BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS056F04

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAR00230.1|  flavonoid 3'-hydroxylase                                353   3e-119   Ipomoea purpurea
dbj|BAD00187.1|  flavonoid 3'-hydroxylase                               357   4e-118   Ipomoea nil [qian niu]
gb|AAR00229.1|  flavonoid 3'-hydroxylase                                352   3e-116   Ipomoea purpurea
gb|ABW69693.1|  flavonoid 3'-hydrogenase                                350   2e-115   Ipomoea purpurea
dbj|BAD00189.1|  flavonoid 3'-hydroxylase                               342   4e-112   Ipomoea tricolor [campanilla]
gb|ACL26685.1|  flavonoid 3'-hydroxylase                                330   2e-107   Ipomoea coccinea [red morning-glory]
gb|AAS46257.1|  flavonoid 3'-hydroxylase                                327   2e-106   Ipomoea quamoclit [bejuco de cipres]
gb|ACL26686.1|  flavonoid 3'-hydroxylase                                324   4e-105   Ipomoea ternifolia
gb|ACS71532.1|  flavonoid 3' hydroxylase                                323   1e-104   Ipomoea horsfalliae [Kuhio-vine]
gb|AEH42499.1|  flavonoid 3'-hydroxylase                                320   2e-103   Ipomoea batatas [batate]
gb|ABW86861.1|  flavonoid 3'-hydroxylase                                318   8e-103   Ipomoea batatas [batate]
gb|AEH42501.1|  flavonoid 3'-hydroxylase                                312   2e-100   Ipomoea batatas [batate]
gb|ACB29666.1|  flavonoid 3'-hydroxylase                                312   2e-100   Ipomoea batatas [batate]
gb|AEH42500.1|  flavonoid 3'-hydroxylase                                308   6e-99    Ipomoea batatas [batate]
dbj|BAJ11756.1|  flavonoid 3'-hydroxylase                               296   3e-94    Calystegia pubescens
dbj|BAJ08322.1|  flavonoid 3'-hydroxylase                               294   2e-93    Calystegia soldanella
dbj|BAE47005.1|  flavonoid 3'-hydroxylase                               275   4e-86    Vitis vinifera
emb|CAI54278.1|  flavonoid-3'-hydroxylase                               275   5e-86    Vitis vinifera
emb|CAN68303.1|  hypothetical protein VITISV_041731                     274   7e-86    Vitis vinifera
dbj|BAE47003.1|  flavonoid 3'-hydroxylase                               267   2e-85    Vitis vinifera
ref|NP_001267916.1|  flavonoid 3' hydroxylase                           272   4e-85    Vitis vinifera
gb|ACN38268.1|  flavonoid 3' hydroxylase                                272   5e-85    Vitis amurensis
emb|CAN62275.1|  hypothetical protein VITISV_007552                     270   9e-85    Vitis vinifera
ref|XP_002284151.1|  PREDICTED: flavonoid 3'-monooxygenase              271   1e-84    Vitis vinifera
ref|XP_009788494.1|  PREDICTED: flavonoid 3'-monooxygenase              271   1e-84    Nicotiana sylvestris
dbj|BAE47004.1|  flavonoid 3'-hydroxylase                               269   7e-84    Vitis vinifera
sp|Q9SBQ9.1|F3PH_PETHY  RecName: Full=Flavonoid 3'-monooxygenase;...    268   1e-83    Petunia x hybrida [garden petunia]
emb|CDP19009.1|  unnamed protein product                                265   2e-82    Coffea canephora [robusta coffee]
dbj|BAP94456.1|  flavonoid 3'-hydroxylas                                265   4e-82    Eustoma exaltatum subsp. russellianum [bluebells]
gb|AGO02167.1|  flavonoid 3'-hydroxylase                                264   4e-82    Nekemias grossedentata
gb|AHZ08763.1|  flavonoid 3'-monooxygenase                              265   5e-82    Nicotiana tabacum [American tobacco]
dbj|BAO58432.1|  flavonoid 3'-hydroxylase                               263   1e-81    Vaccinium ashei
gb|AHA49900.1|  flavonoid 3' hydroxylase                                263   2e-81    Malus hybrid cultivar
ref|XP_008374610.1|  PREDICTED: flavonoid 3'-monooxygenase-like         263   2e-81    Malus domestica [apple tree]
gb|ACR14869.1|  flavonoid 3' hydroxylase IIb                            263   2e-81    Malus domestica [apple tree]
gb|ABM46853.1|  flavonoid 3'-hydroxylase                                262   3e-81    Ageratina adenophora
gb|ACO35753.1|  flavonoid 3'-hydroxylase                                262   3e-81    Bidens aurea
emb|CDP19008.1|  unnamed protein product                                262   3e-81    Coffea canephora [robusta coffee]
gb|AHI58943.1|  flavonoid 3'-hydroxylase                                262   4e-81    Nicotiana tabacum [American tobacco]
ref|XP_009597267.1|  PREDICTED: flavonoid 3'-monooxygenase              262   5e-81    Nicotiana tomentosiformis
gb|AFI25037.1|  flavonoid 3'-hydroxylase                                251   5e-81    Populus deltoides x Populus tremuloides
gb|AJO67965.1|  flavonoid-3'-hydroxylase                                252   6e-81    Prunus avium [gean]
gb|ACN65825.1|  flavonoid 3'-hydroxylase                                261   1e-80    Cichorium intybus [radicchio]
gb|AIY22749.1|  flavonoid 3'-hydroxylase                                260   2e-80    Iochroma cyaneum
gb|AFQ92056.1|  flavonoid 3' hydroxylase                                259   4e-80    Pyrus pyrifolia [sha li]
ref|XP_002319761.1|  hypothetical protein POPTR_0013s07050g             259   4e-80    Populus trichocarpa [western balsam poplar]
ref|XP_006345132.1|  PREDICTED: flavonoid 3'-monooxygenase-like         258   9e-80    Solanum tuberosum [potatoes]
gb|ABB29899.1|  flavonoid 3'-hydroxylase                                258   9e-80    Osteospermum hybrid cultivar
ref|XP_011011227.1|  PREDICTED: flavonoid 3'-monooxygenase              258   1e-79    Populus euphratica
ref|XP_007037547.1|  Flavonoid 3'-hydroxylase isoform 1                 258   1e-79    
ref|XP_010695197.1|  PREDICTED: flavonoid 3'-monooxygenase              258   1e-79    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAN62871.1|  flavonoid 3'-hydroxylase                               258   1e-79    Dianthus caryophyllus [carnation]
gb|AIY22747.1|  flavonoid 3'-hydroxylase                                258   1e-79    Iochroma calycinum
ref|NP_001289844.1|  flavonoid 3'-monooxygenase                         258   1e-79    Solanum lycopersicum
gb|AIY22748.1|  flavonoid 3'-hydroxylase                                258   2e-79    Iochroma calycinum
gb|ABA64468.1|  flavonoid 3'-hydroxylase                                258   2e-79    Gerbera hybrid cultivar
ref|XP_007037548.1|  Flavonoid 3'-hydroxylase isoform 2                 258   2e-79    Theobroma cacao [chocolate]
gb|ADB77826.1|  flavonoid 3'-hydroxylase allele 2                       258   2e-79    Dahlia pinnata
gb|AEA06595.1|  flavonoid 3'-hydroxylase                                258   2e-79    Chromolaena odorata
gb|AGM46642.1|  flavonoid 3'-hydroxylase protein                        246   2e-79    Apium graveolens
gb|AEF30421.1|  flavonoid 3'-hydroxylase                                249   4e-79    Fagopyrum tataricum [Kangra buckwheat]
ref|XP_009338402.1|  PREDICTED: flavonoid 3'-monooxygenase              256   5e-79    Pyrus x bretschneideri [bai li]
gb|KDP31334.1|  hypothetical protein JCGZ_11710                         256   7e-79    Jatropha curcas
gb|ABC47161.1|  flavonoid 3'-hydroxylase                                256   1e-78    Pilosella officinarum [mouse-ear hawkweed]
ref|XP_008393217.1|  PREDICTED: flavonoid 3'-monooxygenase-like         254   4e-78    
gb|ACR14867.1|  flavonoid 3' hydroxylase                                254   4e-78    Malus domestica [apple tree]
gb|ACV74415.1|  putative flavonoid-3'-hydroxylase                       254   5e-78    Camellia sinensis [black tea]
gb|ADZ54783.1|  flavonoid 3'-monooxygenase                              252   2e-77    Prunus avium [gean]
gb|KDO54631.1|  hypothetical protein CISIN_1g020877mg                   246   2e-77    Citrus sinensis [apfelsine]
gb|KJB51033.1|  hypothetical protein B456_008G198200                    249   5e-77    Gossypium raimondii
ref|XP_007209917.1|  hypothetical protein PRUPE_ppa004433mg             251   6e-77    Prunus persica
gb|ADK56126.1|  putative flavonoid 3'-hydroxylase                       251   6e-77    Coreopsis grandiflora
gb|KDO37751.1|  hypothetical protein CISIN_1g042286mg                   244   7e-77    Citrus sinensis [apfelsine]
gb|AJA79074.1|  flavonoid 3' hydroxylase                                251   7e-77    Prunus persica
dbj|BAN05297.1|  flavonoid 3'-hydroxylase                               251   8e-77    Dianthus caryophyllus [carnation]
gb|ADB77825.1|  flavonoid 3'-hydroxylase allele 1                       251   8e-77    Dahlia pinnata
dbj|BAJ17668.1|  flavonoid 3' hydroxylase                               251   8e-77    Gynura bicolor
dbj|BAF96945.1|  flavonoid 3'-hydroxylase                               249   1e-76    Rhododendron x pulchrum
ref|XP_010030596.1|  PREDICTED: flavonoid 3'-monooxygenase-like         250   1e-76    Eucalyptus grandis [rose gum]
ref|XP_009771410.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    250   1e-76    Nicotiana sylvestris
gb|AAG49298.1|AF313488_1  putative flavonoid 3'-hydroxylase             250   1e-76    Callistephus chinensis [Chinese aster]
gb|ADM26615.1|  flavonoid 3'-hydroxylase                                250   2e-76    Cynara cardunculus var. scolymus [artichoke]
ref|XP_010259651.1|  PREDICTED: flavonoid 3'-monooxygenase              250   2e-76    Nelumbo nucifera [Indian lotus]
gb|ACO35752.1|  flavonoid 3'-hydroxylase                                249   2e-76    Cosmos sulphureus [orange cosmos]
dbj|BAJ16330.1|  flavonoid 3'-hydroxylase                               249   3e-76    Antirrhinum kelloggii
ref|XP_008240031.1|  PREDICTED: flavonoid 3'-monooxygenase              249   5e-76    Prunus mume [ume]
gb|ADA85878.1|  flavonoid 3'-hydroxylase                                248   5e-76    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|KHG07922.1|  Flavonoid 3',5'-hydroxylase                             248   9e-76    Gossypium arboreum [tree cotton]
gb|KJB51032.1|  hypothetical protein B456_008G198200                    248   1e-75    Gossypium raimondii
gb|ADA85883.1|  flavonoid 3'-hydroxylase                                248   1e-75    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADA85882.1|  flavonoid 3'-hydroxylase                                248   1e-75    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADT63065.1|  flavonoid 3'-hydroxylase                                246   2e-75    Fagopyrum esculentum
gb|AGC29948.1|  CYP75B65                                                247   2e-75    Sinopodophyllum hexandrum [Himalayan mayapple]
gb|AHZ31753.1|  flavonoid 3'-hydroxylase                                247   3e-75    Viola x wittrockiana
gb|AEN71546.1|  flavanone 3'-hydroxylase                                246   3e-75    Paeonia suffruticosa [moutan peony]
dbj|BAF49324.1|  flavonoid 3'-hydroxylase                               246   4e-75    Lobelia erinus
gb|ADP24158.1|  flavonoid 3'-hydroxylase                                246   4e-75    Gossypium hirsutum [American cotton]
gb|KEH32010.1|  flavonoid hydroxylase                                   246   4e-75    Medicago truncatula
ref|XP_011072866.1|  PREDICTED: flavonoid 3'-monooxygenase              246   5e-75    Sesamum indicum [beniseed]
gb|AEX07282.1|  F3'H                                                    246   5e-75    Arachis hypogaea [goober]
gb|ACY06905.1|  flavonoid 3'-hydroxylase                                246   5e-75    Gossypium hirsutum [American cotton]
dbj|BAE71221.1|  putative flavonoid 3'-hydroxylase                      246   6e-75    Trifolium pratense [peavine clover]
gb|ACO35755.1|  chalcone 3-hydroxylase                                  245   9e-75    Cosmos sulphureus [orange cosmos]
ref|XP_006440736.1|  hypothetical protein CICLE_v10019637mg             246   1e-74    
gb|AIU98513.1|  flavonoid 3'-hydroxylase                                245   2e-74    Paeonia suffruticosa [moutan peony]
gb|AGL81348.1|  flavanone 3' hydroxylase                                244   2e-74    Pyrus communis
gb|ADA85879.1|  flavonoid 3'-hydroxylase                                244   2e-74    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ACO35756.1|  flavonoid 3'-hydroxylase                                244   2e-74    Tagetes erecta [big marigold]
gb|AAO47850.1|  defective flavonoid 3'-hydroxylase                      238   3e-74    Glycine max [soybeans]
gb|ACO35754.1|  flavonoid 3'-hydroxylase                                244   3e-74    Dahlia pinnata
ref|XP_006477655.1|  PREDICTED: flavonoid 3'-monooxygenase-like         244   3e-74    Citrus sinensis [apfelsine]
gb|ACN65827.1|  flavonoid 3'-hydroxylase                                243   9e-74    Centaurea cyanus [bachelor's-button]
gb|ADA85881.1|  flavonoid 3'-hydroxylase                                243   1e-73    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_004508739.1|  PREDICTED: flavonoid 3'-monooxygenase-like         242   1e-73    
gb|ADZ28515.1|  flavonoid-3'-hydroxylase                                242   2e-73    Camellia nitidissima
ref|XP_010491421.1|  PREDICTED: flavonoid 3'-monooxygenase-like         242   2e-73    Camelina sativa [gold-of-pleasure]
gb|ACM62746.1|  flavonoid 3'-hydroxylase                                242   2e-73    Garcinia mangostana [mangosteen]
gb|AHY35313.1|  flavonoid 3'-hydroxylase 1                              242   2e-73    Morus notabilis
ref|XP_010105826.1|  Flavonoid 3'-monooxygenase                         242   2e-73    Morus notabilis
gb|ADA85880.1|  flavonoid 3'-hydroxylase                                242   2e-73    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AAO47844.1|  gray pubescence flavonoid 3'-hydroxylase                238   3e-73    Glycine max [soybeans]
ref|XP_007138248.1|  hypothetical protein PHAVU_009G192400g             240   7e-73    Phaseolus vulgaris [French bean]
ref|XP_006399285.1|  hypothetical protein EUTSA_v10013289mg             240   8e-73    Eutrema salsugineum [saltwater cress]
ref|XP_010258076.1|  PREDICTED: flavonoid 3'-monooxygenase-like         240   9e-73    Nelumbo nucifera [Indian lotus]
gb|ACO35757.1|  flavonoid 3'-hydroxylase                                240   1e-72    Rudbeckia hirta
gb|ABY89687.1|  flavonoid 3` hydroxylase 1 protein                      240   1e-72    Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_003598945.1|  Flavonoid 3'-hydroxylase                           240   1e-72    Medicago truncatula
emb|CDX69984.1|  BnaA10g23330D                                          239   2e-72    
gb|ABC58722.1|  flavonoid 3'-hydroxylase                                239   2e-72    Brassica napus [oilseed rape]
gb|KEH33153.1|  flavonoid hydroxylase                                   239   2e-72    Medicago truncatula
ref|XP_009122411.1|  PREDICTED: flavonoid 3'-monooxygenase              239   2e-72    Brassica rapa
gb|ABY89688.1|  flavonoid 3` hydroxylase 2 protein                      239   2e-72    Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_010423152.1|  PREDICTED: flavonoid 3'-monooxygenase-like         239   2e-72    Camelina sativa [gold-of-pleasure]
gb|AFI71898.1|  flavonoid 3'-hydroxylase                                239   2e-72    Paeonia lactiflora [common garden peony]
gb|AIY51699.1|  flavonoid 3'-hydroxylase                                239   4e-72    Penstemon barbatus
gb|EYU23554.1|  hypothetical protein MIMGU_mgv1a004224mg                239   7e-72    Erythranthe guttata [common monkey flower]
gb|ABB53383.1|  flavonoid-3'-hydroxylase                                238   1e-71    Antirrhinum majus [garden snapdragon]
gb|KHN17812.1|  Flavonoid 3'-monooxygenase                              238   1e-71    Glycine soja [wild soybean]
ref|NP_001237015.1|  flavonoid 3'-hydroxylase                           238   1e-71    Glycine max [soybeans]
gb|AGO03825.1|  flavonoid 3`5`-hydroxylase                              238   1e-71    Cichorium intybus [radicchio]
gb|ACR33790.1|  flavonoid 3'-hydroxylase                                238   1e-71    Glycine max [soybeans]
gb|AAG49315.1|AF315465_1  flavonoid 3'-hydroxylase                      237   1e-71    Pelargonium x hortorum [bedding geranium]
ref|XP_002871298.1|  hypothetical protein ARALYDRAFT_487632             237   1e-71    
gb|AIB06740.1|  flavanone 3'-hydroxylase                                237   2e-71    Mangifera indica
gb|EPS57881.1|  flavonoid 3'-hydroxylase                                234   3e-71    Genlisea aurea
ref|XP_004515962.1|  PREDICTED: flavonoid 3'-monooxygenase-like         236   3e-71    
gb|AGI16386.1|  flavonoid 3' hydroxylase                                236   4e-71    Ribes nigrum [European black currant]
dbj|BAD91808.1|  flavonoid 3'-hydroxylase                               236   4e-71    Gentiana triflora
