQRWWR QS A +  V+ LV+SGQ
Sbjct  63   SNNSIRGACVQNVLDSVIASLLDDENRKFIYVEMAFFQRWWRQQSNAKKVKVKKLVDSGQ  122

Query  512  LEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            LEFINGG CMHDEA  HYIDMIDQTTLGHQ+IK +F   PR+G
Sbjct  123  LEFINGGMCMHDEATPHYIDMIDQTTLGHQFIKTEFGQVPRVG  165



>ref|XP_006466974.1| PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Citrus 
sinensis]
Length=1004

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 126/160 (79%), Gaps = 4/160 (3%)
 Frame = +2

Query  173  SLTLAVGVLCAE----SKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNN  340
            S+ L V  LC+     S YV Y+T A +V GKLNVHLV H+HDDVGWLKTVDQYYVGSNN
Sbjct  9    SVLLCVLCLCSAVVNGSDYVKYNTGAGVVAGKLNVHLVAHSHDDVGWLKTVDQYYVGSNN  68

Query  341  SIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEF  520
            SIQ ACV+NVLDS++ AL  D NRKF++ E AFF RWW  QSP +Q  VR LV++ QLEF
Sbjct  69   SIQSACVENVLDSVVEALRRDPNRKFVFAEMAFFHRWWVGQSPEIQEQVRKLVDASQLEF  128

Query  521  INGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            +NGGWCMHDEA THY+DMIDQTTLGH+YIKQ FN TP+ G
Sbjct  129  VNGGWCMHDEATTHYVDMIDQTTLGHRYIKQHFNKTPKAG  168



>ref|XP_008354644.1| PREDICTED: lysosomal alpha-mannosidase-like [Malus domestica]
Length=1013

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +2

Query  209  SKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIP  388
            S +V Y+T + +V GKLNVHLV H+HDDVGWLKTVDQYYVGSNNSIQGACV+N LDS++ 
Sbjct  29   SGFVKYETGSGVVEGKLNVHLVAHSHDDVGWLKTVDQYYVGSNNSIQGACVENTLDSVVE  88

Query  389  ALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYI  568
            +L+ D NRKF++ E AFFQRWW  QSP +Q+ VR LV++GQLEF+NGGWCMHDEA THYI
Sbjct  89   SLVXDPNRKFVFAEMAFFQRWWLTQSPGIQALVRKLVDAGQLEFVNGGWCMHDEATTHYI  148

Query  569  DMIDQTTLGHQYIKQQFNVTPRIG  640
            DMIDQTTLGH+ IK QFN TPR G
Sbjct  149  DMIDQTTLGHRAIKAQFNKTPRAG  172



>ref|XP_006425431.1| hypothetical protein CICLE_v10024800mg [Citrus clementina]
 gb|ESR38671.1| hypothetical protein CICLE_v10024800mg [Citrus clementina]
Length=986

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 125/160 (78%), Gaps = 4/160 (3%)
 Frame = +2

Query  173  SLTLAVGVLCAE----SKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNN  340
            S+ L V  LC+     S YV Y+T A +V GKLNVHLV H+HDDVGWLKTVDQYYVGSNN
Sbjct  9    SVLLCVLCLCSSVVNGSDYVKYNTGAGVVAGKLNVHLVAHSHDDVGWLKTVDQYYVGSNN  68

Query  341  SIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEF  520
            SIQ ACV+NVLDS++ AL  D NRKF++ E AFF RWW  QSP +Q  VR LV++ QLEF
Sbjct  69   SIQSACVENVLDSVVEALRRDPNRKFVFAEMAFFHRWWVGQSPEIQEQVRKLVDASQLEF  128

Query  521  INGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            +NGGWCMHDEA THY+DMIDQTTLGH YIKQ FN TP+ G
Sbjct  129  VNGGWCMHDEATTHYVDMIDQTTLGHHYIKQHFNKTPKAG  168



>gb|KDO71257.1| hypothetical protein CISIN_1g001850mg [Citrus sinensis]
Length=776

 Score =   235 bits (599),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 125/160 (78%), Gaps = 4/160 (3%)
 Frame = +2

Query  173  SLTLAVGVLCAE----SKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNN  340
            S+ L V  LC+     S YV Y+T A +V GKLNVHLV H+HDDVGWLKTVDQYYVGSNN
Sbjct  9    SVLLCVLCLCSAVVNGSDYVKYNTGAGVVAGKLNVHLVAHSHDDVGWLKTVDQYYVGSNN  68

Query  341  SIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEF  520
            SIQ ACV+NVLDS++ AL  D NRKF++ E AFF RWW  QSP +Q  VR LV++ QLEF
Sbjct  69   SIQSACVENVLDSVVEALRRDPNRKFVFAEMAFFHRWWVGQSPEIQEQVRKLVDASQLEF  128

Query  521  INGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            +NGGWCMHDEA THY+DMIDQTTLGH YIKQ FN TP+ G
Sbjct  129  VNGGWCMHDEATTHYVDMIDQTTLGHHYIKQHFNKTPKAG  168



>dbj|BAH56863.1| AT3G26720 [Arabidopsis thaliana]
Length=947

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 132/163 (81%), Gaps = 1/163 (1%)
 Frame = +2

Query  155  VEFWFLSLTLAVGVLCA-ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVG  331
            V+ + L L LA  V+    S+Y+ Y+T   IVP K+NVHLVPH+HDDVGWLKTVDQYYVG
Sbjct  3    VKCFSLYLILAAIVIGGVTSEYIEYNTKPRIVPEKINVHLVPHSHDDVGWLKTVDQYYVG  62

Query  332  SNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQ  511
            SNNSI+GACVQNVLDS+I +LL D+NRKFIYVE AFFQRWWR QS A +  V+ LV+SGQ
Sbjct  63   SNNSIRGACVQNVLDSVIASLLDDENRKFIYVEMAFFQRWWRQQSNAKKVKVKKLVDSGQ  122

Query  512  LEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            LEFINGG CMHDEA  HYIDMIDQTTLGHQ+IK +F   PR+G
Sbjct  123  LEFINGGMCMHDEATPHYIDMIDQTTLGHQFIKTEFGQVPRVG  165



>ref|NP_001118706.1| glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
 gb|AEE77204.1| glycosyl hydrolase family 38 protein [Arabidopsis thaliana]
Length=943

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 132/163 (81%), Gaps = 1/163 (1%)
 Frame = +2

Query  155  VEFWFLSLTLAVGVLCA-ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVG  331
            V+ + L L LA  V+    S+Y+ Y+T   IVP K+NVHLVPH+HDDVGWLKTVDQYYVG
Sbjct  3    VKCFSLYLILAAIVIGGVTSEYIEYNTKPRIVPEKINVHLVPHSHDDVGWLKTVDQYYVG  62

Query  332  SNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQ  511
            SNNSI+GACVQNVLDS+I +LL D+NRKFIYVE AFFQRWWR QS A +  V+ LV+SGQ
Sbjct  63   SNNSIRGACVQNVLDSVIASLLDDENRKFIYVEMAFFQRWWRQQSNAKKVKVKKLVDSGQ  122

Query  512  LEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            LEFINGG CMHDEA  HYIDMIDQTTLGHQ+IK +F   PR+G
Sbjct  123  LEFINGGMCMHDEATPHYIDMIDQTTLGHQFIKTEFGQVPRVG  165