emb|CDX99037.1|  BnaC09g47980D                                          240   4e-71    
gb|AIY51698.1|  flavonoid 3'-hydroxylase                                236   6e-71    Penstemon neomexicanus
ref|XP_010452770.1|  PREDICTED: flavonoid 3'-monooxygenase              236   6e-71    Camelina sativa [gold-of-pleasure]
gb|AEE60888.1|  flavonoid 3'-hydroxylase                                235   1e-70    Fragaria chiloensis
dbj|BAL63027.1|  flavonoid 3'-hydroxylase                               234   1e-70    Fragaria x ananassa
gb|ADE80941.1|  flavonoid 3'-hydroxylase                                234   2e-70    Epimedium sagittatum
gb|AEE60886.1|  flavonoid 3'-hydroxylase                                234   2e-70    Fragaria x ananassa
ref|NP_001274347.1|  uncharacterized protein LOC101314754               234   2e-70    Fragaria vesca [alpine strawberry]
gb|AEE60887.1|  flavonoid 3'-hydroxylase                                234   2e-70    Fragaria virginiana
gb|AIT52346.1|  flavonoid 3'-monooxygenase 1                            234   2e-70    Daucus carota [carrots]
gb|AEE60883.1|  flavonoid 3'-hydroxylase                                234   2e-70    Fragaria vesca [alpine strawberry]
gb|ACN65826.1|  flavonoid 3'-hydroxylase                                234   3e-70    Echinops bannaticus
gb|AAG49301.1|AF313491_1  flavonoid 3'-hydroxylase                      234   3e-70    Matthiola incana
gb|AGT28741.1|  flavonoid 3'-hydroxylase                                233   4e-70    Fragaria x ananassa
gb|AEE60885.1|  flavonoid 3'-hydroxylase                                233   8e-70    Fragaria x ananassa
gb|ACJ85671.1|  unknown                                                 230   8e-70    Medicago truncatula
gb|ABB43031.1|  flavonoid 3'5'-hydroxylase                              231   3e-69    Osteospermum hybrid cultivar
gb|AJD25177.1|  cytochrome P450 CYP75B79                                231   4e-69    Salvia miltiorrhiza [Chinese salvia]
gb|AGO03824.1|  flavonoid 3`5`-hydroxylase                              230   8e-69    Echinops bannaticus
gb|AGY55961.1|  flavonoid 3'-hydroxylase                                225   9e-69    Punica granatum [granado]
dbj|BAB59005.1|  flavonoid 3'-hydroxylase                               230   9e-69    Perilla frutescens var. crispa
ref|NP_196416.1|  Flavonoid 3'-monooxygenase                            230   1e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010030575.1|  PREDICTED: flavonoid 3'-monooxygenase-like         229   2e-68    Eucalyptus grandis [rose gum]
gb|AES69199.2|  flavonoid hydroxylase                                   229   2e-68    Medicago truncatula
ref|XP_003598948.1|  Flavonoid 3'-hydroxylase                           228   3e-67    
ref|XP_006287545.1|  hypothetical protein CARUB_v10000754mg             225   6e-67    Capsella rubella
gb|AAG49299.1|AF313489_1  flavonoid 3',5'-hydroxylase                   221   2e-65    Callistephus chinensis [Chinese aster]
emb|CDP16533.1|  unnamed protein product                                219   2e-65    Coffea canephora [robusta coffee]
ref|XP_010522799.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    217   5e-65    
gb|AGT50310.1|  flavonoid 3'-hydroxylase                                219   6e-65    Meconopsis simplicifolia
ref|XP_010105825.1|  Flavonoid 3'-monooxygenase                         219   8e-65    Morus notabilis
gb|AGT50309.1|  flavonoid 3'-hydroxylase                                218   1e-64    Meconopsis delavayi
ref|XP_010522791.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    218   1e-64    Tarenaya hassleriana [spider flower]
ref|XP_003525447.1|  PREDICTED: flavonoid 3'-monooxygenase-like         219   1e-64    Glycine max [soybeans]
gb|AGT50311.1|  flavonoid 3'-hydroxylase                                217   3e-64    Meconopsis horridula [prickly blue-poppy]
ref|XP_010522775.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    217   3e-64    Tarenaya hassleriana [spider flower]
ref|XP_010522758.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    217   3e-64    Tarenaya hassleriana [spider flower]
gb|ABB43030.1|  flavonoid 3'5'-hydroxylase                              218   4e-64    Pericallis cruenta
gb|AJD25178.1|  cytochrome P450 CYP75B80                                217   6e-64    Salvia miltiorrhiza [Chinese salvia]
gb|AGT50313.1|  flavonoid 3'-hydroxylase                                216   8e-64    Meconopsis lancifolia
ref|XP_002514665.1|  flavonoid 3-hydroxylase, putative                  215   2e-63    
gb|AGT50318.1|  flavonoid 3'-hydroxylase                                215   2e-63    Meconopsis punicea [red poppywort]
ref|XP_010522740.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    217   3e-63    Tarenaya hassleriana [spider flower]
ref|XP_010522750.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    216   3e-63    
gb|AGO03826.1|  flavonoid 3`5`-hydroxylase                              215   5e-63    Billardiera heterophylla
gb|AAX19888.1|  flavonoid-3',5'-hydroxylase                             214   6e-63    Pericallis cruenta
gb|KHN18348.1|  Flavonoid 3'-monooxygenase                              215   6e-63    Glycine soja [wild soybean]
dbj|BAE72874.1|  flavonoid 3'-hydroxylase                               213   1e-62    Glandularia x hybrida [garden verbena]
dbj|BAB87838.1|  flavonoid 3'-hydroxylase                               214   1e-62    Torenia hybrid cultivar
ref|XP_003525448.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    213   2e-62    Glycine max [soybeans]
gb|KHN48735.1|  Flavonoid 3'-monooxygenase                              213   3e-62    Glycine soja [wild soybean]
ref|XP_003550701.1|  PREDICTED: flavonoid 3'-monooxygenase-like         212   8e-62    
dbj|BAB87839.1|  flavonoid 3'-hydroxalase                               209   2e-61    Torenia hybrid cultivar
ref|XP_010030579.1|  PREDICTED: flavonoid 3'-monooxygenase-like         208   1e-60    Eucalyptus grandis [rose gum]
gb|AFK73718.1|  cytochrome P450                                         207   3e-60    Papaver somniferum
gb|AHY35314.1|  flavonoid 3'-hydroxylase 2                              207   4e-60    Morus notabilis
dbj|BAM28972.1|  flavonoid 3'-hydroxylase                               206   2e-59    Lilium hybrid division I
gb|AHL83556.1|  flavonoid-3'-hydroxylase                                205   3e-59    Iris x hollandica [Dutch iris]
dbj|BAM28971.1|  flavonoid 3'-hydroxylase                               204   7e-59    Lilium hybrid division I
ref|XP_008453263.1|  PREDICTED: flavonoid 3'-monooxygenase              197   2e-56    Cucumis melo [Oriental melon]
gb|KCW83706.1|  hypothetical protein EUGRSUZ_B00580                     194   2e-55    Eucalyptus grandis [rose gum]
ref|XP_003525450.1|  PREDICTED: flavonoid 3'-monooxygenase-like         195   2e-55    Glycine max [soybeans]
gb|KCW83705.1|  hypothetical protein EUGRSUZ_B00580                     194   2e-55    Eucalyptus grandis [rose gum]
gb|KHN48734.1|  Flavonoid 3'-monooxygenase                              194   2e-55    Glycine soja [wild soybean]
ref|XP_006665050.1|  PREDICTED: flavonoid 3'-monooxygenase-like         194   4e-55    Oryza brachyantha
gb|AAS48419.1|  flavonoid 3'-hydroxylase                                193   6e-55    Allium cepa
ref|XP_009394321.1|  PREDICTED: flavonoid 3'-monooxygenase              193   1e-54    
gb|AGJ50589.1|  flavonoid 3'-hydroxylase                                192   1e-54    Tulipa fosteriana
gb|AGT50323.1|  flavonoid 3'-hydroxylase                                191   1e-54    Meconopsis pseudohorridula
gb|AFW72123.1|  red aleurone1                                           192   3e-54    
gb|AIC73642.1|  flavonoid 3'-hydroxylase                                191   4e-54    Anthurium andraeanum [flamingo-lily]
gb|KGN63720.1|  Flavonoid 3' hydroxylase                                191   5e-54    Cucumis sativus [cucumbers]
ref|XP_004138192.1|  PREDICTED: flavonoid 3'-monooxygenase-like         191   5e-54    Cucumis sativus [cucumbers]
ref|XP_004983036.1|  PREDICTED: flavonoid 3'-monooxygenase-like         191   7e-54    Setaria italica
dbj|BAM28973.1|  flavonoid 3'-hydroxylase                               189   1e-53    Lilium hybrid division I
gb|AGT50312.1|  flavonoid 3'-hydroxylase                                189   1e-53    Meconopsis racemosa
gb|AGT50315.1|  flavonoid 3'-hydroxylase                                189   1e-53    Meconopsis betonicifolia [Himalayan blue-poppy]
gb|AGT50317.1|  flavonoid 3'-hydroxylase                                188   2e-53    Meconopsis zangnanensis
gb|AGT50324.1|  flavonoid 3'-hydroxylase                                188   2e-53    Papaver nudicaule [Arctic poppy]
gb|AGT50314.1|  flavonoid 3'-hydroxylase                                187   3e-53    Meconopsis henrici
dbj|BAH22519.1|  flavonoid 3' hydroxylase                               189   4e-53    Tricyrtis hirta
gb|AGT50325.1|  flavonoid 3'-hydroxylase                                187   5e-53    Papaver radicatum
gb|AGT50316.1|  flavonoid 3'-hydroxylase                                187   5e-53    Meconopsis integrifolia [Farrer's lampshade-poppy]
gb|AGT50319.1|  flavonoid 3'-hydroxylase                                187   5e-53    Meconopsis quintuplinervia
gb|AGT50321.1|  flavonoid 3'-hydroxylase                                186   8e-53    Meconopsis wilsonii
ref|NP_001064338.1|  Os10g0320100                                       187   1e-52    
gb|AFP95893.1|  F3'H                                                    187   2e-52    Narcissus tazetta
gb|AGG40645.1|  flavanone 3'-hydroxylase                                185   1e-51    Narcissus tazetta
ref|XP_008678758.1|  PREDICTED: flavonoid 3'-monooxygenase-like         184   2e-51    Zea mays [maize]
gb|ABG54319.1|  flavonoid 3'-hydroxylase                                184   2e-51    Sorghum bicolor [broomcorn]
emb|CDP16353.1|  unnamed protein product                                174   2e-51    Coffea canephora [robusta coffee]
gb|ABG54320.1|  flavonoid 3'-hydroxylase                                183   4e-51    Sorghum bicolor [broomcorn]
ref|XP_002452380.1|  hypothetical protein SORBIDRAFT_04g024710          183   4e-51    Sorghum bicolor [broomcorn]
gb|AGT50322.1|  flavonoid 3'-hydroxylase                                181   5e-51    Meconopsis gracilipes
gb|AII26680.1|  flavonoid 3'-hydroxylase                                183   7e-51    Indosasa hispida
gb|AEF33624.1|  flavonoid 3' hydroxylase                                182   9e-51    Zea mays [maize]
ref|XP_002439914.1|  hypothetical protein SORBIDRAFT_09g022480          182   1e-50    Sorghum bicolor [broomcorn]
ref|XP_002454110.1|  hypothetical protein SORBIDRAFT_04g024750          182   1e-50    
gb|ABG54321.1|  flavonoid 3'-hydroxylase                                182   1e-50    Sorghum bicolor [broomcorn]
ref|XP_002452385.1|  hypothetical protein SORBIDRAFT_04g024730          182   1e-50    Sorghum bicolor [broomcorn]
gb|AFW62812.1|  putative cytochrome P450 superfamily protein            184   6e-50    
ref|XP_008791304.1|  PREDICTED: flavonoid 3'-monooxygenase-like         179   1e-49    Phoenix dactylifera
gb|AAV74194.1|  flavonoid 3'-hydroxylase                                179   1e-49    Sorghum bicolor [broomcorn]
gb|AII26679.1|  flavonoid 3'-monooxygenase                              179   2e-49    Indosasa hispida
gb|AGT50320.1|  flavonoid 3'-hydroxylase                                177   3e-49    Meconopsis paniculata
gb|ADX95997.1|  flavonoid 3'-hydroxylase                                166   2e-48    Chrysanthemum x morifolium [florist's chrysanthemum]
dbj|BAJ95115.1|  predicted protein                                      175   6e-48    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006661696.1|  PREDICTED: flavonoid 3'-monooxygenase-like         174   2e-47    
ref|NP_001141292.1|  uncharacterized protein LOC100273383               172   2e-47    
dbj|BAB17054.1|  unnamed protein product                                164   3e-47    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010939156.1|  PREDICTED: flavonoid 3'-monooxygenase-like         173   3e-47    Elaeis guineensis
ref|XP_003574810.2|  PREDICTED: flavonoid 3'-monooxygenase-like         173   5e-47    Brachypodium distachyon [annual false brome]
dbj|BAJ98136.1|  predicted protein                                      172   5e-47    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACG38346.1|  flavonoid 3-monooxygenase                               172   1e-46    Zea mays [maize]
gb|EAY78004.1|  hypothetical protein OsI_33044                          172   1e-46    Oryza sativa Indica Group [Indian rice]
ref|NP_001146311.1|  uncharacterized protein LOC100279887               172   1e-46    Zea mays [maize]
ref|XP_008678806.1|  PREDICTED: flavonoid 3'-monooxygenase-like         172   1e-46    
ref|NP_001064333.1|  Os10g0317900                                       172   1e-46    
gb|EMS47585.1|  Flavonoid 3'-monooxygenase                              164   2e-45    Triticum urartu
ref|XP_003577475.1|  PREDICTED: flavonoid 3'-monooxygenase-like         169   2e-45    Brachypodium distachyon [annual false brome]
dbj|BAH89259.1|  putative flavonoid 3'-hydroxylase                      166   4e-45    Diospyros kaki [Japanese persimmon]
ref|XP_010233685.1|  PREDICTED: flavonoid 3'-monooxygenase-like         166   2e-44    Brachypodium distachyon [annual false brome]
dbj|BAJ93256.1|  predicted protein                                      163   1e-43    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACL26688.1|  flavonoid 3'-hydroxylase                                158   1e-43    Ipomoea lobata [cresta de gallo]
gb|ACL26687.1|  flavonoid 3'-hydroxylase                                158   2e-43    Ipomoea lutea
gb|ABV53919.1|  flavonoid 3'-hydroxylase                                152   4e-43    Gerbera hybrid cultivar
gb|ABR16821.1|  unknown                                                 162   4e-43    Picea sitchensis
gb|AGA82781.1|  flavonoid 3' hydroxylase 1                              155   4e-42    Clarkia gracilis
ref|XP_003562884.1|  PREDICTED: flavonoid 3'-monooxygenase-like         156   5e-41    
gb|AAO47856.1|  flavonoid 3'-hydroxylase                                147   7e-41    Glycine max [soybeans]
gb|EMT24087.1|  Flavonoid 3'-monooxygenase                              154   3e-40    
gb|AHX02955.1|  flavonoid 3'5'-hydroxylase                              154   4e-40    
gb|EEE50732.1|  hypothetical protein OsJ_31043                          152   1e-39    
ref|XP_010247486.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      150   2e-39    
ref|XP_002314004.1|  hypothetical protein POPTR_0009s07320g             151   2e-39    
dbj|BAF93855.1|  flavonoid 3',5'-hydroxylase                            151   3e-39    
dbj|BAL61235.1|  flavonoid 3',5'-hydroxylase                            151   3e-39    
dbj|BAK64099.1|  flavonoid 3',5'-hydroxylase                            150   9e-39    
sp|Q96418.1|C75A5_EUSER  RecName: Full=Flavonoid 3',5'-hydroxylas...    150   9e-39    
ref|XP_010247479.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      149   1e-38    
dbj|BAH98132.1|  flavonoid 3',5'-hydroxylase                            149   2e-38    
dbj|BAF96946.1|  flavonoid 3',5'-hydroxylase                            149   2e-38    
ref|XP_011009110.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      149   2e-38    
dbj|BAH98133.1|  flavonoid 3',5'-hydroxylase                            149   2e-38    
gb|AGC30728.1|  flavonoid 3',5'-hydroxylase                             145   2e-38    
ref|XP_010031713.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      148   3e-38    
dbj|BAE86871.1|  flavonoid 3',5'-hydroxylase                            148   3e-38    
ref|XP_003636773.1|  Flavonoid 3' 5'-hydroxylase                        142   5e-38    
gb|KDP43193.1|  hypothetical protein JCGZ_22745                         147   6e-38    
dbj|BAK74845.1|  mutated flavonoid 3', 5' hydroxylase                   144   1e-37    
ref|XP_010045076.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      146   1e-37    
gb|KCW87229.1|  hypothetical protein EUGRSUZ_B03742                     146   1e-37    
gb|KCW87228.1|  hypothetical protein EUGRSUZ_B03742                     146   1e-37    
sp|O04790.1|C75A7_EUSER  RecName: Full=Flavonoid 3',5'-hydroxylas...    146   2e-37    
ref|XP_006579509.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    144   2e-37    
gb|ACN60403.1|  flavonoid-3',5'-hydroxylase                             144   2e-37    
sp|Q96581.1|C75A4_GENTR  RecName: Full=Flavonoid 3',5'-hydroxylas...    146   2e-37    
gb|ACN58569.1|  flavonoid 3',5'-hydroxylase                             146   2e-37    
dbj|BAC10997.1|  flavonoid 3',5'-hydroxylase                            145   2e-37    
ref|XP_010045081.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      145   3e-37    
gb|AFD04990.1|  flavonoid 3'5'-hydroxylase                              140   3e-37    
dbj|BAH89265.1|  flavonoid 3'5' hydroxylase                             145   4e-37    
ref|NP_001234840.1|  putative flavonoid 3'5' hydroxylase                145   4e-37    
ref|XP_006837147.1|  hypothetical protein AMTR_s00110p00149730          145   4e-37    
gb|AAV85472.1|  flavonoid 3',5'-hydroxylase                             142   5e-37    
ref|XP_006446310.1|  hypothetical protein CICLE_v10018289mg             144   6e-37    
gb|KJB09328.1|  hypothetical protein B456_001G134900                    144   7e-37    
gb|AAP31058.1|  flavonoid 3',5'-hydroxylase                             144   7e-37    
dbj|BAF64483.1|  flavonoid-3',5'-hydroxylase                            141   8e-37    
gb|ACH56524.1|  flavonoid 3'5'-hydroxylase                              144   1e-36    
ref|XP_007015254.1|  Flavonoid 3',5'-hydroxylase 2 isoform 1            144   1e-36    
gb|AIX10138.1|  flavonoid 3',5'-hydroxylase                             144   1e-36    
ref|XP_010045077.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      144   1e-36    
gb|EMS66050.1|  Flavonoid 3'-monooxygenase                              140   1e-36    
dbj|BAJ08041.1|  flavonoid 3',5'-hydroxylase                            143   2e-36    
sp|P37120.1|C75A2_SOLME  RecName: Full=Flavonoid 3',5'-hydroxylas...    143   2e-36    
gb|AAY23287.1|  flavonoid 3',5'-hydroxylase                             143   2e-36    
gb|AGI16385.1|  flavonoid 3', 5'-hydroxylase                            143   3e-36    
gb|AFD05042.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|ACX37698.1|  flavonoid 3',5'-hydroxylase                             142   3e-36    
gb|AIY22752.1|  flavonoid 3',5'-hydroxylase                             142   3e-36    
gb|ACZ63206.1|  flavonoid 3',5'-hydroxylase                             142   3e-36    
gb|AIM58719.1|  flavonoid 3'hydroxylase                                 142   3e-36    
gb|ACZ63205.1|  flavonoid 3',5'-hydroxylase                             142   3e-36    
gb|ABA40923.1|  flavonoid 3',5'-hydroxylase                             142   3e-36    
gb|ACY06904.1|  flavonoid 3'5'-hydroxylase                              142   3e-36    
gb|AFD04986.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
dbj|BAF64482.1|  flavonoid-3',5'-hydroxylase                            141   3e-36    
gb|AFD05046.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
dbj|BAK74846.1|  flavonoid 3', 5' hydroxylase                           142   4e-36    
gb|AFD05037.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AFD05051.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AFD05065.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AFD05035.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
ref|XP_007155246.1|  hypothetical protein PHAVU_003G1855000g            135   4e-36    
gb|AFD05026.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AFD05023.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AFD05017.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AFD05005.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AFD04975.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AFD04985.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AIY22750.1|  flavonoid 3',5'-hydroxylase                             142   4e-36    
gb|AFD05008.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AFD05019.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AFD04973.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AFD04984.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AFD04970.1|  flavonoid 3'5'-hydroxylase                              137   5e-36    
gb|AFD05011.1|  flavonoid 3'5'-hydroxylase                              137   5e-36    
gb|AFD05024.1|  flavonoid 3'5'-hydroxylase                              137   5e-36    
gb|AFD05012.1|  flavonoid 3'5'-hydroxylase                              137   5e-36    
gb|AFD04980.1|  flavonoid 3'5'-hydroxylase                              137   5e-36    
gb|AFD04969.1|  flavonoid 3'5'-hydroxylase                              137   5e-36    
gb|KHF97502.1|  Flavonoid 3',5'-hydroxylase 2                           142   6e-36    
gb|AFD04971.1|  flavonoid 3'5'-hydroxylase                              137   6e-36    
gb|AIY22751.1|  flavonoid 3',5'-hydroxylase                             142   6e-36    
ref|XP_003638766.1|  Flavonoid 3' 5'-hydroxylase                        142   6e-36    
gb|KEH33357.1|  flavonoid hydroxylase                                   142   6e-36    
dbj|BAF34566.1|  flavonoid 3',5'-hydroxylase                            142   6e-36    
gb|AFD04991.1|  flavonoid 3'5'-hydroxylase                              136   6e-36    
ref|XP_009619846.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1           142   7e-36    
gb|AFD04994.1|  flavonoid 3'5'-hydroxylase                              136   7e-36    
dbj|BAC97831.1|  Flavonoid 3',5'-hydroxylase                            141   8e-36    
gb|AFD05050.1|  flavonoid 3'5'-hydroxylase                              136   9e-36    
gb|AFD05057.1|  flavonoid 3'5'-hydroxylase                              136   1e-35    
emb|CAA50442.1|  P450 hydroxylase                                       140   1e-35    
gb|AFD05032.1|  flavonoid 3'5'-hydroxylase                              136   1e-35    
gb|AFD04978.1|  flavonoid 3'5'-hydroxylase                              136   1e-35    
gb|AFD05052.1|  flavonoid 3'5'-hydroxylase                              136   1e-35    
gb|AFD05020.1|  flavonoid 3'5'-hydroxylase                              136   1e-35    
gb|AFD05064.1|  flavonoid 3'5'-hydroxylase                              136   1e-35    
gb|AFD05010.1|  flavonoid 3'5'-hydroxylase                              136   1e-35    
dbj|BAF34559.1|  flavonoid 3',5'-hydroxylase                            141   1e-35    
gb|ADV39278.1|  flavonoid 3',5'-hydroxylase                             137   1e-35    
dbj|BAF34571.1|  flavonoid 3',5'-hydroxylase                            141   1e-35    
gb|ADV39275.1|  flavonoid 3',5'-hydroxylase                             137   1e-35    
gb|ADV39279.1|  flavonoid 3',5'-hydroxylase                             137   1e-35    
gb|ADV39277.1|  flavonoid 3',5'-hydroxylase                             137   1e-35    
gb|ADV39281.1|  flavonoid 3',5'-hydroxylase                             137   1e-35    
dbj|BAF34560.1|  flavonoid 3',5'-hydroxylase                            140   2e-35    
dbj|BAF34557.1|  flavonoid 3',5'-hydroxylase                            140   2e-35    
dbj|BAF34572.1|  flavonoid 3',5'-hydroxylase                            140   2e-35    
dbj|BAF34569.1|  flavonoid 3',5'-hydroxylase                            140   2e-35    
gb|AIX10137.1|  flavonoid 3',5'-hydroxylase                             140   2e-35    
sp|P48418.1|C75A1_PETHY  RecName: Full=Flavonoid 3',5'-hydroxylas...    140   2e-35    
gb|ABN42195.1|  flavonoid-3',5'-hydroxylase                             140   2e-35    
gb|ADV39273.1|  flavonoid 3',5'-hydroxylase                             136   2e-35    
dbj|BAF34563.1|  flavonoid 3',5'-hydroxylase                            140   2e-35    
gb|ADV39282.1|  flavonoid 3',5'-hydroxylase                             136   2e-35    
gb|ABY77007.1|  flavonoid 3',5'-hydroxylase                             140   2e-35    
dbj|BAF34562.1|  flavonoid 3',5'-hydroxylase                            140   2e-35    
dbj|BAF34561.1|  flavonoid 3',5'-hydroxylase                            140   2e-35    
ref|NP_001274807.1|  flavonoid 3',5'-hydroxylase                        140   2e-35    
dbj|BAF34558.1|  flavonoid 3',5'-hydroxylase                            140   3e-35    
gb|AIX10136.1|  flavonoid 3',5'-hydroxylase                             140   3e-35    
ref|XP_006349127.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    140   3e-35    
dbj|BAJ09746.1|  flavonoid 3',5'-hydroxylase                            140   3e-35    
gb|AIX10140.1|  flavonoid 3',5'-hydroxylase                             140   3e-35    
dbj|BAF34568.1|  flavonoid 3',5'-hydroxylase                            140   3e-35    
gb|AIX10142.1|  flavonoid 3',5'-hydroxylase                             140   3e-35    
gb|ADV39276.1|  flavonoid 3',5'-hydroxylase                             135   3e-35    
gb|AAX53074.1|  flavonoid 3'-hydroxylase 1                              137   3e-35    
gb|AIX10139.1|  flavonoid 3',5'-hydroxylase                             139   4e-35    
gb|AIX10135.1|  flavonoid 3',5'-hydroxylase                             139   4e-35    
gb|ABQ96219.1|  flavonoid 3'5' hydroxylase                              139   5e-35    
gb|AAX51796.1|  flavonoid 3'5'-hydroxylase                              139   5e-35    
gb|AIX10133.1|  flavonoid 3',5'-hydroxylase                             139   5e-35    
gb|AFD04977.1|  flavonoid 3'5'-hydroxylase                              134   5e-35    
ref|XP_010651523.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      139   5e-35    
dbj|BAE47007.1|  flavonoid 3',5'-hydroxylase                            139   5e-35    
dbj|BAF34567.1|  flavonoid 3',5'-hydroxylase                            139   5e-35    
dbj|BAO66642.1|  flavonoid 3',5'-hydroxylase                            139   5e-35    
gb|AIX10134.1|  flavonoid 3',5'-hydroxylase                             139   6e-35    
ref|XP_006593479.1|  PREDICTED: flavonoid 3', 5'-hydroxylase isof...    139   6e-35    
dbj|BAJ14025.1|  flavonoid 3'5'-hydroxylase                             139   6e-35    
dbj|BAJ16328.1|  flavonoid 3',5'-hydroxylase                            139   6e-35    
dbj|BAM09186.1|  flavonoid 3'5'-hydroxylase                             139   6e-35    
gb|ABQ96218.1|  flavonoid 3'5' hydroxylase                              139   6e-35    
gb|AJA40049.1|  flavonoid 3'5'-hydroxylase                              139   6e-35    
ref|NP_001236632.1|  flavonoid 3', 5'-hydroxylase                       139   6e-35    
gb|AFD05049.1|  flavonoid 3'5'-hydroxylase                              134   6e-35    
gb|AFD05059.1|  flavonoid 3'5'-hydroxylase                              134   6e-35    
gb|AIX10141.1|  flavonoid 3',5'-hydroxylase                             139   7e-35    
emb|CAN82588.1|  hypothetical protein VITISV_038260                     139   7e-35    
gb|ADV39274.1|  flavonoid 3',5'-hydroxylase                             135   7e-35    
dbj|BAO04188.1|  flavonoid 3'5'-hydroxylase                             139   8e-35    
gb|AFD05054.1|  flavonoid 3'5'-hydroxylase                              134   8e-35    
gb|AAV85470.1|  flavonoid 3',5'-hydroxylase                             139   8e-35    
dbj|BAF34575.1|  flavonoid 3',5'-hydroxylase                            139   9e-35    
dbj|BAB20076.1|  flavonoid 3',5'-hydroxylase                            139   9e-35    
gb|AHK10251.1|  flavonoid-3',5'-hydroxylase                             138   9e-35    
dbj|BAE72871.1|  flavonoid 3',5'-hdyroxylase                            138   9e-35    
gb|AAT34974.1|  flavonoid 3',5'-hydroxylase                             138   1e-34    
gb|AAG49300.1|AF313490_1  flavonoid 3',5'-hydroxylase                   138   1e-34    
ref|XP_007146175.1|  hypothetical protein PHAVU_006G018800g             137   1e-34    
gb|AEY80043.1|  flavonoid-3',5'-hydroxylase                             138   1e-34    
ref|XP_008794133.1|  PREDICTED: flavonoid 3'-monooxygenase-like         138   1e-34    
ref|NP_001268164.1|  uncharacterized protein LOC100261319               137   2e-34    
gb|AFL91704.1|  flavonoid-3',5'-hydroxylase                             137   2e-34    
emb|CAN81079.1|  hypothetical protein VITISV_007550                     137   2e-34    
ref|XP_011024984.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      137   2e-34    
ref|XP_003632209.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           137   2e-34    
dbj|BAF34573.1|  flavonoid 3',5'-hydroxylase                            137   2e-34    
emb|CAN61852.1|  hypothetical protein VITISV_020443                     137   2e-34    
ref|XP_003632242.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           137   2e-34    
gb|ACN38269.1|  flavonoid-3',5'-hydroxylase                             137   3e-34    
emb|CAN82604.1|  hypothetical protein VITISV_005589                     137   3e-34    
gb|AIY51702.1|  flavonoid 3',5'-hydroxylase                             137   3e-34    
ref|XP_007146174.1|  hypothetical protein PHAVU_006G018800g             137   3e-34    
ref|XP_002298464.1|  hypothetical protein POPTR_0001s28140g             137   3e-34    
ref|XP_010651525.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           137   3e-34    
dbj|BAJ16329.1|  flavonoid 3',5'-hydroxylase                            137   3e-34    
gb|ABC86840.1|  flavonoid 3',5'-hydroxylase                             137   3e-34    
ref|XP_002280939.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           137   4e-34    
gb|AFD05053.1|  flavonoid 3'5'-hydroxylase                              132   4e-34    
ref|XP_003638760.1|  Flavonoid 3' 5'-hydroxylase                        136   4e-34    
emb|CAN60738.1|  hypothetical protein VITISV_042284                     134   5e-34    
emb|CBI15131.3|  unnamed protein product                                130   5e-34    
ref|XP_007015255.1|  Flavonoid 3',5'-hydroxylase 2 isoform 2            135   6e-34    
ref|XP_006856442.1|  hypothetical protein AMTR_s00047p00229040          136   6e-34    
gb|AJD25176.1|  cytochrome P450 CYP75A57                                136   8e-34    
dbj|BAF34570.1|  flavonoid 3',5'-hydroxylase                            135   8e-34    
gb|ADE80942.1|  flavonoid 3',5'-hydroxylase                             135   9e-34    
gb|AAM51564.1|  flavonoid 3', 5'-hydroxylase                            135   1e-33    
gb|AFF59221.1|  flavonoid 3'5'-hydroxylase                              135   1e-33    
dbj|BAE72872.1|  flavonoid 3',5'-hdyroxylase                            135   2e-33    
gb|AGO02173.1|  flavonoid 3'5'-hydroxylase                              135   2e-33    
dbj|BAF49293.1|  flavonoid 3',5'-hydroxylase                            135   2e-33    
gb|AFR67330.1|  flavonoid-3',5'-hydroxylase                             135   2e-33    
dbj|BAE72870.1|  flavonoid 3',5'-hdyroxylase                            135   2e-33    
gb|ADW66657.1|  flavonoid-3',5'-hydroxylase                             134   2e-33    
ref|XP_008780588.1|  PREDICTED: cytochrome P450 750A1-like              131   3e-33    
ref|XP_009411862.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      134   4e-33    
ref|XP_009383085.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      134   4e-33    
emb|CBI15132.3|  unnamed protein product                                133   4e-33    
gb|KDO54767.1|  hypothetical protein CISIN_1g047593mg                   134   5e-33    
ref|XP_004513234.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    134   5e-33    
ref|XP_010936313.1|  PREDICTED: flavonoid 3'-monooxygenase-like         134   5e-33    
ref|XP_006470529.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      134   5e-33    
gb|ADW66160.1|  flavonoid 3' 5' hydroxylase                             133   6e-33    
sp|P48419.1|C75A3_PETHY  RecName: Full=Flavonoid 3',5'-hydroxylas...    132   1e-32    
ref|XP_003556788.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    131   3e-32    
ref|XP_006665049.1|  PREDICTED: flavonoid 3'-monooxygenase-like         131   3e-32    
gb|ABR16345.1|  unknown                                                 130   5e-32    
ref|XP_003632212.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      130   5e-32    
emb|CBI35858.3|  unnamed protein product                                130   5e-32    
gb|ABC86841.1|  flavonoid 3',5'-hydroxylase                             130   6e-32    
emb|CAA09850.1|  flavonoid 3',5'-hydroxylase                            130   6e-32    
emb|CAN77776.1|  hypothetical protein VITISV_021888                     130   6e-32    
ref|XP_002273390.1|  PREDICTED: cytochrome P450 71A1-like               130   7e-32    
ref|XP_002271739.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           130   7e-32    
ref|XP_008792895.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    127   8e-32    
gb|AGC74041.1|  flavonoid-3',5'-hydroxylase                             130   1e-31    