>ref|XP_006395530.1| hypothetical protein EUTSA_v10003577mg [Eutrema salsugineum]
 gb|ESQ32816.1| hypothetical protein EUTSA_v10003577mg [Eutrema salsugineum]
Length=1020

 Score =   236 bits (603),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +2

Query  164  WFLSLTLAVGVLCA-ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNN  340
            ++L L LA  V+    S+Y+ Y+T+  IVP K+NVHLVPH+HDDVGWLKTVDQYYVG+NN
Sbjct  9    FYLCLFLATIVIGGVYSEYIEYNTTPRIVPEKINVHLVPHSHDDVGWLKTVDQYYVGANN  68

Query  341  SIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEF  520
            SI+GACVQNVLDS+I +LL D+NRKFIYVE AFFQRWWR QS A +  V+ LV+SGQLEF
Sbjct  69   SIRGACVQNVLDSVIASLLDDQNRKFIYVEMAFFQRWWRQQSNAKKVKVKKLVDSGQLEF  128

Query  521  INGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            INGG CMHDEA  HYIDMIDQTTLGHQ+IK +F   PR+G
Sbjct  129  INGGMCMHDEATPHYIDMIDQTTLGHQFIKSEFGQVPRVG  168



>ref|XP_007046660.1| Fatty acid hydroxylase superfamily isoform 2 [Theobroma cacao]
 gb|EOX90817.1| Fatty acid hydroxylase superfamily isoform 2 [Theobroma cacao]
Length=1000

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 129/161 (80%), Gaps = 3/161 (2%)
 Frame = +2

Query  167  FLSLTLAVGVLCAESK---YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSN  337
            F+ L +AV  L  +S    +V Y+T A IVPGKLNVHLVPH+HDDVGWLKTVDQYYVGSN
Sbjct  12   FVVLVVAVCGLKVKSVKGVHVKYNTGAGIVPGKLNVHLVPHSHDDVGWLKTVDQYYVGSN  71

Query  338  NSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLE  517
            NSIQGACVQ VLDS++ ALL D NRKF++ E AFFQRWW  QS  +Q  V+ L ++G+LE
Sbjct  72   NSIQGACVQYVLDSVVDALLRDSNRKFVFAEMAFFQRWWTEQSLEIQEQVKKLADAGRLE  131

Query  518  FINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            FINGGWCMHDEA THYIDMIDQ+TLGH+ IK+QFN  PR G
Sbjct  132  FINGGWCMHDEATTHYIDMIDQSTLGHRLIKEQFNKVPRAG  172



>gb|KDO71255.1| hypothetical protein CISIN_1g001850mg [Citrus sinensis]
Length=1005

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 125/160 (78%), Gaps = 4/160 (3%)
 Frame = +2

Query  173  SLTLAVGVLCAE----SKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNN  340
            S+ L V  LC+     S YV Y+T A +V GKLNVHLV H+HDDVGWLKTVDQYYVGSNN
Sbjct  9    SVLLCVLCLCSAVVNGSDYVKYNTGAGVVAGKLNVHLVAHSHDDVGWLKTVDQYYVGSNN  68

Query  341  SIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEF  520
            SIQ ACV+NVLDS++ AL  D NRKF++ E AFF RWW  QSP +Q  VR LV++ QLEF
Sbjct  69   SIQSACVENVLDSVVEALRRDPNRKFVFAEMAFFHRWWVGQSPEIQEQVRKLVDASQLEF  128

Query  521  INGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            +NGGWCMHDEA THY+DMIDQTTLGH YIKQ FN TP+ G
Sbjct  129  VNGGWCMHDEATTHYVDMIDQTTLGHHYIKQHFNKTPKAG  168



>gb|KDO71256.1| hypothetical protein CISIN_1g001850mg [Citrus sinensis]
Length=997

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 125/160 (78%), Gaps = 4/160 (3%)
 Frame = +2

Query  173  SLTLAVGVLCAE----SKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNN  340
            S+ L V  LC+     S YV Y+T A +V GKLNVHLV H+HDDVGWLKTVDQYYVGSNN
Sbjct  9    SVLLCVLCLCSAVVNGSDYVKYNTGAGVVAGKLNVHLVAHSHDDVGWLKTVDQYYVGSNN  68

Query  341  SIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEF  520
            SIQ ACV+NVLDS++ AL  D NRKF++ E AFF RWW  QSP +Q  VR LV++ QLEF
Sbjct  69   SIQSACVENVLDSVVEALRRDPNRKFVFAEMAFFHRWWVGQSPEIQEQVRKLVDASQLEF  128

Query  521  INGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            +NGGWCMHDEA THY+DMIDQTTLGH YIKQ FN TP+ G
Sbjct  129  VNGGWCMHDEATTHYVDMIDQTTLGHHYIKQHFNKTPKAG  168



>ref|XP_007046659.1| Glycosyl hydrolase family 38 protein isoform 1 [Theobroma cacao]
 gb|EOX90816.1| Glycosyl hydrolase family 38 protein isoform 1 [Theobroma cacao]
Length=1012

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 129/161 (80%), Gaps = 3/161 (2%)
 Frame = +2

Query  167  FLSLTLAVGVLCAESK---YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSN  337
            F+ L +AV  L  +S    +V Y+T A IVPGKLNVHLVPH+HDDVGWLKTVDQYYVGSN
Sbjct  12   FVVLVVAVCGLKVKSVKGVHVKYNTGAGIVPGKLNVHLVPHSHDDVGWLKTVDQYYVGSN  71

Query  338  NSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLE  517
            NSIQGACVQ VLDS++ ALL D NRKF++ E AFFQRWW  QS  +Q  V+ L ++G+LE
Sbjct  72   NSIQGACVQYVLDSVVDALLRDSNRKFVFAEMAFFQRWWTEQSLEIQEQVKKLADAGRLE  131

Query  518  FINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            FINGGWCMHDEA THYIDMIDQ+TLGH+ IK+QFN  PR G
Sbjct  132  FINGGWCMHDEATTHYIDMIDQSTLGHRLIKEQFNKVPRAG  172



>ref|XP_002875335.1| glycosyl hydrolase family 38 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51594.1| glycosyl hydrolase family 38 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=1018

 Score =   236 bits (601),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 132/164 (80%), Gaps = 1/164 (1%)
 Frame = +2

Query  152  KVEFWFLSLTLAVGVLCA-ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYV  328
            +V ++ L L LA  V+    S+Y+ Y+T   IVP K+NVHLVPH+HDDVGWLKTVDQYYV
Sbjct  2    EVNYFSLYLILAAIVIGGVNSEYIEYNTKPRIVPEKINVHLVPHSHDDVGWLKTVDQYYV  61

Query  329  GSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSG  508
            G+NNSI+GACVQNVLDS+I +LL D+NRKFIYVE AFFQRWWR QS A +  V+ LV+SG
Sbjct  62   GANNSIRGACVQNVLDSVIASLLDDENRKFIYVEMAFFQRWWRQQSNAKKVKVKKLVDSG  121

Query  509  QLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            QLEFINGG CMHDEA  HYIDMIDQTTLGH +IK +F   PR+G
Sbjct  122  QLEFINGGMCMHDEATPHYIDMIDQTTLGHHFIKTEFGQVPRVG  165



>gb|EMS46456.1| Lysosomal alpha-mannosidase [Triticum urartu]
Length=1033

 Score =   236 bits (601),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            YV Y+TSA  V G LNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQGACV N LDS++ AL
Sbjct  23   YVAYNTSAGTVAGLLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQGACVMNTLDSVVDAL  82

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
              D  RKF+  EQAFFQRWW  +SP +Q+ V  LV+SGQLEFINGGWCMHDEAATHYIDM
Sbjct  83   ARDPGRKFVVAEQAFFQRWWVEKSPKIQAIVHKLVDSGQLEFINGGWCMHDEAATHYIDM  142

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH+ IK+QFN TPR G
Sbjct  143  IDQTTLGHRVIKKQFNKTPRAG  164



>gb|EYU31875.1| hypothetical protein MIMGU_mgv1a000658mg [Erythranthe guttata]
Length=1029

 Score =   236 bits (601),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 130/161 (81%), Gaps = 4/161 (2%)
 Frame = +2

Query  161  FWFLSL-TLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSN  337
             +F S+ T+  GV    S YV Y+T++   P K+NVHLVPH+HDDVGWLKTVDQYY G+N
Sbjct  7    LFFTSIATIFAGV---NSTYVPYNTTSGFAPDKINVHLVPHSHDDVGWLKTVDQYYAGAN  63

Query  338  NSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLE  517
            NSI+GACVQNVLDS+I ALL DKNR+FIYVE AFFQRWWR QS  +++ V+ LVNSGQLE
Sbjct  64   NSIRGACVQNVLDSVISALLDDKNRRFIYVEMAFFQRWWRQQSDTLKAKVKHLVNSGQLE  123

Query  518  FINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            FINGG CMHDEA  HYID+IDQTTLGH++I  +F  TPR+G
Sbjct  124  FINGGMCMHDEATPHYIDLIDQTTLGHRFILDEFGKTPRVG  164



>ref|XP_004158902.1| PREDICTED: lysosomal alpha-mannosidase-like [Cucumis sativus]
Length=1007

 Score =   236 bits (601),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = +2

Query  155  VEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGS  334
            + F FL L L +  +  +  +V YDT   +V GKLNVHLV H+HDDVGWLKTVDQYYVG 
Sbjct  9    LPFSFLVLVLILFCVEVDCNFVNYDTGGGVVDGKLNVHLVAHSHDDVGWLKTVDQYYVGL  68

Query  335  NNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQL  514
            NNSIQGACVQNVLDS++ +LL D NRKF++ E AFFQRWW  Q+P +Q  VR LV  GQL
Sbjct  69   NNSIQGACVQNVLDSVVDSLLRDSNRKFVFAEMAFFQRWWSQQNPTVQRRVRELVEDGQL  128

Query  515  EFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            EFINGGWCMHDEA +HYIDMIDQTTLGH  IK++FN  PR G
Sbjct  129  EFINGGWCMHDEATSHYIDMIDQTTLGHSVIKEEFNKVPRAG  170



>gb|AIX48011.1| LMann protein, partial [synthetic construct]
Length=989

 Score =   235 bits (600),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            Y  Y+T A IV GKLNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQGACV+NVLDS++ +L
Sbjct  2    YTKYNTGAGIVKGKLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQGACVENVLDSIVFSL  61

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
              D NRKF++ E AFF RWW  QSP +Q  V+ LV +GQLEF+NGGWCMHDEA  HYIDM
Sbjct  62   QKDPNRKFVFAEMAFFHRWWVEQSPEIQEQVKRLVAAGQLEFVNGGWCMHDEATVHYIDM  121

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH++IK QFN TPR G
Sbjct  122  IDQTTLGHRFIKDQFNTTPRAG  143



>gb|KCW53179.1| hypothetical protein EUGRSUZ_J024562, partial [Eucalyptus grandis]
Length=866

 Score =   234 bits (598),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +2

Query  206  ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI  385
            +  Y+ Y+T A +V GKLNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQGACV+NVLDS++
Sbjct  24   DGAYMKYNTGAGVVEGKLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQGACVENVLDSVV  83

Query  386  PALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHY  565
             AL  D NRKF++ E AFFQRWW  QSP  Q  VR LV++GQ EFINGGWCMHDEA  HY
Sbjct  84   KALARDPNRKFVFAEMAFFQRWWLEQSPETQEQVRKLVDAGQFEFINGGWCMHDEATAHY  143

Query  566  IDMIDQTTLGHQYIKQQFNVTPRIG  640
            IDMIDQTTLGH  IK QF+  PR+G
Sbjct  144  IDMIDQTTLGHGLIKSQFDKVPRVG  168



>ref|XP_010034700.1| PREDICTED: lysosomal alpha-mannosidase-like [Eucalyptus grandis]
Length=876

 Score =   234 bits (598),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +2

Query  206  ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLI  385
            +  Y+ Y+T A +V GKLNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQGACV+NVLDS++
Sbjct  24   DGAYMKYNTGAGVVEGKLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQGACVENVLDSVV  83

Query  386  PALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHY  565
             AL  D NRKF++ E AFFQRWW  QSP  Q  VR LV++GQ EFINGGWCMHDEA  HY
Sbjct  84   KALARDPNRKFVFAEMAFFQRWWLEQSPETQEQVRKLVDAGQFEFINGGWCMHDEATAHY  143

Query  566  IDMIDQTTLGHQYIKQQFNVTPRIG  640
            IDMIDQTTLGH  IK QF+  PR+G
Sbjct  144  IDMIDQTTLGHGLIKSQFDKVPRVG  168



>ref|XP_003573734.1| PREDICTED: lysosomal alpha-mannosidase [Brachypodium distachyon]
Length=998

 Score =   235 bits (600),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            YV Y+TSA  V G LNVHLVPH+HDDVGWLKTVDQY+VGSNNSIQGACV N LDS++ AL
Sbjct  20   YVAYNTSAGTVAGLLNVHLVPHSHDDVGWLKTVDQYFVGSNNSIQGACVMNTLDSVVDAL  79

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
              D  RKF+  EQAFFQRWW  +SP +Q+ V  LV+SGQLEFINGGWCMHDEAATHYIDM
Sbjct  80   AKDPGRKFVVAEQAFFQRWWVEKSPEIQAMVHKLVDSGQLEFINGGWCMHDEAATHYIDM  139

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH+ IK+QFN TPR G
Sbjct  140  IDQTTLGHRMIKKQFNKTPRAG  161



>ref|XP_004135022.1| PREDICTED: lysosomal alpha-mannosidase-like [Cucumis sativus]
 gb|KGN48931.1| hypothetical protein Csa_6G507060 [Cucumis sativus]
Length=1007

 Score =   235 bits (600),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = +2

Query  155  VEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGS  334
            + F FL L L +  +  +  +V YDT   +V GKLNVHLV H+HDDVGWLKTVDQYYVG 
Sbjct  9    LPFSFLVLVLILFCVEVDCNFVNYDTGGGVVDGKLNVHLVAHSHDDVGWLKTVDQYYVGL  68

Query  335  NNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQL  514
            NNSIQGACVQNVLDS++ +LL D NRKF++ E AFFQRWW  Q+P +Q  VR LV  GQL
Sbjct  69   NNSIQGACVQNVLDSVVDSLLHDSNRKFVFAEMAFFQRWWSQQNPTVQRRVRELVEDGQL  128

Query  515  EFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            EFINGGWCMHDEA +HYIDMIDQTTLGH  IK++FN  PR G
Sbjct  129  EFINGGWCMHDEATSHYIDMIDQTTLGHSVIKEEFNKVPRAG  170