>gb|AAR00230.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
Length=323

 Score =   353 bits (907),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 199/205 (97%), Positives = 203/205 (99%), Gaps = 0/205 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMAER+
Sbjct  4    LTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMAERH  63

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLR+GFVDVVVAASAAVAAQFLKVHD+NFSNRPPNSGAEHIAYNYQDLVFAPYGPR
Sbjct  64   GPLMHLRMGFVDVVVAASAAVAAQFLKVHDANFSNRPPNSGAEHIAYNYQDLVFAPYGPR  123

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKIT VHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL R
Sbjct  124  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  183

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGRKVFNDGGSKSDPKAEEFKSM
Sbjct  184  VMLGRKVFNDGGSKSDPKAEEFKSM  208



>dbj|BAD00187.1| flavonoid 3'-hydroxylase [Ipomoea nil]
 dbj|BAD00190.1| flavonoid 3'-hydroxylase [Ipomoea nil]
Length=519

 Score =   357 bits (917),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 203/205 (99%), Positives = 203/205 (99%), Gaps = 0/205 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGKKPHQSIAAMAERY
Sbjct  4    LTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGKKPHQSIAAMAERY  63

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFVDVVVAASAAVAAQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR
Sbjct  64   GPLMHLRLGFVDVVVAASAAVAAQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  123

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKIT VHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL R
Sbjct  124  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  183

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGRKVFNDGGSKSDPKAEEFKSM
Sbjct  184  VMLGRKVFNDGGSKSDPKAEEFKSM  208



>gb|AAR00229.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
 dbj|BAD00188.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
 dbj|BAD00191.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
Length=519

 Score =   352 bits (904),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 199/205 (97%), Positives = 203/205 (99%), Gaps = 0/205 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMAER+
Sbjct  4    LTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMAERH  63

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLR+GFVDVVVAASAAVAAQFLKVHD+NFSNRPPNSGAEHIAYNYQDLVFAPYGPR
Sbjct  64   GPLMHLRMGFVDVVVAASAAVAAQFLKVHDANFSNRPPNSGAEHIAYNYQDLVFAPYGPR  123

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKIT VHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL R
Sbjct  124  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  183

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGRKVFNDGGSKSDPKAEEFKSM
Sbjct  184  VMLGRKVFNDGGSKSDPKAEEFKSM  208



>gb|ABW69693.1| flavonoid 3'-hydrogenase [Ipomoea purpurea]
Length=519

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 198/205 (97%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMAER+
Sbjct  4    LTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMAERH  63

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLR+GFVDVVVAASAAVAAQFLKVHD+NFSNRPPNSGAEHIAYNYQDLVFAPYGPR
Sbjct  64   GPLMHLRMGFVDVVVAASAAVAAQFLKVHDANFSNRPPNSGAEHIAYNYQDLVFAPYGPR  123

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKIT VHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL R
Sbjct  124  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  183

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGRKVFNDG SKSDPKAEEFKSM
Sbjct  184  VMLGRKVFNDGSSKSDPKAEEFKSM  208



>dbj|BAD00189.1| flavonoid 3'-hydroxylase [Ipomoea tricolor]
 dbj|BAD00192.1| flavonoid 3'-hydroxylase [Ipomoea tricolor]
Length=522

 Score =   342 bits (877),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 195/205 (95%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLI CTLVFAI LYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA+ Y
Sbjct  4    LTLILCTLVFAICLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMAQSY  63

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGAEHIAYNYQDLVFAPYGPR
Sbjct  64   GPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAEHIAYNYQDLVFAPYGPR  123

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKIT VHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL R
Sbjct  124  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  183

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGRKVFNDG SKSDPKAEEFKSM
Sbjct  184  VMLGRKVFNDGSSKSDPKAEEFKSM  208



>gb|ACL26685.1| flavonoid 3'-hydroxylase [Ipomoea coccinea]
Length=519

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = +1

Query  28   FAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLG  207
            FAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA++YGPLMHLRLG
Sbjct  13   FAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMAQKYGPLMHLRLG  72

Query  208  FvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITF  387
            FVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKIT 
Sbjct  73   FVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS  132

Query  388  VHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVMLGRKVFN  567
            VHLFSAKALDDF HVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL RVMLGRKVFN
Sbjct  133  VHLFSAKALDDFSHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFN  192

Query  568  DGGSKSDPKAEEFKSM  615
            DGGSKSDPKAEEFKSM
Sbjct  193  DGGSKSDPKAEEFKSM  208



>gb|AAS46257.1| flavonoid 3'-hydroxylase [Ipomoea quamoclit]
Length=519

 Score =   327 bits (839),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 187/196 (95%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = +1

Query  28   FAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLG  207
            FAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA++YGPLMHLRLG
Sbjct  13   FAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMAQKYGPLMHLRLG  72

Query  208  FvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITF  387
            FVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKIT 
Sbjct  73   FVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS  132

Query  388  VHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVMLGRKVFN  567
            VHLFSAKALDDF HVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL RVMLGRKVFN
Sbjct  133  VHLFSAKALDDFSHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFN  192

Query  568  DGGSKSDPKAEEFKSM  615
            DG SKSDPKAEEFKSM
Sbjct  193  DGSSKSDPKAEEFKSM  208



>gb|ACL26686.1| flavonoid 3'-hydroxylase [Ipomoea ternifolia]
Length=519

 Score =   324 bits (830),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = +1

Query  28   FAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLG  207
            FAI LYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA++YGPLMHLRLG
Sbjct  13   FAISLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMAKKYGPLMHLRLG  72

Query  208  FvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITF  387
            FVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPRWRMLRKIT 
Sbjct  73   FVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPRWRMLRKITS  132

Query  388  VHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVMLGRKVFN  567
            VHLFSAKALDDF HVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL RVMLGRKVFN
Sbjct  133  VHLFSAKALDDFSHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFN  192

Query  568  DGGSKSDPKAEEFKSM  615
            DGGSKSDPKAEEFKSM
Sbjct  193  DGGSKSDPKAEEFKSM  208



>gb|ACS71532.1| flavonoid 3' hydroxylase [Ipomoea horsfalliae]
Length=517

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 196/205 (96%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLI CT VFA+FLYFL LR+K RYPLPLPPGPKPWPV+GNLPHLG+KPHQSIAA+A+ Y
Sbjct  4    LTLILCTSVFAVFLYFL-LRLK-RYPLPLPPGPKPWPVVGNLPHLGQKPHQSIAALAQSY  61

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  62   GPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPR  121

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKIT VHLFSAKALDDFCHVRQEEVATL RSLASAGKTPVKLGQLLNVCTTNAL R
Sbjct  122  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLARSLASAGKTPVKLGQLLNVCTTNALGR  181

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGRKVFNDGGSKSDPKA+EFKSM
Sbjct  182  VMLGRKVFNDGGSKSDPKADEFKSM  206



>gb|AEH42499.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 194/205 (95%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLI CT+VF IFLYFL LRVK RYPLPLPPGPKPWPV+GNLPHLG+KPHQSIAA+A+ Y
Sbjct  5    LTLILCTIVFTIFLYFL-LRVK-RYPLPLPPGPKPWPVVGNLPHLGEKPHQSIAALAQSY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WR LRKIT VHLFSAKALDDF HVRQ EVATLTRSLASAGKTPVKLGQLLNVCTTNAL R
Sbjct  123  WRRLRKITSVHLFSAKALDDFSHVRQGEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            V+LGRKVFNDGGSKSDPKAEEFKSM
Sbjct  183  VVLGRKVFNDGGSKSDPKAEEFKSM  207



>gb|ABW86861.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=517

 Score =   318 bits (815),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 193/205 (94%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLIFCT+VF IFLY L LRVK RYPLPLPPGPKPWPV+GNLPHLG+KPHQSIAA+A+ Y
Sbjct  4    LTLIFCTIVFTIFLYCL-LRVK-RYPLPLPPGPKPWPVVGNLPHLGEKPHQSIAALAQSY  61

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  62   GPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPR  121

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WR LRKIT VHLFSAKALDDF HVRQ EVATLTRSLASAGKTPVKLGQLLNVCTTNAL R
Sbjct  122  WRRLRKITSVHLFSAKALDDFSHVRQGEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  181

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGRKVFNDG SKSDPKAEEFKSM
Sbjct  182  VMLGRKVFNDGSSKSDPKAEEFKSM  206



>gb|AEH42501.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 191/205 (93%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLI CT VF IFLY L LRVK RYPLPLPPGPKPWP++GNLPHLG+KPHQSIAA+A+ Y
Sbjct  5    LTLILCTSVFTIFLYCL-LRVK-RYPLPLPPGPKPWPIVGNLPHLGEKPHQSIAALAQSY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAY+YQDLVFAPYGPR
Sbjct  63   GPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYSYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKIT VHLFSAKALDDF HVRQ  VATLTRSLASAGKTPVKLGQLLNVCTTNAL R
Sbjct  123  WRMLRKITSVHLFSAKALDDFSHVRQGVVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGRKVFNDG SKSDPKAEEFKSM
Sbjct  183  VMLGRKVFNDGSSKSDPKAEEFKSM  207



>gb|ACB29666.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 191/205 (93%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLI CT VF IFLY L LRVK RYPLPLPPGPKPWP++GNLPHLG+KPHQSIAA+A+ Y
Sbjct  5    LTLILCTSVFTIFLYCL-LRVK-RYPLPLPPGPKPWPIVGNLPHLGEKPHQSIAALAQSY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAY+YQDLVFAPYGPR
Sbjct  63   GPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYSYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKIT VHLFSAKALDDF HVRQ  VATLTRSLASAGKTPVKLGQLLNVCTTNAL R
Sbjct  123  WRMLRKITSVHLFSAKALDDFSHVRQGVVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGRKVFNDG SKSDPKAEEFKSM
Sbjct  183  VMLGRKVFNDGSSKSDPKAEEFKSM  207



>gb|AEH42500.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   308 bits (789),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 190/205 (93%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLI CT V  I LY L LRVK RYPLPLPPGPKPWPV+GNLPHLG+KP+QS+AA+A+ Y
Sbjct  5    LTLILCTSVITISLYCL-LRVK-RYPLPLPPGPKPWPVVGNLPHLGEKPNQSLAALAQSY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKIT VHLFSAKALDDF HVRQ EVATLTRSLASAGKTPVKLGQLLNVCTTNAL R
Sbjct  123  WRMLRKITSVHLFSAKALDDFSHVRQGEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGRKVFNDGGSKSDPKAEE KSM
Sbjct  183  VMLGRKVFNDGGSKSDPKAEESKSM  207



>dbj|BAJ11756.1| flavonoid 3'-hydroxylase [Calystegia pubescens]
Length=520

 Score =   296 bits (758),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 187/211 (89%), Gaps = 6/211 (3%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRV---KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  171
            LTL   T +FAIFLYFL+ ++    +RYPL LPPGP PWPV+GNLPHLG KPHQ++AA+A
Sbjct  4    LTLFLFTSIFAIFLYFLVCQLLISNKRYPLLLPPGPSPWPVVGNLPHLGPKPHQTLAALA  63

Query  172  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  351
            + YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  64   QNYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  123

Query  352  GPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  531
            GPRWRMLRKIT VHLFS+KALDDF HVRQEE+  LTR+LASAGKTPVKLGQLLNVCTTNA
Sbjct  124  GPRWRMLRKITSVHLFSSKALDDFRHVRQEEIGVLTRALASAGKTPVKLGQLLNVCTTNA  183

Query  532  LTRVMLGRKVFND---GGSKSDPKAEEFKSM  615
            L+RV+LGRKVFND    G KSDPKA+EFKSM
Sbjct  184  LSRVLLGRKVFNDQTNAGGKSDPKADEFKSM  214



>dbj|BAJ08322.1| flavonoid 3'-hydroxylase [Calystegia soldanella]
Length=520

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 188/211 (89%), Gaps = 6/211 (3%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRV---KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  171
            LTL   T +FAIF+YFL+ ++    +RYPLPLPPGP PWPV+GNLPHLG KPHQ++AA+A
Sbjct  4    LTLFLFTSIFAIFIYFLVCQLLISNKRYPLPLPPGPSPWPVVGNLPHLGPKPHQTLAALA  63

Query  172  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  351
            + YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  64   QNYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  123

Query  352  GPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  531
            GPRWRMLRKIT VHLFS+KALDDF HVRQEE+  LTR+LASAG+TPVKLGQLLNVCTTNA
Sbjct  124  GPRWRMLRKITSVHLFSSKALDDFRHVRQEEIGVLTRALASAGRTPVKLGQLLNVCTTNA  183

Query  532  LTRVMLGRKVFND---GGSKSDPKAEEFKSM  615
            L+RV+LGRKVFND    G KSDPKA+EFKSM
Sbjct  184  LSRVLLGRKVFNDQTNAGGKSDPKADEFKSM  214



>dbj|BAE47005.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   275 bits (702),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 164/205 (80%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A+ Y
Sbjct  4    LALIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALAKTY  59

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  60   GPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPR  119

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNAL R
Sbjct  120  WRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNALGR  179

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG    DPKA+EFK M
Sbjct  180  VMLGRRVFGDGSGGEDPKADEFKEM  204



>emb|CAI54278.1| flavonoid-3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 165/205 (80%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L LIFCT +F + LY  + R   R P  L P P      GNLPHLG  PH SIAA+A+ Y
Sbjct  4    LALIFCTALFCVLLYHFLTRRSVRLPPGLKPWPIV----GNLPHLGPVPHHSIAALAKTY  59

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  60   GPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPR  119

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNAL R
Sbjct  120  WRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNALGR  179

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG    DPKA+EFK M
Sbjct  180  VMLGRRVFGDGSGGEDPKADEFKEM  204



>emb|CAN68303.1| hypothetical protein VITISV_041731 [Vitis vinifera]
Length=509

 Score =   274 bits (701),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 164/205 (80%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L LIFCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A+ Y
Sbjct  4    LALIFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALAKTY  59

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  60   GPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPR  119

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNAL R
Sbjct  120  WRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNALGR  179

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG    DPKA+EFK M
Sbjct  180  VMLGRRVFGDGSGGEDPKADEFKEM  204



>dbj|BAE47003.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=334

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 162/205 (79%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L L FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A+ Y
Sbjct  4    LALSFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALAKTY  59

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  60   GPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPR  119

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFS +ALDDF H+RQEEV  L R+LA AG+TPVKLGQLLNVCTTNAL R
Sbjct  120  WRMLRKICSVHLFSGQALDDFRHIRQEEVLALMRALARAGQTPVKLGQLLNVCTTNALGR  179

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG    DPKA+EFK M
Sbjct  180  VMLGRRVFGDGSGGEDPKADEFKEM  204



>ref|NP_001267916.1| flavonoid 3' hydroxylase [Vitis vinifera]
 dbj|BAE47006.1| flavonoid 3'-hydroxylase [Vitis vinifera]
 gb|ABH06586.1| flavonoid 3' hydroxylase [Vitis vinifera]
Length=509

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 163/205 (80%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L L FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A+ Y
Sbjct  4    LALFFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALAKTY  59

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  60   GPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPR  119

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNAL R
Sbjct  120  WRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNALGR  179

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG    DPKA+EFK M
Sbjct  180  VMLGRRVFGDGSGGEDPKADEFKEM  204



>gb|ACN38268.1| flavonoid 3' hydroxylase [Vitis amurensis]
Length=509

 Score =   272 bits (695),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 163/205 (80%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L L FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A+ Y
Sbjct  4    LALFFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALAKTY  59

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  60   GPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPR  119

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNAL R
Sbjct  120  WRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNALGR  179

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG    DPKA+EFK M
Sbjct  180  VMLGRRVFGDGSGGEDPKADEFKEM  204



>emb|CAN62275.1| hypothetical protein VITISV_007552 [Vitis vinifera]
Length=471

 Score =   270 bits (691),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 163/205 (80%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A+ Y
Sbjct  4    LALIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALAKTY  59