>ref|XP_010113332.1| Lysosomal alpha-mannosidase [Morus notabilis]
 gb|EXC35339.1| Lysosomal alpha-mannosidase [Morus notabilis]
Length=1011

 Score =   235 bits (599),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +2

Query  197  LCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLD  376
            L     YV Y+TS+ IV GKLNVHLVPH+HDDVGWLKTVDQYYVG+NNSIQGACV+NVLD
Sbjct  23   LVVSGSYVKYNTSSGIVEGKLNVHLVPHSHDDVGWLKTVDQYYVGANNSIQGACVENVLD  82

Query  377  SLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAA  556
            S++ +L  D NRKF++ E AFFQRWW  QS   Q  VR LV+ G+LEFINGGWCMHDEA 
Sbjct  83   SVVESLRRDPNRKFVFAEMAFFQRWWTEQSFETQEQVRKLVDDGRLEFINGGWCMHDEAT  142

Query  557  THYIDMIDQTTLGHQYIKQQFNVTPRIG  640
             HYIDMIDQTTLGH YIK+QFN  PR G
Sbjct  143  CHYIDMIDQTTLGHSYIKKQFNKVPRAG  170



>gb|EMT01931.1| Lysosomal alpha-mannosidase [Aegilops tauschii]
Length=1072

 Score =   235 bits (600),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            YV Y+TSA  V G LNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQGACV N LDS++ AL
Sbjct  23   YVAYNTSAGTVAGLLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQGACVMNTLDSVVDAL  82

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
              D  RKF+  EQAFFQRWW  +SP +Q+ V  LV+SGQLEFINGGWCMHDEAATHYIDM
Sbjct  83   ARDPGRKFVVAEQAFFQRWWVEKSPQIQAIVHKLVDSGQLEFINGGWCMHDEAATHYIDM  142

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH+ IK+QFN TPR G
Sbjct  143  IDQTTLGHRVIKKQFNKTPRAG  164



>gb|AIX48013.1| LMann protein, partial [synthetic construct]
Length=863

 Score =   234 bits (596),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            YV Y+T + +VPGK+NVHLV H+HDDVGWLKTVDQYYVGSNNSIQGACV+NVLDS++ +L
Sbjct  2    YVKYNTGSGVVPGKINVHLVAHSHDDVGWLKTVDQYYVGSNNSIQGACVENVLDSVVVSL  61

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
            L D NRKFI+VE AFFQRWW  QS  +Q  VR L+++GQLEF NGGWCMHDEA  HYIDM
Sbjct  62   LRDPNRKFIFVEMAFFQRWWLEQSEEIQDHVRKLIDAGQLEFANGGWCMHDEATCHYIDM  121

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH  IK+QFN TPR G
Sbjct  122  IDQTTLGHLAIKEQFNKTPRAG  143



>gb|AIX48006.1| LMann protein, partial [synthetic construct]
Length=997

 Score =   234 bits (597),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPA  391
            +Y+ Y+T   IVP K+NVHLVPH+HDDVGWLKTVDQYYVGSNNSI+GACVQNVLDS+I +
Sbjct  1    EYIEYNTKPRIVPEKINVHLVPHSHDDVGWLKTVDQYYVGSNNSIRGACVQNVLDSVIAS  60

Query  392  LLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYID  571
            LL D+NRKFIYVE AFFQRWWR QS A +  V+ LV+SGQLEFINGG CMHDEA  HYID
Sbjct  61   LLDDENRKFIYVEMAFFQRWWRQQSNAKKVKVKKLVDSGQLEFINGGMCMHDEATPHYID  120

Query  572  MIDQTTLGHQYIKQQFNVTPRIG  640
            MIDQTTLGHQ+IK +F   PR+G
Sbjct  121  MIDQTTLGHQFIKTEFGQVPRVG  143



>ref|XP_002530831.1| lysosomal alpha-mannosidase, putative [Ricinus communis]
 gb|EEF31544.1| lysosomal alpha-mannosidase, putative [Ricinus communis]
Length=891

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            YV Y+T + +VPGK+NVHLV H+HDDVGWLKTVDQYYVGSNNSIQGACV+NVLDS++ +L
Sbjct  30   YVKYNTGSGVVPGKINVHLVAHSHDDVGWLKTVDQYYVGSNNSIQGACVENVLDSVVVSL  89

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
            L D NRKFI+VE AFFQRWW  QS  +Q  VR L+++GQLEF NGGWCMHDEA  HYIDM
Sbjct  90   LRDPNRKFIFVEMAFFQRWWLEQSEEIQDHVRKLIDAGQLEFANGGWCMHDEATCHYIDM  149

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH  IK+QFN TPR G
Sbjct  150  IDQTTLGHLAIKEQFNKTPRAG  171



>ref|XP_009152026.1| PREDICTED: lysosomal alpha-mannosidase [Brassica rapa]
 emb|CDY13654.1| BnaA06g32690D [Brassica napus]
Length=1021

 Score =   234 bits (597),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = +2

Query  167  FLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSI  346
             L  T+ +GV+ +E  Y+ Y+T+  IVP K+NVHLVPH+HDDVGWLKTVDQYYVG+NNSI
Sbjct  13   LLLATIVIGVVSSE--YIEYNTAPRIVPEKINVHLVPHSHDDVGWLKTVDQYYVGANNSI  70

Query  347  QGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFIN  526
            +GACV+NV++S+I +LL D+NRKFIYVE AFF+RWWR QS A +  V+ LV+SGQLEFIN
Sbjct  71   RGACVENVIESVIASLLDDQNRKFIYVEMAFFERWWRQQSNAKKVKVKKLVDSGQLEFIN  130

Query  527  GGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GG CMHDEA  HYIDMIDQTTLGHQ+IK +F   PR+G
Sbjct  131  GGMCMHDEATPHYIDMIDQTTLGHQFIKSEFGQVPRVG  168



>gb|EYU30803.1| hypothetical protein MIMGU_mgv1a000690mg [Erythranthe guttata]
Length=1017

 Score =   234 bits (596),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            Y+ Y+T + IV GKLNVHLV H+HDDVGWLKT+DQYYVGSNNSIQGACV+NVLDS++ AL
Sbjct  25   YIHYNTGSGIVDGKLNVHLVAHSHDDVGWLKTIDQYYVGSNNSIQGACVENVLDSVVVAL  84

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
              D NRKFI+ E AFF RWW  QSP +Q  VR LV+ GQLEF+NGGWCMHDEA THYIDM
Sbjct  85   RRDPNRKFIFAEMAFFSRWWEEQSPEIQQQVRKLVDDGQLEFVNGGWCMHDEATTHYIDM  144

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH  IK QFN TPR G
Sbjct  145  IDQTTLGHFLIKSQFNTTPRAG  166



>ref|XP_009386958.1| PREDICTED: lysosomal alpha-mannosidase [Musa acuminata subsp. 
malaccensis]
Length=1008

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 125/160 (78%), Gaps = 2/160 (1%)
 Frame = +2

Query  167  FLSLTLAVGVLCAESK--YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNN  340
            FL ++L +  L   S+  Y+ Y+TS   V GKLNVHLVPH+HDDVGWLKT+DQYYVGSNN
Sbjct  10   FLCVSLMILALAGVSRGGYIAYNTSGGTVVGKLNVHLVPHSHDDVGWLKTIDQYYVGSNN  69