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  60   GPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPR  119

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFS +ALDDF H+RQEEV  L R+LA AG+TPVKLGQLLNVCTTNAL R
Sbjct  120  WRMLRKICSVHLFSGQALDDFRHIRQEEVLALMRALARAGQTPVKLGQLLNVCTTNALGR  179

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG    DPKA+EFK M
Sbjct  180  VMLGRRVFGDGSGGEDPKADEFKEM  204



>ref|XP_002284151.1| PREDICTED: flavonoid 3'-monooxygenase [Vitis vinifera]
 emb|CAN75347.1| hypothetical protein VITISV_002956 [Vitis vinifera]
Length=509

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 163/205 (80%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A+ Y
Sbjct  4    LALIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALAKTY  59

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  60   GPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPR  119

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFS +ALDDF H+RQEEV  L R+LA AG+TPVKLGQLLNVCTTNAL R
Sbjct  120  WRMLRKICSVHLFSGQALDDFRHIRQEEVLALMRALARAGQTPVKLGQLLNVCTTNALGR  179

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG    DPKA+EFK M
Sbjct  180  VMLGRRVFGDGSGGEDPKADEFKEM  204



>ref|XP_009788494.1| PREDICTED: flavonoid 3'-monooxygenase [Nicotiana sylvestris]
Length=514

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 180/205 (88%), Gaps = 2/205 (1%)
 Frame = +1

Query  4    TLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            +L+  T++F+  L+  L L  ++RYPLPLPPGPKPWP++GNL H+G KPHQS AAMA  Y
Sbjct  5    SLLLYTVIFSFLLHSILTLFFRKRYPLPLPPGPKPWPIIGNLVHMGPKPHQSTAAMARTY  64

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPR
Sbjct  65   GPLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPR  124

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI FVHLFSAKALDDF HVRQ+EV TLTR+LASAG+ PVKLGQLLNVCTTNAL R
Sbjct  125  WRMLRKICFVHLFSAKALDDFSHVRQDEVKTLTRALASAGQKPVKLGQLLNVCTTNALAR  184

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF D  S +DP+AEEFKSM
Sbjct  185  VMLGRRVFADASS-ADPQAEEFKSM  208



>dbj|BAE47004.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   269 bits (688),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 162/205 (79%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A+ Y
Sbjct  4    LALIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALAKTY  59

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  60   GPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPR  119

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFS +ALDDF H+RQEEV  L R+LA  G+TPVKLGQLLNVCTTNAL R
Sbjct  120  WRMLRKICSVHLFSGQALDDFRHIRQEEVLALMRALAREGQTPVKLGQLLNVCTTNALGR  179

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG    DPKA+EFK M
Sbjct  180  VMLGRRVFGDGSGGEDPKADEFKEM  204



>sp|Q9SBQ9.1|F3PH_PETHY RecName: Full=Flavonoid 3'-monooxygenase; AltName: Full=Cytochrome 
P450 75B2; AltName: Full=Flavonoid 3'-hydroxylase [Petunia 
x hybrida]
 gb|AAD56282.1|AF155332_1 flavonoid 3'-hydroxylase [Petunia x hybrida]
Length=512

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 180/207 (87%), Gaps = 3/207 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILR--VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  174
            L+LI  T++F+  L F ILR   ++RYPLPLPPGPKPWP++GNL HLG KPHQS AAMA+
Sbjct  4    LSLILYTVIFSFLLQF-ILRSFFRKRYPLPLPPGPKPWPIIGNLVHLGPKPHQSTAAMAQ  62

Query  175  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  354
             YGPLM+L++GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGAEH+AYNYQDLVFAPYG
Sbjct  63   TYGPLMYLKMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAEHMAYNYQDLVFAPYG  122

Query  355  PRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL  534
            PRWRMLRKI  VHLFS KALDDF HVRQ+EV TLTR+LASAG+ PVKLGQLLNVCTTNAL
Sbjct  123  PRWRMLRKICSVHLFSTKALDDFRHVRQDEVKTLTRALASAGQKPVKLGQLLNVCTTNAL  182

Query  535  TRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             RVMLG++VF DG    DP+A EFKSM
Sbjct  183  ARVMLGKRVFADGSGDVDPQAAEFKSM  209



>emb|CDP19009.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 173/206 (84%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLIF + + A FL + IL+        LPPGPKPWP++GNLPHLG KPH S+AAMA+ Y
Sbjct  4    LTLIFISSLLA-FLLYSILKKAGNPSKSLPPGPKPWPIVGNLPHLGTKPHHSLAAMAKTY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRS-LASAGKTPVKLGQLLNVCTTNALT  537
            WR+LRKI  +HLFSAKALDDF  VRQEEV TL R+ LASAGKTPV LGQLLNVCTTNAL 
Sbjct  123  WRLLRKICSIHLFSAKALDDFHLVRQEEVGTLARALLASAGKTPVNLGQLLNVCTTNALG  182

Query  538  RVMLGRKVFNDGGSKSDPKAEEFKSM  615
            RVMLGR+VF DG    DPKA+EFKSM
Sbjct  183  RVMLGRRVFGDGSGGGDPKADEFKSM  208



>dbj|BAP94456.1| flavonoid 3'-hydroxylas [Eustoma exaltatum subsp. russellianum]
Length=519

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 172/204 (84%), Gaps = 1/204 (0%)
 Frame = +1

Query  7    LIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
            L+  T +F++ +Y  L L  ++     LPPGPKPWP++GNLPHLG KPHQ++AAMA+ YG
Sbjct  9    LVVYTAIFSLLIYAILKLLRRENRRPSLPPGPKPWPIIGNLPHLGTKPHQTLAAMAKTYG  68

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHL+LGFVDVVVAASA+VA QFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPRW
Sbjct  69   PLMHLKLGFVDVVVAASASVAEQFLKKHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPRW  128

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            R+LRKI  VHLFSAKALDDF HVRQEEV  LTRS+ASAG+ P+ LGQLL VCTTNAL RV
Sbjct  129  RLLRKICSVHLFSAKALDDFQHVRQEEVGILTRSIASAGENPINLGQLLGVCTTNALARV  188

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            MLGR+VF DG    DP+A+EFKSM
Sbjct  189  MLGRRVFGDGSGGVDPQADEFKSM  212



>gb|AGO02167.1| flavonoid 3'-hydroxylase [Ampelopsis grossedentata]
Length=509

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 160/205 (78%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L L+FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A+ Y
Sbjct  4    LALLFCTALFCVLLYRFLTRRSPRLPPGPKPWPIV----GNLPHLGPVPHHSIAALAKTY  59

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLR+GFVDVVVAASA+VA+QFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  60   GPLMHLRMGFVDVVVAASASVASQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPR  119

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  +HLFS KALDDF H+RQEE++ LT +LA AG  PV LGQLLNVCTTNAL R
Sbjct  120  WRMLRKICSIHLFSGKALDDFRHIRQEEISVLTSALARAGPAPVNLGQLLNVCTTNALGR  179

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+ F DG    DPKA+EFK M
Sbjct  180  VMLGRRAFGDGSGGEDPKADEFKEM  204



>gb|AHZ08763.1| flavonoid 3'-monooxygenase [Nicotiana tabacum]
Length=515

 Score =   265 bits (676),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 176/205 (86%), Gaps = 1/205 (0%)
 Frame = +1

Query  4    TLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            +L+  T++F+  L+  L L  ++RYPLPLPPGPKPWP++GNL H+G KPHQS AAMA  Y
Sbjct  5    SLLLYTVIFSFLLHSILTLFFRKRYPLPLPPGPKPWPIIGNLVHMGPKPHQSTAAMARTY  64

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPR
Sbjct  65   GPLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPR  124

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFSAKALDDF HVRQ+EV TLTR+LASA + PVKLGQLLNVCTTNAL +
Sbjct  125  WRMLRKICSVHLFSAKALDDFSHVRQDEVRTLTRALASAAQKPVKLGQLLNVCTTNALAQ  184

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF D     DP+AEEFKSM
Sbjct  185  VMLGRRVFADANGGVDPQAEEFKSM  209



>dbj|BAO58432.1| flavonoid 3'-hydroxylase [Vaccinium ashei]
Length=517

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 170/207 (82%), Gaps = 2/207 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L  I  +L+  IFLYF++  ++ RYP PLPPGPKPWPV+GNLPHLG  PH SIAA+A  Y
Sbjct  4    LAFIIYSLLIGIFLYFVLSLLRNRYPRPLPPGPKPWPVIGNLPHLGTMPHHSIAALARTY  63

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHL +G V VVVAASA+VA QFLK HD NFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  64   GPLMHLWMGSVHVVVAASASVAXQFLKTHDQNFSSRPPNSGAKHIAYNYQDLVFAPYGPR  123

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAG--KTPVKLGQLLNVCTTNAL  534
            WRMLRKI  VHLFSAKALDDF HVRQEEVA LTR+LASA   KT V LGQLLN+CTTNA+
Sbjct  124  WRMLRKICSVHLFSAKALDDFRHVRQEEVAILTRALASAAKSKTTVNLGQLLNLCTTNAI  183

Query  535  TRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             RVMLGR+VF DG    DPKA+EFK M
Sbjct  184  GRVMLGRRVFGDGSGGGDPKADEFKGM  210



>gb|AHA49900.1| flavonoid 3' hydroxylase [Malus hybrid cultivar]
Length=511

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
             LIF T+V A FLY L      R+  PLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIFFTVVLAFFLYRLFAPGGSRHAQPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            RMLRKI+ VHLFS KALDD  HVRQEEV  L   LASAG  PV LGQLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLGQLLNVCTVNALGRV  182

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            M+GR++F DGG + D KA+EFKSM
Sbjct  183  MVGRRLFGDGGGREDQKADEFKSM  206



>ref|XP_008374610.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
 gb|ACR14868.1| flavonoid 3' hydroxylase IIa [Malus domestica]
Length=511

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
             LIF T+V A FLY L      R+  PLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIFFTVVLAFFLYRLFAPGGSRHAQPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            RMLRKI+ VHLFS KALDD  HVRQEEV  L   LASAG  PV LGQLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLGQLLNVCTVNALGRV  182

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            M+GR++F DGG + D KA+EFKSM
Sbjct  183  MVGRRLFGDGGGREDQKADEFKSM  206



>gb|ACR14869.1| flavonoid 3' hydroxylase IIb [Malus domestica]
Length=511

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
             LIF T+V A FLY L      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIFFTVVLAFFLYRLFAPGGSRHALPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            RMLRKI+ VHLFS KALDD  HVRQEEV  L   LASAG  PV LGQLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVSLGQLLNVCTVNALGRV  182

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            M+GR++F DGG + D KA+EFKSM
Sbjct  183  MVGRRLFGDGGGREDQKADEFKSM  206



>gb|ABM46853.1| flavonoid 3'-hydroxylase [Ageratina adenophora]
Length=510

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 174/205 (85%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTL+  T + A+  Y L+L ++ R+P  LPPGP PWP++GNLPHLG  PH S+AA+A +Y
Sbjct  4    LTLLLYTSISALAFY-LLLNLRTRHPKRLPPGPTPWPIVGNLPHLGTVPHHSLAALATKY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFVDVVVAASA+VA+QFLK HD+NF++RPPNSGA+HIAYNY DLVFAPYGPR
Sbjct  63   GPLMHLRLGFVDVVVAASASVASQFLKSHDANFASRPPNSGAKHIAYNYHDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFSAK+LDDF HVRQEEVA LTR L SAG+T VKLGQLLNVCTTNAL R
Sbjct  123  WRMLRKICSVHLFSAKSLDDFRHVRQEEVAILTRVLISAGETTVKLGQLLNVCTTNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            V+LGR+VF DG   SDPKA+EFK M
Sbjct  183  VLLGRRVFGDGSRDSDPKADEFKDM  207



>gb|ACO35753.1| flavonoid 3'-hydroxylase [Bidens aurea]
Length=512

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG  PH S+AA+A +YGPLMHLRLGFVDVVVAASA+VA+QFLK HD+NF++RPPN
Sbjct  42   GNLPHLGTVPHHSLAALAAKYGPLMHLRLGFVDVVVAASASVASQFLKTHDANFASRPPN  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGAEHIAYNYQDLVFAPYGPRWRMLRKI  VHLFS KALDD+ HVRQEEVA LTR+L  A
Sbjct  102  SGAEHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDYRHVRQEEVAILTRALVGA  161

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            GK PVKLGQLLNVCTTNAL RVMLGR+VF DG    DPKA+EFK M
Sbjct  162  GKAPVKLGQLLNVCTTNALARVMLGRRVFGDGSGGGDPKADEFKDM  207



>emb|CDP19008.1| unnamed protein product [Coffea canephora]
 emb|CDP16354.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 172/206 (83%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLIF + + A FL + I +        LPPGPKPWP++GNLPHLG KPH S+AAMA+ Y
Sbjct  4    LTLIFISSLLA-FLLYSIHKKAGNPSKSLPPGPKPWPIVGNLPHLGTKPHHSLAAMAKTY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRS-LASAGKTPVKLGQLLNVCTTNALT  537
            WR+LRKI  +HLFSAKALDDF  VRQEEV TL R+ LASAGKTPV LGQLLNVCTTNAL 
Sbjct  123  WRLLRKICSIHLFSAKALDDFHLVRQEEVGTLARALLASAGKTPVNLGQLLNVCTTNALG  182

Query  538  RVMLGRKVFNDGGSKSDPKAEEFKSM  615
            RVMLGR+VF DG    DPKA+EFKSM
Sbjct  183  RVMLGRRVFGDGSGGGDPKADEFKSM  208



>gb|AHI58943.1| flavonoid 3'-hydroxylase [Nicotiana tabacum]
Length=515

 Score =   262 bits (669),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 173/204 (85%), Gaps = 4/204 (2%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
            T+IF  L+ +IF  F     ++RYPL LPPGPKPWP++GNL H+G KPHQS AAMA  YG
Sbjct  10   TVIFSFLLHSIFSLFF----RKRYPLTLPPGPKPWPIIGNLVHMGPKPHQSTAAMARTYG  65

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  66   PLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  125

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            RMLRKI  VHLFSAKALDDF HVRQ+EV TLTR+LASA + PVKLGQLLNVCTTNAL +V
Sbjct  126  RMLRKICSVHLFSAKALDDFSHVRQDEVRTLTRALASAAQKPVKLGQLLNVCTTNALAQV  185

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            MLGR+VF D     DP+AEEFKSM
Sbjct  186  MLGRRVFADANGGVDPQAEEFKSM  209



>ref|XP_009597267.1| PREDICTED: flavonoid 3'-monooxygenase [Nicotiana tomentosiformis]
Length=515

 Score =   262 bits (669),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 173/204 (85%), Gaps = 4/204 (2%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
            T+IF  L+ +IF  F     ++RYPL LPPGPKPWP++GNL H+G KPHQS AAMA  YG
Sbjct  10   TVIFSFLLHSIFSLFF----RKRYPLTLPPGPKPWPIIGNLVHMGPKPHQSTAAMARTYG  65

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  66   PLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  125

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            RMLRKI  VHLFSAKALDDF HVRQ+EV TLTR+LASA + PVKLGQLLNVCTTNAL +V
Sbjct  126  RMLRKICSVHLFSAKALDDFSHVRQDEVRTLTRALASAAQKPVKLGQLLNVCTTNALAQV  185

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            MLGR+VF D     DP+AEEFKSM
Sbjct  186  MLGRRVFADANGGVDPQAEEFKSM  209



>gb|AFI25037.1| flavonoid 3'-hydroxylase, partial [Populus deltoides x Populus 
tremuloides]
Length=201

 Score =   251 bits (642),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 170/197 (86%), Gaps = 3/197 (2%)
 Frame = +1

Query  34   IFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLG  207
            IF+Y L+ LR ++ R+  PLPPGPKPWP++GNLPHLG  PH S+AA+A+ YGPLMHLR G
Sbjct  1    IFVYCLLQLRSLRDRHGKPLPPGPKPWPLVGNLPHLGPVPHHSMAALAKTYGPLMHLRFG  60

Query  208  FvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITF  387
            FVDVVVAASA+VAAQFLKVHDSNFS+RPPNSGA+HIAYNYQDLVFAPYGPRWRMLRKI+ 
Sbjct  61   FVDVVVAASASVAAQFLKVHDSNFSSRPPNSGAKHIAYNYQDLVFAPYGPRWRMLRKISS  120

Query  388  VHLFSAKALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLLNVCTTNALTRVMLGRKVF  564
            VHLFSAK+LDDF H+RQEEVA LT +L  +G  TPV LGQLLNVCT NAL RVMLGR+VF
Sbjct  121  VHLFSAKSLDDFRHIRQEEVAVLTGALTRSGPTTPVNLGQLLNVCTANALGRVMLGRRVF  180

Query  565  NDGGSKSDPKAEEFKSM  615
             DG    DPKA+EFKSM
Sbjct  181  GDGSGDGDPKADEFKSM  197



>gb|AJO67965.1| flavonoid-3'-hydroxylase, partial [Prunus avium]
Length=215

 Score =   252 bits (644),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 166/203 (82%), Gaps = 1/203 (0%)
 Frame = +1