Query  341  SIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEF  520
            SIQGACV NVLDS++ ALL +  RKFI+ EQAFFQRWW  Q+   Q  +R LV+SGQLEF
Sbjct  70   SIQGACVMNVLDSVVDALLKNPTRKFIFAEQAFFQRWWIEQNDRTQEVMRKLVDSGQLEF  129

Query  521  INGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            INGGWCMHDEA  HYIDMIDQTTLGH  IK+QFN  PR G
Sbjct  130  INGGWCMHDEATVHYIDMIDQTTLGHWMIKKQFNKVPRAG  169



>ref|XP_001770740.1| predicted protein [Physcomitrella patens]
 gb|EDQ64422.1| predicted protein [Physcomitrella patens]
Length=992

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  VYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPALLA  400
            +Y+TS  I  GK+NVHLV HTHDDVGWLKTVDQYYVGSNNSIQ A VQ VLDS++ AL  
Sbjct  1    MYNTSGGIEEGKINVHLVSHTHDDVGWLKTVDQYYVGSNNSIQIAAVQYVLDSVVTALEQ  60

Query  401  DKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDMID  580
            D NRKFIYVEQAFFQRWWR QSP  + +V+ LV  GQLEFINGG+CMHDEAATHY+DMID
Sbjct  61   DPNRKFIYVEQAFFQRWWREQSPEKKKSVKKLVEEGQLEFINGGYCMHDEAATHYVDMID  120

Query  581  QTTLGHQYIKQQFNVTPRIG  640
            QT+LGH+Y+K+QF +TPRIG
Sbjct  121  QTSLGHRYLKEQFGITPRIG  140



>ref|XP_009759740.1| PREDICTED: lysosomal alpha-mannosidase isoform X1 [Nicotiana 
sylvestris]
Length=1006

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 132/174 (76%), Gaps = 6/174 (3%)
 Frame = +2

Query  125  IGCHLQPMAKVEFWFLSLTL--AVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVG  298
            +G    P + + F F S+    ++GV    + YV Y+T + IV GKLNVHLVPH+HDDVG
Sbjct  1    MGTIAGPASVLLFIFYSVCAFWSIGV----NGYVKYNTGSGIVEGKLNVHLVPHSHDDVG  56

Query  299  WLKTVDQYYVGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQ  478
            WLKTVDQYYVGSNN+IQ ACV+NVLDS++ +L  D NRKF++ E AFF RWW  QSP +Q
Sbjct  57   WLKTVDQYYVGSNNTIQVACVENVLDSVVMSLRRDPNRKFVFAEMAFFHRWWIRQSPEIQ  116

Query  479  STVRGLVNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
              VR LV SGQLEFINGGWCMHDEA  HY+DMIDQTTLGHQ IK +FN+TPR G
Sbjct  117  EEVRNLVASGQLEFINGGWCMHDEATCHYVDMIDQTTLGHQLIKNEFNITPRAG  170



>ref|XP_009759741.1| PREDICTED: lysosomal alpha-mannosidase isoform X2 [Nicotiana 
sylvestris]
Length=998

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 132/174 (76%), Gaps = 6/174 (3%)
 Frame = +2

Query  125  IGCHLQPMAKVEFWFLSLTL--AVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVG  298
            +G    P + + F F S+    ++GV    + YV Y+T + IV GKLNVHLVPH+HDDVG
Sbjct  1    MGTIAGPASVLLFIFYSVCAFWSIGV----NGYVKYNTGSGIVEGKLNVHLVPHSHDDVG  56

Query  299  WLKTVDQYYVGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQ  478
            WLKTVDQYYVGSNN+IQ ACV+NVLDS++ +L  D NRKF++ E AFF RWW  QSP +Q
Sbjct  57   WLKTVDQYYVGSNNTIQVACVENVLDSVVMSLRRDPNRKFVFAEMAFFHRWWIRQSPEIQ  116

Query  479  STVRGLVNSGQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
              VR LV SGQLEFINGGWCMHDEA  HY+DMIDQTTLGHQ IK +FN+TPR G
Sbjct  117  EEVRNLVASGQLEFINGGWCMHDEATCHYVDMIDQTTLGHQLIKNEFNITPRAG  170



>gb|KHN36022.1| Lysosomal alpha-mannosidase [Glycine soja]
Length=1035

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  197  LCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLD  376
            LC     V Y+T A++VPGKLNVHL+ H+HDDVGWLKTVDQYYVGSNNSIQGACV+NVLD
Sbjct  20   LCGTVVCVKYNTGASVVPGKLNVHLIAHSHDDVGWLKTVDQYYVGSNNSIQGACVENVLD  79

Query  377  SLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAA  556
            S++ +L  ++NRKF++ E AFF RWW  Q+P  Q  VR LV++GQLEFINGGWCMHDEA 
Sbjct  80   SVVVSLQLNQNRKFVFAEMAFFHRWWVEQTPQTQVQVRKLVDAGQLEFINGGWCMHDEAT  139

Query  557  THYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            THYIDMIDQTTLGH++IK QFN  PR G
Sbjct  140  THYIDMIDQTTLGHRFIKNQFNKVPRAG  167



>ref|XP_002975348.1| hypothetical protein SELMODRAFT_103066 [Selaginella moellendorffii]
 gb|EFJ23549.1| hypothetical protein SELMODRAFT_103066 [Selaginella moellendorffii]
Length=989

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 129/153 (84%), Gaps = 3/153 (2%)
 Frame = +2

Query  182  LAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACV  361
            LA+  L A  +Y   +T+A IV GK+NVHLVPHTHDDVGWLKTVDQYY+GSNN+IQ A V
Sbjct  14   LAIAELGASKRY---NTTAGIVAGKINVHLVPHTHDDVGWLKTVDQYYIGSNNTIQEAGV  70

Query  362  QNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCM  541
            Q +LDS++  L ++ +RKF+YVEQAFFQRWWR Q+  +QS V+ L++SG+LE INGGWCM
Sbjct  71   QYILDSILMYLTSNPDRKFVYVEQAFFQRWWREQTEEVQSVVKELIHSGRLELINGGWCM  130

Query  542  HDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HDEAATHYIDMI+QTTLGH+YIK+QF VTPRIG
Sbjct  131  HDEAATHYIDMIEQTTLGHKYIKEQFGVTPRIG  163



>ref|XP_002964449.1| hypothetical protein SELMODRAFT_266756 [Selaginella moellendorffii]
 gb|EFJ34782.1| hypothetical protein SELMODRAFT_266756 [Selaginella moellendorffii]
Length=998

 Score =   233 bits (594),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 129/153 (84%), Gaps = 3/153 (2%)
 Frame = +2

Query  182  LAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACV  361
            LA+  L A  +Y   +T+A IV GK+NVHLVPHTHDDVGWLKTVDQYY+GSNN+IQ A V
Sbjct  14   LAIAELGASKRY---NTTAGIVAGKINVHLVPHTHDDVGWLKTVDQYYIGSNNTIQEAGV  70

Query  362  QNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCM  541
            Q +LDS++  L ++ +RKF+YVEQAFFQRWWR Q+  +QS V+ L++SG+LE INGGWCM
Sbjct  71   QYILDSILMYLTSNPDRKFVYVEQAFFQRWWREQTEEVQSVVKELIHSGRLELINGGWCM  130

Query  542  HDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HDEAATHYIDMI+QTTLGH+YIK+QF VTPRIG
Sbjct  131  HDEAATHYIDMIEQTTLGHKYIKEQFGVTPRIG  163



>ref|XP_008788431.1| PREDICTED: lysosomal alpha-mannosidase-like [Phoenix dactylifera]
Length=997

 Score =   233 bits (594),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 126/165 (76%), Gaps = 2/165 (1%)
 Frame = +2

Query  146  MAKVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            MA+    FL + L +        Y+ Y+TSA IV GKLNVHLV H+HDD GWLKTVDQYY
Sbjct  1    MARSAMAFLCIFLTIS--ACNGGYIRYNTSAGIVAGKLNVHLVAHSHDDGGWLKTVDQYY  58

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNN+IQ ACV NVLDS++ ALL D NRKF++ EQAFFQRWWR Q+   Q  VR LV+S
Sbjct  59   VGSNNTIQVACVMNVLDSVVDALLKDPNRKFVFAEQAFFQRWWREQNEQTQEVVRKLVDS  118

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GQLEFINGGWCMHDEA  HYI MIDQTTLGH+ IK+QFN  PR+G
Sbjct  119  GQLEFINGGWCMHDEATVHYIYMIDQTTLGHRMIKKQFNKVPRVG  163



>dbj|BAJ94660.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=998

 Score =   233 bits (594),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            YV Y+TSA    G LNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQGACV + LDS++ AL
Sbjct  23   YVAYNTSAGTAAGLLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQGACVMDTLDSVVDAL  82

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
              D  RKF+  EQAFFQRWW  +SP +Q+ V  LV+SGQLEFINGGWCMHDEAATHYIDM
Sbjct  83   ARDPGRKFVVAEQAFFQRWWVEKSPKIQAIVHKLVDSGQLEFINGGWCMHDEAATHYIDM  142

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH+ IK+QFN TPR G
Sbjct  143  IDQTTLGHRVIKKQFNKTPRAG  164



>ref|XP_002865084.1| glycosyl hydrolase family 38 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41343.1| glycosyl hydrolase family 38 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=1047

 Score =   233 bits (593),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            YV Y T A +VPGKLNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQ ACV+NVLDS++ +L
Sbjct  32   YVKYGTEAKVVPGKLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQNACVRNVLDSVVDSL  91

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
            L D NRKF++ E AFF RWW  QSP  Q  V+ LV SGQLEF+NGGW M+DEA  HYIDM
Sbjct  92   LGDPNRKFVFAEMAFFTRWWEEQSPETQEQVKRLVKSGQLEFVNGGWAMNDEATCHYIDM  151

Query  575  IDQTTLGHQYIKQQFNVTPR  634
            IDQTT GH++IKQQFN TPR
Sbjct  152  IDQTTKGHRFIKQQFNTTPR  171



>ref|XP_010478748.1| PREDICTED: lysosomal alpha-mannosidase-like [Camelina sativa]
Length=1040

 Score =   232 bits (592),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +2

Query  176  LTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGA  355
            L L+V  +  E +YV Y T A +VPGKLNVHLVPH+HDDVGWLKTVDQYY+GSNNSIQ A
Sbjct  21   LRLSVESVNGE-RYVKYGTEARVVPGKLNVHLVPHSHDDVGWLKTVDQYYLGSNNSIQNA  79

Query  356  CVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGW  535
            CV+NVLDS++ +LL D NRKF++ E AFF RWW  QSP MQ  V+ LV SGQLEF+NGGW
Sbjct  80   CVRNVLDSVVDSLLRDPNRKFVFGEMAFFTRWWEEQSPEMQEQVKRLVKSGQLEFVNGGW  139

Query  536  CMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPR  634
             M+DEA  HYIDMIDQTT GH++IKQ FN TPR
Sbjct  140  SMNDEATCHYIDMIDQTTRGHRFIKQHFNTTPR  172



>ref|XP_011462239.1| PREDICTED: alpha-mannosidase isoform X2 [Fragaria vesca subsp. 
vesca]
Length=1005

 Score =   232 bits (591),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 124/159 (78%), Gaps = 6/159 (4%)
 Frame = +2

Query  164  WFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNS  343
            WFL      GV+  +  YV Y T + +V GKLNVHLV H+HDDVGWLKTVDQYYVGSNNS
Sbjct  16   WFL------GVVSVDGVYVKYQTGSGVVEGKLNVHLVAHSHDDVGWLKTVDQYYVGSNNS  69

Query  344  IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFI  523
            IQGACV+N LDS++ +L+ D NRKF++ E AFFQRWW  QS  +Q  V  LV++GQLEF+
Sbjct  70   IQGACVENTLDSVVESLVRDPNRKFVFAEMAFFQRWWLTQSVEVQERVWKLVDAGQLEFV  129

Query  524  NGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            NGGWCMHDEAA HYIDMIDQTTLGH  IKQQFN TPR G
Sbjct  130  NGGWCMHDEAAVHYIDMIDQTTLGHLAIKQQFNKTPRAG  168



>ref|XP_011462234.1| PREDICTED: alpha-mannosidase isoform X1 [Fragaria vesca subsp. 
vesca]
Length=1006

 Score =   231 bits (590),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 124/159 (78%), Gaps = 6/159 (4%)
 Frame = +2

Query  164  WFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNS  343
            WFL      GV+  +  YV Y T + +V GKLNVHLV H+HDDVGWLKTVDQYYVGSNNS
Sbjct  16   WFL------GVVSVDGVYVKYQTGSGVVEGKLNVHLVAHSHDDVGWLKTVDQYYVGSNNS  69

Query  344  IQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFI  523
            IQGACV+N LDS++ +L+ D NRKF++ E AFFQRWW  QS  +Q  V  LV++GQLEF+
Sbjct  70   IQGACVENTLDSVVESLVRDPNRKFVFAEMAFFQRWWLTQSVEVQERVWKLVDAGQLEFV  129

Query  524  NGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            NGGWCMHDEAA HYIDMIDQTTLGH  IKQQFN TPR G
Sbjct  130  NGGWCMHDEAAVHYIDMIDQTTLGHLAIKQQFNKTPRAG  168



>ref|XP_010425390.1| PREDICTED: lysosomal alpha-mannosidase-like [Camelina sativa]
Length=1023

 Score =   231 bits (590),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = +2

Query  152  KVEFWFLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVG  331
            K  F F  +  AV +    S+Y+ Y+T   IVP K+NVHLVPH+HDDVGWLKTVDQYYVG
Sbjct  4    KCFFSFYLILAAVVIGAVNSEYIEYNTKPRIVPEKINVHLVPHSHDDVGWLKTVDQYYVG  63

Query  332  SNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQ  511
            SNNSI+GACVQNVLDS+I +LL D+NRKFIYVE AFF+RWWR QS A +  V+ LV+SGQ
Sbjct  64   SNNSIRGACVQNVLDSVIASLLDDENRKFIYVEIAFFERWWRQQSKAKKVKVKKLVDSGQ  123

Query  512  LEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            LEFINGG CMHDEA  HYIDMIDQTTLGHQ+IK +F   PR+G
Sbjct  124  LEFINGGMCMHDEATPHYIDMIDQTTLGHQFIKSEFGQVPRVG  166



>ref|NP_201416.1| Glycosyl hydrolase family protein [Arabidopsis thaliana]
 dbj|BAB10420.1| alpha-mannosidase [Arabidopsis thaliana]
 gb|AED98165.1| Glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=1047