Query  7    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  186
            LIF T+VFA FLY L++    R+ LPL PGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAAFLYRLLVP-GNRHSLPLAPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  187  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  366
            LMHLRLGFVDV+VAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVIVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  367  MLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVM  546
            MLRKI+ VHLFS KALDD  HVRQEEVA L  SLA AG   V L QLLN+CT NAL RVM
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHSLAGAGSKTVNLAQLLNICTVNALGRVM  182

Query  547  LGRKVFNDGGSKSDPKAEEFKSM  615
            +G+K+F DG    D KA+EFK M
Sbjct  183  VGKKLFADGSGSGDAKADEFKEM  205



>gb|ACN65825.1| flavonoid 3'-hydroxylase [Cichorium intybus]
Length=511

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 168/205 (82%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLI    V  I  Y L L ++ R    LPPGP PWP++GNLPHLG  PH S+AA+A RY
Sbjct  4    LTLIIYACVTGIAAYVL-LNLRNRRAKRLPPGPTPWPIVGNLPHLGTIPHHSLAALATRY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+H+AYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGFVDVVVAASASVAAQFLKAHDANFASRPPNSGAKHMAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFSAK+LDDF HVRQEEVA LTR+L  AGK+ V LGQLLNVCTTNAL R
Sbjct  123  WRMLRKICSVHLFSAKSLDDFRHVRQEEVAILTRALVDAGKSTVILGQLLNVCTTNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG    DPKA+EFK M
Sbjct  183  VMLGRRVFGDGSGGGDPKADEFKDM  207



>gb|AIY22749.1| flavonoid 3'-hydroxylase [Iochroma cyaneum]
Length=515

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 174/204 (85%), Gaps = 1/204 (0%)
 Frame = +1

Query  7    LIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
            +I CT++ +  L+  L L   +RYP+PLPPGPKPWP++GN+ HLG KPHQS A MA  YG
Sbjct  6    IILCTIIISFLLHTILSLFFLKRYPVPLPPGPKPWPIIGNIVHLGPKPHQSTADMARTYG  65

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRW
Sbjct  66   PLMHLRMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAPYGPRW  125

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            RMLRKI  VHLFSAKALDDF HVRQEEV TLTR+LA+A + PVKLGQLLNVCTTN+L RV
Sbjct  126  RMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANASQKPVKLGQLLNVCTTNSLARV  185

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            MLG++VF DG    DP+AEEFKSM
Sbjct  186  MLGKRVFADGTGGIDPQAEEFKSM  209



>gb|AFQ92056.1| flavonoid 3' hydroxylase [Pyrus pyrifolia]
Length=511

 Score =   259 bits (663),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
             LIF T+V A FLY L    + R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIFFTVVLAFFLYRLFAPGRSRHGLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            RMLRKI+ VHLFS KALDD  HVRQEEV  L   LASAG  PV LGQLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLGQLLNVCTVNALGRV  182

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            M+GR++F DG    D KA+EFKSM
Sbjct  183  MVGRRLFGDGSGGEDQKADEFKSM  206



>ref|XP_002319761.1| hypothetical protein POPTR_0013s07050g [Populus trichocarpa]
 gb|EEE95684.1| hypothetical protein POPTR_0013s07050g [Populus trichocarpa]
Length=521

 Score =   259 bits (663),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 175/206 (85%), Gaps = 3/206 (1%)
 Frame = +1

Query  7    LIFCTLVFAIFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LI  + + AIF+Y L+ LR ++ R+  PLPPGPKPWP++GNLPHLG  PH S+AA+A+ Y
Sbjct  4    LILYSALLAIFVYCLLQLRSLRDRHGKPLPPGPKPWPLVGNLPHLGPMPHHSMAALAKTY  63

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLR GFVDVVVAASA+VAAQFLKVHDSNFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  64   GPLMHLRFGFVDVVVAASASVAAQFLKVHDSNFSSRPPNSGAKHIAYNYQDLVFAPYGPR  123

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLLNVCTTNALT  537
            WRMLRKI+ VHLFSAK+LDDF H+RQEEVA LT +L  +G  TPV LGQLLNVCT NAL 
Sbjct  124  WRMLRKISSVHLFSAKSLDDFRHIRQEEVAVLTGALTRSGPTTPVNLGQLLNVCTANALG  183

Query  538  RVMLGRKVFNDGGSKSDPKAEEFKSM  615
            RVMLGR+VF DG    DPKA+EFKSM
Sbjct  184  RVMLGRRVFGDGSGDGDPKADEFKSM  209



>ref|XP_006345132.1| PREDICTED: flavonoid 3'-monooxygenase-like [Solanum tuberosum]
Length=514

 Score =   258 bits (660),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 178/205 (87%), Gaps = 1/205 (0%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLI-LRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            +LI  T++ +  L+F++ L  ++RYP+PLPPGPKPWP++GN+  LG KPHQS A+MA  Y
Sbjct  5    SLILYTIISSFILHFILSLFFRKRYPVPLPPGPKPWPIIGNIVQLGPKPHQSTASMARTY  64

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPR
Sbjct  65   GPLMHLRMGFVDVVVAASASVAAQFLKNHDANFSSRPPNSGAKHMAYNYHDLVFAPYGPR  124

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFSAKALDDF HVRQEEV TLTR+LA+AG+ P+KLGQLLNVCTTNAL R
Sbjct  125  WRMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANAGQKPIKLGQLLNVCTTNALAR  184

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLG++VF DG +  DP+AEEFK M
Sbjct  185  VMLGKRVFADGTNGIDPQAEEFKLM  209



>gb|ABB29899.1| flavonoid 3'-hydroxylase [Osteospermum hybrid cultivar]
Length=514

 Score =   258 bits (660),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 172/206 (83%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L L+  + +  + +Y L L ++ R+   LPPGP PWP++GNLPHLG  PH S+AAMAE+Y
Sbjct  4    LPLVLYSCITGLVIYVL-LNLRTRHSNRLPPGPTPWPIVGNLPHLGVVPHHSLAAMAEKY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY-GP  357
            GPLMHLRLGFVDVVVAASAAVAAQFLKVHD+NF++RPPNSGA+HIAYNYQDLVFAPY GP
Sbjct  63   GPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFASRPPNSGAKHIAYNYQDLVFAPYYGP  122

Query  358  RWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALT  537
            RWRMLRKI  VHLFS+KALDDF HVRQEEVA LTR+L  AG +PVKLGQLLNVCTTNAL 
Sbjct  123  RWRMLRKICSVHLFSSKALDDFRHVRQEEVAILTRALIGAGDSPVKLGQLLNVCTTNALA  182

Query  538  RVMLGRKVFNDGGSKSDPKAEEFKSM  615
            RVMLG++VF D     DPKA+EFK M
Sbjct  183  RVMLGKRVFGDRSGGGDPKADEFKDM  208



>ref|XP_011011227.1| PREDICTED: flavonoid 3'-monooxygenase [Populus euphratica]
Length=521

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 175/206 (85%), Gaps = 3/206 (1%)
 Frame = +1

Query  7    LIFCTLVFAIFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LI  + + A+F+Y L+ LR ++ R+  PLPPGPKPWP++GNLPHLG  PH S+AA+A+ Y
Sbjct  4    LILYSALVAVFVYCLLQLRSLRDRHGKPLPPGPKPWPLVGNLPHLGPMPHHSMAALAKTY  63

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLR GFVDVVVAASA+VAAQFLKVHDSNFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  64   GPLMHLRFGFVDVVVAASASVAAQFLKVHDSNFSSRPPNSGAKHIAYNYQDLVFAPYGPR  123

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLLNVCTTNALT  537
            WRMLRKI+ VHLFSAK+LDDF H+RQEEVA LT +L  +G  TPV LGQLLNVCT NAL 
Sbjct  124  WRMLRKISSVHLFSAKSLDDFRHIRQEEVAVLTGALTRSGPTTPVNLGQLLNVCTANALG  183

Query  538  RVMLGRKVFNDGGSKSDPKAEEFKSM  615
            RVMLGR+VF DG    DPKA+EFKSM
Sbjct  184  RVMLGRRVFGDGSGDGDPKADEFKSM  209



>ref|XP_007037547.1| Flavonoid 3'-hydroxylase isoform 1 [Theobroma cacao]
 gb|EOY22048.1| Flavonoid 3'-hydroxylase isoform 1 [Theobroma cacao]
Length=501

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
            + +  +++ A+FLYF+   +++R+ LPLPPGPKPWP++GNLPH+G  PH S+AA+A+ YG
Sbjct  3    SFLLYSILSAVFLYFIFATLRKRHRLPLPPGPKPWPIIGNLPHMGPVPHHSLAALAKVYG  62

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHLRLGFVDVVVAASA+VAAQFLKVHD+NFS+RPPNSGA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVAAQFLKVHDANFSSRPPNSGAKYVAYNYQDLVFAPYGPRW  122

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            RMLRKI+ VHLFS KALDDF HVRQ+EV  L R+LA A KT V LGQLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDFRHVRQDEVGVLVRALADA-KTKVNLGQLLNVCTVNALGRV  181

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            MLG++VF DG  K+DP+A+EFKSM
Sbjct  182  MLGKRVFGDGSGKADPEADEFKSM  205



>ref|XP_010695197.1| PREDICTED: flavonoid 3'-monooxygenase [Beta vulgaris subsp. vulgaris]
Length=512

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L L F T+  AIF+Y+LI  +  RYP PLPPGPKPWP++GNLPH+G  PHQ +A +A++Y
Sbjct  4    LELTFYTIALAIFIYYLITTIFSRYPGPLPPGPKPWPIVGNLPHMGPVPHQGLAKLAQKY  63

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPL+HLRLG+V VVVAASA+VAA+FLK HD+NFS+RPPNSGA++IAYNYQDLVFAPYGPR
Sbjct  64   GPLLHLRLGYVHVVVAASASVAAEFLKAHDANFSSRPPNSGAKYIAYNYQDLVFAPYGPR  123

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLLNVCTTNALT  537
            WRMLRKI+ +HLFSAKAL+D+  +RQEEVA LT++LA +G   P++LGQLLNVCTTNAL+
Sbjct  124  WRMLRKISSLHLFSAKALEDYKPIRQEEVAILTKALAKSGSNNPIQLGQLLNVCTTNALS  183

Query  538  RVMLGRKVFNDGGSKSDPKAEEFKSM  615
            R MLGR+VF DG  KSD K+EEFK M
Sbjct  184  RAMLGRRVFGDGTGKSDTKSEEFKDM  209



>dbj|BAN62871.1| flavonoid 3'-hydroxylase [Dianthus caryophyllus]
Length=513

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L L F T+V A  LY+LI  V + +  PLPPGP+PWP++GNLPH+G+ PHQ +AA+A++Y
Sbjct  4    LELTFYTIVLATILYYLITTVFRGHQKPLPPGPRPWPIVGNLPHMGQAPHQGLAALAQKY  63

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPL+++RLG+VDVVVAASA+VA QFLK HD NFS+RPPNSGA+HIAYNYQDLVFAPYGP+
Sbjct  64   GPLLYMRLGYVDVVVAASASVATQFLKTHDLNFSSRPPNSGAKHIAYNYQDLVFAPYGPK  123

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  +H+FS+KALDDF  VRQEEV+ L  ++A AG  PV+LGQLLNVCTTNAL+R
Sbjct  124  WRMLRKICSLHMFSSKALDDFRLVRQEEVSILVNAIAKAGTKPVQLGQLLNVCTTNALSR  183

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLG++V  DG  KSDPKAEEFK M
Sbjct  184  VMLGKRVLGDGTGKSDPKAEEFKDM  208



>gb|AIY22747.1| flavonoid 3'-hydroxylase [Iochroma calycinum]
Length=516

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 174/204 (85%), Gaps = 1/204 (0%)
 Frame = +1

Query  7    LIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
            +I  T++F+  L+  L L   +RYP+PLPPGPKPWP++GN+ HLG KPHQSIA MA  YG
Sbjct  6    IILYTIIFSFLLHSILSLFFLKRYPVPLPPGPKPWPIIGNIVHLGPKPHQSIADMARTYG  65

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            P MHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRW
Sbjct  66   PFMHLRMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAPYGPRW  125

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            RMLRKI  VHLFSAKALDDF HVRQEEV TLTR+LA+A + PVKLGQLLNVCTTN+L RV
Sbjct  126  RMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANASQKPVKLGQLLNVCTTNSLARV  185

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            MLG++VF DG    DP+AEEFKSM
Sbjct  186  MLGKRVFADGTGGIDPQAEEFKSM  209



>ref|NP_001289844.1| flavonoid 3'-monooxygenase [Solanum lycopersicum]
 gb|ADK56284.1| putative flavonoid 3' hydroxylase CYP75B49 [Solanum lycopersicum]
Length=514

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  7    LIFCTLVFAIFLYF-LILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
            LI  T++ +I L+F L L  ++RYP+PLPPGPKPWP++GN+  LG KPHQS A+MA  YG
Sbjct  6    LILYTIISSIILHFSLSLFFRKRYPVPLPPGPKPWPIIGNIIQLGPKPHQSTASMARTYG  65

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRW
Sbjct  66   PLMHLRMGFVDVVVAASASVAAQFLKNHDANFSSRPPNSGAKHMAYNYHDLVFAPYGPRW  125

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            RMLRKI  VHLFS KALDDF HVRQEEV TLTR+LA+AG+ P+KLGQLLNVCTTNAL RV
Sbjct  126  RMLRKICSVHLFSTKALDDFRHVRQEEVRTLTRALANAGQNPIKLGQLLNVCTTNALARV  185

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            MLG++VF DG +  DP+AEEFK M
Sbjct  186  MLGKRVFADGTNGMDPQAEEFKLM  209



>gb|AIY22748.1| flavonoid 3'-hydroxylase [Iochroma calycinum]
Length=516

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 174/204 (85%), Gaps = 1/204 (0%)
 Frame = +1

Query  7    LIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
            +I  T++F+  L+  L L   +RYP+PLPPGPKPWP++GN+ HLG KPHQSIA MA  YG
Sbjct  6    IILYTIIFSFLLHSILSLFFLKRYPVPLPPGPKPWPIIGNIVHLGPKPHQSIADMARTYG  65

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            P MHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRW
Sbjct  66   PFMHLRMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAPYGPRW  125

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            RMLRKI  VHLFSAKALDDF HVRQEEV TLTR+LA+A + PVKLGQLLNVCTTN+L RV
Sbjct  126  RMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANASQKPVKLGQLLNVCTTNSLARV  185

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            MLG++VF DG    DP+AEEFKSM
Sbjct  186  MLGKRVFADGTGGIDPQAEEFKSM  209



>gb|ABA64468.1| flavonoid 3'-hydroxylase [Gerbera hybrid cultivar]
Length=512

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 171/205 (83%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTL+  T V  +FLY L+ R   R P  LPPGP PWPV+GNLPHLG  PH S+AAMA++Y
Sbjct  4    LTLLIGTCVTGLFLYVLLNRC-TRNPNRLPPGPTPWPVVGNLPHLGTIPHHSLAAMAKKY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGFVDVVVAASASVAAQFLKTHDANFADRPPNSGAKHIAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFS KALDDF HVRQEEVA L R+L  AGK+PVKLGQLLNVCTTNAL R
Sbjct  123  WRMLRKICSVHLFSTKALDDFRHVRQEEVAILARALVGAGKSPVKLGQLLNVCTTNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF+ G    D +A+EFK M
Sbjct  183  VMLGRRVFDSG----DAQADEFKDM  203



>ref|XP_007037548.1| Flavonoid 3'-hydroxylase isoform 2 [Theobroma cacao]
 gb|EOY22049.1| Flavonoid 3'-hydroxylase isoform 2 [Theobroma cacao]
Length=507

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
            + +  +++ A+FLYF+   +++R+ LPLPPGPKPWP++GNLPH+G  PH S+AA+A+ YG
Sbjct  3    SFLLYSILSAVFLYFIFATLRKRHRLPLPPGPKPWPIIGNLPHMGPVPHHSLAALAKVYG  62

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHLRLGFVDVVVAASA+VAAQFLKVHD+NFS+RPPNSGA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVAAQFLKVHDANFSSRPPNSGAKYVAYNYQDLVFAPYGPRW  122

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            RMLRKI+ VHLFS KALDDF HVRQ+EV  L R+LA A KT V LGQLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDFRHVRQDEVGVLVRALADA-KTKVNLGQLLNVCTVNALGRV  181

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            MLG++VF DG  K+DP+A+EFKSM
Sbjct  182  MLGKRVFGDGSGKADPEADEFKSM  205



>gb|ADB77826.1| flavonoid 3'-hydroxylase allele 2 [Dahlia pinnata]
Length=508

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 169/205 (82%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTL+    + A+ LY L L ++ R+   LPPGP PWP++GNLPHLG  PH S+AA+AE+Y
Sbjct  4    LTLLLYASITALPLYVL-LNLRTRHSNRLPPGPTPWPIVGNLPHLGTIPHHSLAALAEKY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLR GFVDVVVAASA+VA+QFLK HD+ F++RPPNSGAEHIAYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRFGFVDVVVAASASVASQFLKTHDAKFASRPPNSGAEHIAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFS KALDDF HVRQEEVA LTR LA AG + VKLGQLLNVCTTNAL R
Sbjct  123  WRMLRKICSVHLFSGKALDDFRHVRQEEVAILTRVLAGAGNSTVKLGQLLNVCTTNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG    DPKA+EFK M
Sbjct  183  VMLGRRVFGDG----DPKADEFKDM  203



>gb|AEA06595.1| flavonoid 3'-hydroxylase [Chromolaena odorata]
Length=507

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = +1

Query  37   FLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvd  216
             +++L+L ++ R+   LPPGP PWP++GNLPHLG  PH S+AA+A++YGPLMHLRLGFVD
Sbjct  15   LVFYLLLNLRPRHSKRLPPGPSPWPIVGNLPHLGTIPHHSLAALAKKYGPLMHLRLGFVD  74

Query  217  vvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHL  396
            VVVAASA+VAAQFLK HD+NF++RPPNSGA+HIAYNY DLVFAPYGPRWRMLRKI  VHL
Sbjct  75   VVVAASASVAAQFLKTHDANFASRPPNSGAKHIAYNYHDLVFAPYGPRWRMLRKICSVHL  134

Query  397  FSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGG  576
            FS KALDDF H+RQEEVA LTR L  AG++ VKLGQLLNVCTTNAL RVMLGR+VF DG 
Sbjct  135  FSTKALDDFRHIRQEEVAILTRVLVGAGESTVKLGQLLNVCTTNALARVMLGRRVFGDGS  194

Query  577  SKSDPKAEEFKSM  615
               DPKA+EFK M
Sbjct  195  GTGDPKADEFKDM  207



>gb|AGM46642.1| flavonoid 3'-hydroxylase protein, partial [Apium graveolens]
Length=153

 Score =   246 bits (627),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG KPH S+AA+A+ YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NFS+RPPN
Sbjct  6    GNLPHLGAKPHHSLAALAKNYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFSSRPPN  65

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYNYQDLVFAPYGPRWRMLRKIT VHLFSAKALDDF HVRQEEV  LTR+LASA
Sbjct  66   SGAKHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFRHVRQEEVGILTRALASA  125

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKV  561
            GKTPVKLGQLLNVCTTNAL RVMLGR+V
Sbjct  126  GKTPVKLGQLLNVCTTNALARVMLGRRV  153



>gb|AEF30421.1| flavonoid 3'-hydroxylase, partial [Fagopyrum tataricum]
Length=277

 Score =   249 bits (637),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPH+G  PH S+AA+A+ YGPLMHLRLG V V++AASA+VA+QFLK HD+NFS+RPPN
Sbjct  6    GNLPHMGAVPHHSLAALAKVYGPLMHLRLGSVHVIIAASASVASQFLKTHDANFSSRPPN  65

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI  VHLFS KAL+DF  VR+EEV  LTR+L+ A
Sbjct  66   SGAKHIAYNYQDLVFAPYGPRWRMLRKICQVHLFSGKALEDFRFVREEEVGILTRALSKA  125

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            GK  V+LGQLLNVCTTNAL RVMLGR+VF DG  K+DPKA+EFK M
Sbjct  126  GKNAVQLGQLLNVCTTNALGRVMLGRRVFGDGSGKADPKADEFKDM  171



>ref|XP_009338402.1| PREDICTED: flavonoid 3'-monooxygenase [Pyrus x bretschneideri]
Length=511

 Score =   256 bits (655),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
             LI  T+VFA FLY +      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIVFTVVFAFFLYRIFAPSGSRHSLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            RMLRKI+ VHLFS KALDD  HVRQEEV  L   LASAG  PV L QLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSRPVNLAQLLNVCTVNALGRV  182

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            M+GR++F +G    DPKA+EFKSM
Sbjct  183  MVGRRLFGNGKGGEDPKADEFKSM  206



>gb|KDP31334.1| hypothetical protein JCGZ_11710 [Jatropha curcas]
Length=511

 Score =   256 bits (654),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG KPHQS+AA+A  YGPLMHLR+GFVDVVVAASAAVA QFLKVHD+NFS+RPPN
Sbjct  39   GNLPHLGPKPHQSLAALARSYGPLMHLRMGFVDVVVAASAAVATQFLKVHDANFSSRPPN  98

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
             GA+++AYNYQDLVFAPYGPRWRMLRKI+ VHLFS KALDDF H+RQ+EV+ LTR+LASA
Sbjct  99   CGAKYVAYNYQDLVFAPYGPRWRMLRKISSVHLFSGKALDDFRHIRQQEVSVLTRALASA  158

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            G TPV LGQLLNVCT NAL RVM+GR+VF DG    D KA+EFKSM
Sbjct  159  GPTPVNLGQLLNVCTANALGRVMIGRRVFGDGTGGGDRKADEFKSM  204



>gb|ABC47161.1| flavonoid 3'-hydroxylase [Pilosella officinarum]
Length=512

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 169/205 (82%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L+LI    +  +  Y L+  ++ R    LPPGP PWP++GNLPHLG  PH S+A +A RY
Sbjct  4    LSLIIYLCITGVTAYVLV-NLRTRRANRLPPGPTPWPIVGNLPHLGTIPHHSLADLATRY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+H+AYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPNSGAKHMAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFSAK+LDDF HVRQEEVA LTR+L  AGK+ VKLGQLL+VCTTNAL R
Sbjct  123  WRMLRKICSVHLFSAKSLDDFRHVRQEEVAILTRALVGAGKSTVKLGQLLHVCTTNALVR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG    DPKA+EFK+M
Sbjct  183  VMLGRRVFGDGSGGGDPKADEFKNM  207



>ref|XP_008393217.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=511

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
             LI  T+VFA FLY +      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIVFTVVFAFFLYRIFAPGGSRHSLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            R+LRKI+ VHLFS KALDD  HVRQEEV  L   LASAG  PV L QLLNVCT NAL RV
Sbjct  123  RLLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLAQLLNVCTVNALGRV  182

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            M+GR++F +G    DPKA+EFKSM
Sbjct  183  MVGRRLFGNGMGGEDPKADEFKSM  206



>gb|ACR14867.1| flavonoid 3' hydroxylase [Malus domestica]
Length=511

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
             LI  T+VFA FLY +      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIVFTVVFAFFLYRIFAPGGSRHSLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            R+LRKI+ VHLFS KALDD  HVRQEEV  L   LASAG  PV L QLLNVCT NAL RV
Sbjct  123  RLLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLAQLLNVCTVNALGRV  182

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            M+GR++F +G    DPKA+EFKSM
Sbjct  183  MVGRRLFGNGMGGEDPKADEFKSM  206



>gb|ACV74415.1| putative flavonoid-3'-hydroxylase [Camellia sinensis]
Length=518

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 169/209 (81%), Gaps = 4/209 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLI-LRVK--QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  171
            L  +  +L+ A+FLY L+ LR     R+P PLPPGP PWPV+GNLPHLG  PH SIA MA
Sbjct  4    LAFVLYSLLIAVFLYCLLNLRTLLFNRHPRPLPPGPTPWPVIGNLPHLGTMPHHSIATMA  63

Query  172  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  351
              YGPLMHLRLG VDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  64   RTYGPLMHLRLGLVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPY  123

Query  352  GPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGK-TPVKLGQLLNVCTTN  528
            GPRWRMLRKI  VHLFS KALDDF HVRQEE+A LTR+L SAG+   V LGQLLNVCTTN
Sbjct  124  GPRWRMLRKICSVHLFSTKALDDFRHVRQEEIAILTRALESAGQAAAVNLGQLLNVCTTN  183

Query  529  ALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            AL RVMLG +VF DG    DPKA+EFK M
Sbjct  184  ALGRVMLGHRVFGDGSGSGDPKADEFKEM  212



>gb|ADZ54783.1| flavonoid 3'-monooxygenase [Prunus avium]
Length=510

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 166/203 (82%), Gaps = 1/203 (0%)
 Frame = +1

Query  7    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  186
            LIF T+VFA FLY L++    R+ LPL PGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAAFLYRLLVP-GNRHSLPLAPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  187  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  366
            LMHLRLGFVDV+VAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVIVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  367  MLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVM  546
            MLRKI+ VHLFS KALDD  HVRQEEVA L  SLA AG   V L QLLN+CT NAL RVM
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHSLAGAGSKTVNLAQLLNICTVNALGRVM  182

Query  547  LGRKVFNDGGSKSDPKAEEFKSM  615
            +G+K+F DG    D KA+EFK M
Sbjct  183  VGKKLFADGSGSGDAKADEFKEM  205



>gb|KDO54631.1| hypothetical protein CISIN_1g020877mg [Citrus sinensis]
Length=320

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG  PHQSIA +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPN
Sbjct  47   GNLPHLGPMPHQSIAGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPN  106

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYNYQD+VF PYGPRWRMLRKI+ VHLFS KALDD+ HVRQEE+A LTR+LASA
Sbjct  107  SGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASA  166

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            G  PV L Q LN+C  NAL RVMLG +VF DG   SDP+A+EFKSM
Sbjct  167  GTEPVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGSDPRADEFKSM  212



>gb|KJB51033.1| hypothetical protein B456_008G198200 [Gossypium raimondii]
Length=422

 Score =   249 bits (635),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 174/204 (85%), Gaps = 1/204 (0%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
            + +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YG
Sbjct  3    SFVLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYG  62

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRW  122

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            R+LRKI+ +HLFS KALDDF  +R+EE+  L R+LASA KT V LGQLLNVCT NAL +V
Sbjct  123  RLLRKISSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQV  181

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            M+G++VF DG   SDP+A+EFKSM
Sbjct  182  MMGKRVFGDGSGGSDPEADEFKSM  205



>ref|XP_007209917.1| hypothetical protein PRUPE_ppa004433mg [Prunus persica]
 gb|AFC62055.1| flavonoid 3' hydroxylase [Prunus persica]
 gb|EMJ11116.1| hypothetical protein PRUPE_ppa004433mg [Prunus persica]
Length=510

 Score =   251 bits (641),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 165/203 (81%), Gaps = 1/203 (0%)
 Frame = +1

Query  7    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  186
            LIF T+VFA  LY L+     R+ LPLPPGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAALLYRLLFS-GNRHSLPLPPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  187  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  366
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVVVAASASVASQFLKTHDTNFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  367  MLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVM  546
            MLRKI+ VHLFS KALDD  HVRQEEVA L   LA AG  PV L QLLNVCT NAL RVM
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHGLAGAGSKPVNLAQLLNVCTVNALGRVM  182

Query  547  LGRKVFNDGGSKSDPKAEEFKSM  615
            +G+++F DG    D KA+EFK M
Sbjct  183  VGKRLFGDGSGSGDEKADEFKEM  205



>gb|ADK56126.1| putative flavonoid 3'-hydroxylase [Coreopsis grandiflora]
Length=512

 Score =   251 bits (641),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 165/205 (80%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLI    V  I  Y L L ++ R    LPPGP PWP++GNLPHLG  PH S+AA+A RY
Sbjct  4    LTLIIYACVTGIAAYVL-LNLRNRRAKRLPPGPTPWPIVGNLPHLGTIPHHSLAALATRY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RP +SG +H+AYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGFVDVVVAASASVAAQFLKAHDANFASRPLSSGGKHMAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLF AK+LDDF HVRQEEVA LTR+L  AGK+ V LGQLLNVCTTNAL R
Sbjct  123  WRMLRKICSVHLFPAKSLDDFRHVRQEEVAILTRALVDAGKSTVILGQLLNVCTTNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG    DPKA+EFK M
Sbjct  183  VMLGRRVFGDGSGGGDPKADEFKDM  207



>gb|KDO37751.1| hypothetical protein CISIN_1g042286mg, partial [Citrus sinensis]
Length=303

 Score =   244 bits (624),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG  PHQSIA +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPN
Sbjct  47   GNLPHLGPMPHQSIAGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPN  106

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYNYQD+VF PYGPRWRMLRKI+ VHLFS KALDD+ HVRQEE+A L R+LASA
Sbjct  107  SGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLARALASA  166

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            G  PV L Q LN+C  NAL RVMLG +VF DG   SDP+A+EFKSM
Sbjct  167  GTEPVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGSDPRADEFKSM  212



>gb|AJA79074.1| flavonoid 3' hydroxylase [Prunus persica]
 gb|AJA79081.1| flavonoid 3' hydroxylase [Prunus persica]
Length=509

 Score =   251 bits (641),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 165/203 (81%), Gaps = 1/203 (0%)
 Frame = +1

Query  7    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  186
            LIF T+VFA  LY L+     R+ LPLPPGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  9    LIFITVVFAALLYRLLFS-GNRHSLPLPPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  67

Query  187  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  366
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  68   LMHLRLGFVDVVVAASASVASQFLKTHDTNFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  127

Query  367  MLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVM  546
            MLRKI+ VHLFS KALDD  HVRQEEVA L   LA AG  PV L QLLNVCT NAL RVM
Sbjct  128  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHGLAGAGSKPVNLAQLLNVCTVNALGRVM  187

Query  547  LGRKVFNDGGSKSDPKAEEFKSM  615
            +G+++F DG    D KA+EFK M
Sbjct  188  VGKRLFGDGSGSGDEKADEFKEM  210



>dbj|BAN05297.1| flavonoid 3'-hydroxylase [Dianthus caryophyllus]
Length=514

 Score =   251 bits (641),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L L F T+  A  LY+LI  V + +  PLPPGP+PWP++GNLPH+G+ PHQ +AA+A++Y
Sbjct  4    LELTFYTIALATILYYLIPTVFRGHQKPLPPGPRPWPIVGNLPHMGQAPHQGLAALAQKY  63

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPL+++RLG+VDVVVAASA+VA QFLK HD NFS+RPPNSGA+HIAYNYQDLVFAPYGP+
Sbjct  64   GPLLYMRLGYVDVVVAASASVATQFLKTHDLNFSSRPPNSGAKHIAYNYQDLVFAPYGPK  123

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ-LLNVCTTNALT  537
            WRMLRKI  +H+FS+KALDDF  VRQEEV+ L  ++A AG  PV+LGQ LLNVCTTNAL+
Sbjct  124  WRMLRKICSLHMFSSKALDDFRLVRQEEVSILVNAIAKAGTKPVQLGQLLLNVCTTNALS  183

Query  538  RVMLGRKVFNDGGSKSDPKAEEFKSM  615
            RVMLG++V  DG  KSDPKAEEFK M
Sbjct  184  RVMLGKRVLGDGTGKSDPKAEEFKDM  209



>gb|ADB77825.1| flavonoid 3'-hydroxylase allele 1 [Dahlia pinnata]
Length=508

 Score =   251 bits (640),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 143/166 (86%), Gaps = 4/166 (2%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG  PH S+AA+AE+YGPLMHLR GFVDVVVAASA+VA+QFLK HD+ F++RPPN
Sbjct  42   GNLPHLGTIPHHSLAALAEKYGPLMHLRFGFVDVVVAASASVASQFLKTHDAKFASRPPN  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGAEHIAYNYQDLVFAPYGPRWRMLRKI  VHLFS KALDDF HVRQEEVA LTR LA A
Sbjct  102  SGAEHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDFRHVRQEEVAILTRVLAGA  161

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            G + VKLGQLLNVCTTNAL RVML R+VF DG    DPKA+EFK M
Sbjct  162  GNSTVKLGQLLNVCTTNALARVMLSRRVFGDG----DPKADEFKDM  203



>dbj|BAJ17668.1| flavonoid 3' hydroxylase [Gynura bicolor]
Length=511

 Score =   251 bits (640),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 169/205 (82%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTL+  T + A+ LY L L +  R+P  LPPGP PWP++GNLPHLG  PH  +AA+A +Y
Sbjct  4    LTLVLYTSIIALVLYVL-LNLFTRHPNRLPPGPTPWPIVGNLPHLGSIPHHGLAALATKY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+H+AYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPNSGAKHMAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WR+LRKI  VHLFS+KALDDF HVRQEEVA LTR L  A K+PVKLGQLLNVCTTNAL R
Sbjct  123  WRLLRKICSVHLFSSKALDDFRHVRQEEVAILTRDLVGAKKSPVKLGQLLNVCTTNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF  GG   D KA EFK M
Sbjct  183  VMLGRRVFGSGG--GDLKAGEFKDM  205



>dbj|BAF96945.1| flavonoid 3'-hydroxylase [Rhododendron x pulchrum]
Length=480

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG  PH SIAA+A  YGPLMHL +G V VVVAASA+VAAQFLK HD+NFS+RPPN
Sbjct  7    GNLPHLGTMPHHSIAALAREYGPLMHLWMGSVHVVVAASASVAAQFLKTHDANFSSRPPN  66