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            YV Y T A +VPGKLNVHLVPH+HDDVGWLKTVDQYYVGSNN IQ ACV+NVLDS++ +L
Sbjct  33   YVKYGTEAKVVPGKLNVHLVPHSHDDVGWLKTVDQYYVGSNNRIQNACVRNVLDSVVDSL  92

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
            L D NRKF++ E AFF RWW  QSP  Q  VR LV SGQLEF+NGGW M+DEA  HYIDM
Sbjct  93   LRDPNRKFVFAEMAFFTRWWEEQSPERQEQVRRLVKSGQLEFVNGGWAMNDEATCHYIDM  152

Query  575  IDQTTLGHQYIKQQFNVTPR  634
            IDQTT GH++IKQQFN TPR
Sbjct  153  IDQTTKGHRFIKQQFNTTPR  172



>ref|XP_011099865.1| PREDICTED: alpha-mannosidase [Sesamum indicum]
Length=1012

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 126/165 (76%), Gaps = 8/165 (5%)
 Frame = +2

Query  167  FLSLTLAV-------GVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYY  325
            FLS  L +       G++  E  Y+ YDT + IV GKLNVHLV H+HDDVGWLKT+DQYY
Sbjct  7    FLSALLCIASALSSYGIVGVEG-YLKYDTGSGIVDGKLNVHLVAHSHDDVGWLKTIDQYY  65

Query  326  VGSNNSIQGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNS  505
            VGSNNSIQGACV+N LDS++ AL  D +RKFI+ E AFF RWW  QS  +Q  VR LV++
Sbjct  66   VGSNNSIQGACVENTLDSVVMALRRDPSRKFIFAEMAFFSRWWEEQSVEIQQEVRKLVDA  125

Query  506  GQLEFINGGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            G+LEF+NGGWCMHDEA THYIDMIDQTTLGHQ IK QFN TPR G
Sbjct  126  GRLEFVNGGWCMHDEATTHYIDMIDQTTLGHQLIKSQFNKTPRAG  170



>tpg|DAA46680.1| TPA: hypothetical protein ZEAMMB73_299553, partial [Zea mays]
Length=752

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +2

Query  236  AAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPALLADKNRK  415
            A +V GKLNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQGACV N LDS++ AL  D  RK
Sbjct  37   ATVVAGKLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQGACVMNTLDSVVDALARDPARK  96

Query  416  FIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDMIDQTTLG  595
            F+ VEQAFFQRWW  + P +Q+ VR LV+SGQLEFINGGWCMHDEAA HYIDMIDQTTLG
Sbjct  97   FVVVEQAFFQRWWAEKIPNIQAVVRKLVDSGQLEFINGGWCMHDEAAVHYIDMIDQTTLG  156

Query  596  HQYIKQQFNVTPRIG  640
            H+ IK+QFN TPR G
Sbjct  157  HRMIKKQFNKTPRAG  171



>ref|NP_001064140.1| Os10g0140200 [Oryza sativa Japonica Group]
 gb|ABG65904.1| glycosyl hydrolase family 38 protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26054.1| Os10g0140200 [Oryza sativa Japonica Group]
 gb|EEE50554.1| hypothetical protein OsJ_30682 [Oryza sativa Japonica Group]
Length=1004

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +2

Query  224  YDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPALLAD  403
            Y+TSA  V GKLNVHLVPH+HDDVGWLKT+DQY+VG+NNSIQGACV N LDS++ AL+ D
Sbjct  27   YNTSAGAVAGKLNVHLVPHSHDDVGWLKTIDQYFVGTNNSIQGACVMNTLDSVVDALILD  86

Query  404  KNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDMIDQ  583
              RKF++ EQAFFQRWW  +SP +Q+ V  LV+SGQLEFINGGWCMHDEAA HYIDMIDQ
Sbjct  87   PARKFVFAEQAFFQRWWAEKSPKIQAIVHKLVDSGQLEFINGGWCMHDEAAVHYIDMIDQ  146

Query  584  TTLGHQYIKQQFNVTPRIG  640
            TTLGH+ IK+QFN  PR G
Sbjct  147  TTLGHRVIKKQFNKIPRAG  165



>gb|EEC66555.1| hypothetical protein OsI_32713 [Oryza sativa Indica Group]
Length=1004

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +2

Query  224  YDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPALLAD  403
            Y+TSA  V GKLNVHLVPH+HDDVGWLKT+DQY+VG+NNSIQGACV N LDS++ AL+ D
Sbjct  27   YNTSAGAVAGKLNVHLVPHSHDDVGWLKTIDQYFVGTNNSIQGACVMNTLDSVVDALILD  86

Query  404  KNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDMIDQ  583
              RKF++ EQAFFQRWW  +SP +Q+ V  LV+SGQLEFINGGWCMHDEAA HYIDMIDQ
Sbjct  87   PARKFVFAEQAFFQRWWAEKSPKIQAIVHKLVDSGQLEFINGGWCMHDEAAVHYIDMIDQ  146

Query  584  TTLGHQYIKQQFNVTPRIG  640
            TTLGH+ IK+QFN  PR G
Sbjct  147  TTLGHRVIKKQFNKIPRAG  165



>ref|XP_006573549.1| PREDICTED: lysosomal alpha-mannosidase-like [Glycine max]
Length=1004

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  197  LCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLD  376
            LC     V Y+T A++VPGKLNVHL+ H+HDDVGWLKTVDQYYVGSNNSIQGACV+NVLD
Sbjct  20   LCGTVVCVKYNTGASVVPGKLNVHLIAHSHDDVGWLKTVDQYYVGSNNSIQGACVENVLD  79

Query  377  SLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAA  556
            S++ +L  ++ RKF++ E AFF RWW  Q+P  Q  VR LV++GQLEFINGGWCMHDEA 
Sbjct  80   SVVVSLQLNQKRKFVFAEMAFFHRWWVEQTPQTQVQVRKLVDAGQLEFINGGWCMHDEAT  139

Query  557  THYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            THYIDMIDQTTLGH++IK QFN  PR G
Sbjct  140  THYIDMIDQTTLGHRFIKNQFNKVPRAG  167



>ref|XP_010246823.1| PREDICTED: lysosomal alpha-mannosidase isoform X1 [Nelumbo nucifera]
 ref|XP_010246824.1| PREDICTED: lysosomal alpha-mannosidase isoform X1 [Nelumbo nucifera]
Length=1011

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPA  391
            KY+ Y+T A IV GKLNVHLVPH+HDDVGWLKT+DQYYVGSNNSIQGACV+ VLDS++ +
Sbjct  29   KYIKYNTGAGIVEGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNSIQGACVECVLDSVVES  88

Query  392  LLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYID  571
            L  D NRKF++ EQAFFQRWW  Q+   Q  V+ LV+SGQLEFINGGW MHDEA  HYID
Sbjct  89   LRRDPNRKFVFAEQAFFQRWWAEQNLETQEEVKKLVDSGQLEFINGGWSMHDEATCHYID  148

Query  572  MIDQTTLGHQYIKQQFNVTPRIG  640
            MIDQTTLGH+ IK+QFN  PR+G
Sbjct  149  MIDQTTLGHRMIKKQFNKVPRVG  171



>emb|CDX83641.1| BnaC07g23810D [Brassica napus]
Length=1022

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 130/158 (82%), Gaps = 2/158 (1%)
 Frame = +2

Query  167  FLSLTLAVGVLCAESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSI  346
             L  T+ +GV+ +E  Y+ Y+T+  IV  K+NVHLVPH+HDDVGWLKTVDQYYVG+NNSI
Sbjct  13   LLLATIVIGVVNSE--YIEYNTAPRIVTEKINVHLVPHSHDDVGWLKTVDQYYVGANNSI  70

Query  347  QGACVQNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFIN  526
            +GACV+NV++S+I +LL D+NRKFIYVE AFFQRWWR QS A +  V+ LV+SGQLEFIN
Sbjct  71   RGACVENVIESVIASLLDDQNRKFIYVEMAFFQRWWRQQSNAKKVKVKKLVDSGQLEFIN  130

Query  527  GGWCMHDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            GG CMHDEA  HYIDMIDQTTLGHQ+IK +F   PR+G
Sbjct  131  GGMCMHDEATPHYIDMIDQTTLGHQFIKSEFGQVPRVG  168



>ref|XP_010246825.1| PREDICTED: lysosomal alpha-mannosidase isoform X2 [Nelumbo nucifera]
Length=988

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPA  391
            KY+ Y+T A IV GKLNVHLVPH+HDDVGWLKT+DQYYVGSNNSIQGACV+ VLDS++ +
Sbjct  29   KYIKYNTGAGIVEGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNSIQGACVECVLDSVVES  88

Query  392  LLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYID  571
            L  D NRKF++ EQAFFQRWW  Q+   Q  V+ LV+SGQLEFINGGW MHDEA  HYID
Sbjct  89   LRRDPNRKFVFAEQAFFQRWWAEQNLETQEEVKKLVDSGQLEFINGGWSMHDEATCHYID  148

Query  572  MIDQTTLGHQYIKQQFNVTPRIG  640
            MIDQTTLGH+ IK+QFN  PR+G
Sbjct  149  MIDQTTLGHRMIKKQFNKVPRVG  171



>ref|XP_004289082.1| PREDICTED: alpha-mannosidase-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=1011

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            Y+ Y+TS+ +V GKLNVHLV H+HDDVGWLKTVDQYYVGSNNSIQ AC++NVLDS++ +L
Sbjct  31   YMKYNTSSGLVEGKLNVHLVAHSHDDVGWLKTVDQYYVGSNNSIQAACIENVLDSVVESL  90

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
              D NRKF++ E AFFQRWW  QS  MQ  VR LV +GQLEF+NGGWCMHDEA  HYIDM
Sbjct  91   FRDPNRKFVFAEMAFFQRWWLTQSEEMQERVRKLVEAGQLEFVNGGWCMHDEATCHYIDM  150

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH+ IK+QFN  PR G
Sbjct  151  IDQTTLGHRAIKEQFNKAPRAG  172



>ref|XP_008659412.1| PREDICTED: lysosomal alpha-mannosidase-like [Zea mays]
Length=1007

 Score =   230 bits (587),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +2

Query  233  SAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPALLADKNR  412
            +A +V GKLNVHLVPH+HDDVGWLKTVDQYYVGSNNSIQGACV N LDS++ AL  D  R
Sbjct  31   NATVVAGKLNVHLVPHSHDDVGWLKTVDQYYVGSNNSIQGACVMNTLDSVVDALARDPAR  90

Query  413  KFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDMIDQTTL  592
            KF+ VEQAFFQRWW  +SP +Q  V  LV+SGQLEFINGGWCMHDEAA HYIDMIDQTTL
Sbjct  91   KFVVVEQAFFQRWWAEKSPTIQDIVHKLVDSGQLEFINGGWCMHDEAAVHYIDMIDQTTL  150

Query  593  GHQYIKQQFNVTPRIG  640
            GH+ IK+QFN TPR G
Sbjct  151  GHRMIKKQFNKTPRAG  166



>ref|XP_011462206.1| PREDICTED: alpha-mannosidase-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=1028

 Score =   230 bits (587),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  YVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLIPAL  394
            Y+ Y+TS+ +V GKLNVHLV H+HDDVGWLKTVDQYYVGSNNSIQ AC++NVLDS++ +L
Sbjct  31   YMKYNTSSGLVEGKLNVHLVAHSHDDVGWLKTVDQYYVGSNNSIQAACIENVLDSVVESL  90

Query  395  LADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATHYIDM  574
              D NRKF++ E AFFQRWW  QS  MQ  VR LV +GQLEF+NGGWCMHDEA  HYIDM
Sbjct  91   FRDPNRKFVFAEMAFFQRWWLTQSEEMQERVRKLVEAGQLEFVNGGWCMHDEATCHYIDM  150

Query  575  IDQTTLGHQYIKQQFNVTPRIG  640
            IDQTTLGH+ IK+QFN  PR G
Sbjct  151  IDQTTLGHRAIKEQFNKAPRAG  172



>dbj|BAJ95309.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1010

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 122/146 (84%), Gaps = 8/146 (5%)
 Frame = +2

Query  203  AESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSL  382
             E+ Y+ Y+TSA +V GKLNVH        VGWLKTVDQYYVGSNNSIQGACVQNVLDSL
Sbjct  22   GEAAYIPYNTSAGVVNGKLNVH--------VGWLKTVDQYYVGSNNSIQGACVQNVLDSL  73

Query  383  IPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCMHDEAATH  562
            +PALL D+NRKFIYVEQAFFQRWWR QS  ++ TV+GLV+SG+LEFINGG CMHDEA  H
Sbjct  74   VPALLRDENRKFIYVEQAFFQRWWRQQSDIIKDTVKGLVSSGRLEFINGGMCMHDEATVH  133

Query  563  YIDMIDQTTLGHQYIKQQFNVTPRIG  640
            YIDMIDQTTLGH++IK++F   PRIG
Sbjct  134  YIDMIDQTTLGHRFIKEEFGQIPRIG  159



>ref|XP_002265360.1| PREDICTED: alpha-mannosidase [Vitis vinifera]
 emb|CBI17353.3| unnamed protein product [Vitis vinifera]
Length=1006

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 122/153 (80%), Gaps = 4/153 (3%)
 Frame = +2

Query  194  VLCA----ESKYVVYDTSAAIVPGKLNVHLVPHTHDDVGWLKTVDQYYVGSNNSIQGACV  361
            VLC+       Y+ Y+T A IV GKLNVHLVPH+HDDVGWLKT+DQYYVGSNNSIQGACV
Sbjct  15   VLCSYVTVNGGYIKYNTGAGIVEGKLNVHLVPHSHDDVGWLKTIDQYYVGSNNSIQGACV  74

Query  362  QNVLDSLIPALLADKNRKFIYVEQAFFQRWWRNQSPAMQSTVRGLVNSGQLEFINGGWCM  541
            +NVLDS++ +LL ++NRKF++ E AFF RWW  QS  +Q TV  LV+ G+LEFINGGWCM
Sbjct  75   ENVLDSVVESLLRNQNRKFVFAEMAFFSRWWYEQSEEIQETVGKLVDGGRLEFINGGWCM  134

Query  542  HDEAATHYIDMIDQTTLGHQYIKQQFNVTPRIG  640
            HDEA  HYIDMIDQTTLGH+ IK+ FN  PR G
Sbjct  135  HDEATVHYIDMIDQTTLGHRLIKKAFNKAPRAG  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375