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI  VHLFSAKALDDF HVRQEEVA LTR+LA+A
Sbjct  67   SGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSAKALDDFRHVRQEEVAILTRALANA  126

Query  478  GK-TPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            GK T V LGQLLN+CTTNA+ RVMLGR+VF DG    D KA+EFKSM
Sbjct  127  GKSTTVNLGQLLNLCTTNAIARVMLGRRVFGDGSGSGDAKADEFKSM  173



>ref|XP_010030596.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW83708.1| hypothetical protein EUGRSUZ_B00582 [Eucalyptus grandis]
Length=514

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 166/205 (81%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L+LI  T+  + FLY L L    R   PLPPGP+PWP++GNLPHLG  PH SIAA+A  Y
Sbjct  4    LSLILATVAISAFLYSL-LGYLSRPARPLPPGPRPWPLVGNLPHLGPVPHHSIAALARTY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFVDVVVAASA+VAA+FLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGFVDVVVAASASVAAEFLKTHDTNFSSRPPNSGAKHIAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI+ VHLFS KAL+D+ HVRQEEVA LT +LA AG  P  L QLLNVCT NAL R
Sbjct  123  WRMLRKISSVHLFSGKALEDYRHVRQEEVAILTSALARAGSAPANLAQLLNVCTVNALGR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR++F DG    D KA+EFKSM
Sbjct  183  VMLGRRMFGDGSGGGDAKADEFKSM  207



>ref|XP_009771410.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'-monooxygenase-like 
[Nicotiana sylvestris]
Length=515

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 172/205 (84%), Gaps = 1/205 (0%)
 Frame = +1

Query  4    TLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            +LI  T++F+  L+  L L  ++RYPLPLPPGPKPWP++GNL H+G KPHQSIAAMA  Y
Sbjct  5    SLILYTVIFSFLLHSILTLFFRKRYPLPLPPGPKPWPIIGNLVHMGPKPHQSIAAMARTY  64

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHL++GFVDVVVAASA+VAAQFLK HD+NFS+RP NS  +H+AYN QDLVFAPYGPR
Sbjct  65   GPLMHLKMGFVDVVVAASASVAAQFLKTHDANFSSRPQNSCTKHLAYNSQDLVFAPYGPR  124

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFSAK LDDF HVRQ EV  LTR+LASAG+ PVKLGQLLNVCTTNALT+
Sbjct  125  WRMLRKICSVHLFSAKPLDDFRHVRQNEVRILTRALASAGQKPVKLGQLLNVCTTNALTQ  184

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF       DP+AEEFKSM
Sbjct  185  VMLGRRVFAGASGGVDPQAEEFKSM  209



>gb|AAG49298.1|AF313488_1 putative flavonoid 3'-hydroxylase [Callistephus chinensis]
Length=518

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 147/168 (88%), Gaps = 2/168 (1%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG  PH S+AA+A++YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPN
Sbjct  42   GNLPHLGMIPHHSLAALAQKYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPN  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI  VHLFS KALDDF HVR+EEVA LTR L  A
Sbjct  102  SGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSTKALDDFRHVREEEVAILTRVLVHA  161

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDG--GSKSDPKAEEFKSM  615
            G++ VKLGQLLNVCTTNAL RVMLGR+VF DG  G   DPKA+EFK M
Sbjct  162  GESAVKLGQLLNVCTTNALARVMLGRRVFADGSEGRGVDPKADEFKDM  209



>gb|ADM26615.1| flavonoid 3'-hydroxylase [Cynara cardunculus var. scolymus]
Length=512

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG+ PH ++AAMA +YGPLMHLRLG VDVVVAASA+VAAQFLKVHD+NF++RPPN
Sbjct  42   GNLPHLGRIPHHALAAMATKYGPLMHLRLGVVDVVVAASASVAAQFLKVHDANFASRPPN  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAY+YQDLVFAPYGP+WRMLRKI  VHLFS KALDDF HVR+EEVA L R+LA A
Sbjct  102  SGAKHIAYDYQDLVFAPYGPKWRMLRKICSVHLFSNKALDDFRHVREEEVAILARALAGA  161

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            G++ V LGQLLNVCTTNAL RVMLGR+VF DG    DPKA+EFK M
Sbjct  162  GRSTVALGQLLNVCTTNALARVMLGRRVFGDGSGGVDPKADEFKDM  207



>ref|XP_010259651.1| PREDICTED: flavonoid 3'-monooxygenase [Nelumbo nucifera]
Length=513

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 164/205 (80%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L  +  TL  A  +YFL   +  RYP PLPPGPKPWP++GNLPHLG  PH S+AAMA  Y
Sbjct  4    LAFVSFTLFVAFLIYFL-FNLLNRYPRPLPPGPKPWPIIGNLPHLGTVPHHSLAAMARTY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPL+HLRLG V VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  63   GPLLHLRLGSVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFS KALDDF H+RQEEVA L R+LA AGK  V +GQLL+VCTTNAL R
Sbjct  123  WRMLRKICSVHLFSGKALDDFRHIRQEEVAVLIRALAGAGKAAVNVGQLLSVCTTNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF  G    D K+EEFK M
Sbjct  183  VMLGRRVFGSGEGTGDQKSEEFKEM  207



>gb|ACO35752.1| flavonoid 3'-hydroxylase [Cosmos sulphureus]
Length=508

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 146/166 (88%), Gaps = 4/166 (2%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG  PH S+AA+A +YGPLMHLRLGFVDVVVAASA+VA+QFLK HD+NF++RPPN
Sbjct  42   GNLPHLGTTPHHSLAALAAKYGPLMHLRLGFVDVVVAASASVASQFLKTHDANFASRPPN  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGAEH+AYNYQDLVFAPYGPRWRMLRKI  VHLFS KALDDF HVRQEEVA LTR+LA A
Sbjct  102  SGAEHMAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDFRHVRQEEVAVLTRALAGA  161

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            GK+PVKLGQLL+VCTTNAL RVMLGR+VF +     D KA+EFK M
Sbjct  162  GKSPVKLGQLLSVCTTNALARVMLGRRVFGE----RDAKADEFKDM  203



>dbj|BAJ16330.1| flavonoid 3'-hydroxylase [Antirrhinum kelloggii]
Length=509

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 167/205 (81%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            +TLI  TL+    L ++ L  K +   PLPPGPKPWP++GNLPHLG KPHQS+AA+A  +
Sbjct  5    ITLIASTLILGFLLLYIFLNRKAKAAAPLPPGPKPWPIVGNLPHLGPKPHQSMAALARVH  64

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPL+HL++GFV VVVAASA+VA +FLKVHD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPR
Sbjct  65   GPLIHLKMGFVHVVVAASASVAEKFLKVHDANFSSRPPNSGAKHVAYNYQDLVFAPYGPR  124

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  +HLFSAKAL DF HVRQEEV  LTR+LA AGKTPVKLGQ+LN C TNA+ R
Sbjct  125  WRMLRKICALHLFSAKALTDFTHVRQEEVGILTRALADAGKTPVKLGQMLNTCATNAIAR  184

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+V    G     +AEEFKSM
Sbjct  185  VMLGRRVV---GHACGAEAEEFKSM  206



>ref|XP_008240031.1| PREDICTED: flavonoid 3'-monooxygenase [Prunus mume]
Length=510

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 165/203 (81%), Gaps = 1/203 (0%)
 Frame = +1

Query  7    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  186
            LIF T+VFA FLY L+     R+ LPLPPGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAAFLYRLLFS-GNRHFLPLPPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  187  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  366
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVVVAASASVASQFLKTHDTNFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  367  MLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVM  546
            MLRKI+ VHLFS KALDD  HVRQEE+A L   LA AG   V L QLLNVCT NAL RVM
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEIAVLAHGLAGAGSKTVNLAQLLNVCTVNALGRVM  182

Query  547  LGRKVFNDGGSKSDPKAEEFKSM  615
            +G+++F DG    D KA+EFK M
Sbjct  183  VGKRLFGDGSGSGDEKADEFKEM  205



>gb|ADA85878.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 168/205 (82%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A++Y
Sbjct  4    LPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALAKKY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WR+LRKI  VHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNAL R
Sbjct  123  WRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG  +S   A+EFK M
Sbjct  183  VMLGRRVFGDGIDRS---ADEFKDM  204



>gb|KHG07922.1| Flavonoid 3',5'-hydroxylase [Gossypium arboreum]
Length=510

 Score =   248 bits (633),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 174/204 (85%), Gaps = 1/204 (0%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
            + +  +++  +FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YG
Sbjct  3    SFVLYSILSTVFLYFVFIISRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYG  62

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRW  122

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            R+LRKI+ VHLFS KALDDF H+R+EE+  L R+LASA KT V LGQLLNVCT NAL +V
Sbjct  123  RLLRKISSVHLFSGKALDDFRHIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQV  181

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            M+G++VF DG   +DP+A+EFKSM
Sbjct  182  MMGKRVFGDGSGGADPEADEFKSM  205



>gb|KJB51032.1| hypothetical protein B456_008G198200 [Gossypium raimondii]
Length=510

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 174/204 (85%), Gaps = 1/204 (0%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
            + +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YG
Sbjct  3    SFVLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYG  62

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRW  122

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            R+LRKI+ +HLFS KALDDF  +R+EE+  L R+LASA KT V LGQLLNVCT NAL +V
Sbjct  123  RLLRKISSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQV  181

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            M+G++VF DG   SDP+A+EFKSM
Sbjct  182  MMGKRVFGDGSGGSDPEADEFKSM  205



>gb|ADA85883.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
 gb|AGX01487.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 167/205 (81%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A++Y
Sbjct  4    LPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALAKKY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WR+LRKI  VHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNAL R
Sbjct  123  WRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG  +S   A EFK M
Sbjct  183  VMLGRRVFGDGIDRS---ANEFKDM  204



>gb|ADA85882.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 167/205 (81%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A++Y
Sbjct  4    LPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALAKKY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WR+LRKI  VHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNAL R
Sbjct  123  WRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG  +S   A EFK M
Sbjct  183  VMLGRRVFGDGIDRS---ANEFKDM  204



>gb|ADT63065.1| flavonoid 3'-hydroxylase, partial [Fagopyrum esculentum]
Length=457

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPH+G  PH S+AA+A+ YGPLMHLRLG V V++AASA+VA+QFLK HD+NFS+RPPN
Sbjct  6    GNLPHMGAVPHHSLAALAKVYGPLMHLRLGSVHVIIAASASVASQFLKTHDANFSSRPPN  65

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI  VHLFS KAL+DF  VR+EEV  LT +L+ A
Sbjct  66   SGAKHIAYNYQDLVFAPYGPRWRMLRKICQVHLFSGKALEDFRFVREEEVGILTGALSKA  125

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            GK  V+LGQLLNVCTTNAL RVMLGR+VF DG  K+DPKA+EFK M
Sbjct  126  GKNAVQLGQLLNVCTTNALGRVMLGRRVFGDGSGKADPKADEFKDM  171



>gb|AGC29948.1| CYP75B65 [Sinopodophyllum hexandrum]
Length=510

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            + LI  TLV    +Y +I ++  R PLPLPPGPKPWP++GNLPHLG  PH S+A++A +Y
Sbjct  4    IELILSTLVIGTIVYTIISKLINRTPLPLPPGPKPWPIVGNLPHLGPVPHHSLASLASKY  63

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLG V+V+VAAS++VA Q  K HD+NFS+RPPNSGA+HIAYNYQDLVFAPYGP+
Sbjct  64   GPLMHLRLGSVNVIVAASSSVAVQIFKTHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPK  123

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFSAKALDDF H+RQEEV  LT+ L  AGK PV L +LLNVCTTNAL R
Sbjct  124  WRMLRKICSVHLFSAKALDDFRHIRQEEVMVLTKVLLGAGKAPVDLAKLLNVCTTNALGR  183

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG    D K++EFK+M
Sbjct  184  VMLGRRVFGDG--NGDEKSDEFKNM  206



>gb|AHZ31753.1| flavonoid 3'-hydroxylase [Viola x wittrockiana]
Length=508

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG  PH++IAA+A  YGPLMHLRLG V+VVVAASA+VAAQFLK HDSNFS+RPPN
Sbjct  40   GNLPHLGPAPHRNIAALARTYGPLMHLRLGSVNVVVAASASVAAQFLKTHDSNFSSRPPN  99

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI+ VHLFS KALDD  +VRQEEVA LTR+LASA
Sbjct  100  SGAKHIAYNYQDLVFAPYGPRWRMLRKISSVHLFSGKALDDGRYVRQEEVALLTRTLASA  159

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            G   V L QLLN+C  NAL RVMLGR+VF+DG +  DPKA+EFKSM
Sbjct  160  GDAAVNLAQLLNICAANALGRVMLGRRVFSDGSACGDPKADEFKSM  205



>gb|AEN71546.1| flavanone 3'-hydroxylase [Paeonia suffruticosa]
Length=512

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 173/207 (84%), Gaps = 2/207 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  174
            +T +  TL    F+Y L+ LR +   +P  LPPGP+PWP++GNLPHLG KPHQS+A++A 
Sbjct  4    VTFLLFTLAVTCFVYLLVNLRTLVNSHPHRLPPGPRPWPIVGNLPHLGSKPHQSLASLAR  63

Query  175  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  354
             YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+NF+NRPPNSGA++IAYNYQDLVFAPYG
Sbjct  64   SYGPLMHLRLGFVDVVVAASASVAAQFLKTNDANFANRPPNSGAKYIAYNYQDLVFAPYG  123

Query  355  PRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL  534
            PRWR+LRK++ +HLFS KALDDF H+RQEEVA LT +LASA  + V LGQLLNVCTTNAL
Sbjct  124  PRWRLLRKVSSLHLFSGKALDDFRHLRQEEVAVLTHALASARDSLVNLGQLLNVCTTNAL  183

Query  535  TRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             RVMLG++VF DG   +DPKA+EFK M
Sbjct  184  ARVMLGKRVFGDGSGGADPKADEFKGM  210



>dbj|BAF49324.1| flavonoid 3'-hydroxylase [Lobelia erinus]
Length=515

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 166/212 (78%), Gaps = 10/212 (5%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLI-------LRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSI  159
            ++LIF T + A  LY L+       L        PLPPGPKPWP++GNLPHLG  PHQ++
Sbjct  1    MSLIFYTCIIAFLLYVLLSTLRTFLLNRNPASRKPLPPGPKPWPIVGNLPHLGTMPHQTM  60

Query  160  AAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLV  339
            AA+A  YGPLMHLRLG VDVVVAAS AVA QFLKVHD+NF NRPPNSGA HIAYNYQDLV
Sbjct  61   AALARTYGPLMHLRLGSVDVVVAASGAVAEQFLKVHDANFLNRPPNSGAVHIAYNYQDLV  120

Query  340  FAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVC  519
            FAPYGPRWR+LRK++ VHLFSAKALDDF HVRQEEVA LTR LASAG  PV L QLL+VC
Sbjct  121  FAPYGPRWRLLRKVSAVHLFSAKALDDFRHVRQEEVAVLTRDLASAGNAPVHLNQLLSVC  180

Query  520  TTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            TTNAL+RVM G++VF  GG   D KA+EFK M
Sbjct  181  TTNALSRVMFGKRVFGGGG---DSKADEFKQM  209



>gb|ADP24158.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
 gb|ADP24159.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
Length=510

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 174/204 (85%), Gaps = 1/204 (0%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
            + +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YG
Sbjct  3    SFVLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYG  62

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRW  122

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            R+LRK++ +HLFS KALDDF  +R+EE+  L R+LASA KT V LGQLLNVCT NAL +V
Sbjct  123  RLLRKMSSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQV  181

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            M+G++VF DG   SDP+A+EFKSM
Sbjct  182  MMGKRVFGDGSGGSDPEADEFKSM  205



>gb|KEH32010.1| flavonoid hydroxylase [Medicago truncatula]
Length=510

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 175/207 (85%), Gaps = 3/207 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L ++F T+  AI +Y L L +  +  LPLPPGP PWP++GNLPH+G  PH ++A +A ++
Sbjct  4    LIIVFATIAAAILIYRL-LNLITKPSLPLPPGPSPWPIVGNLPHMGPVPHHALAVLALKH  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLG+VDV+VAASA+VA QFLKVHD+NFS+RP NSGA+++AYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGYVDVIVAASASVAEQFLKVHDTNFSSRPTNSGAKYLAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WR+LRKI++VH+FS+KALD+F H+RQEEVA L R+LAS+G   V LGQ+LNVCTTNAL R
Sbjct  123  WRLLRKISYVHMFSSKALDEFRHIRQEEVARLIRNLASSGSKAVNLGQMLNVCTTNALAR  182

Query  541  VMLGRKVFND--GGSKSDPKAEEFKSM  615
            VM+GR+VFN+  GG + DP+A+EFKSM
Sbjct  183  VMIGRRVFNEGNGGCECDPRADEFKSM  209



>ref|XP_011072866.1| PREDICTED: flavonoid 3'-monooxygenase [Sesamum indicum]
Length=511

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 168/205 (82%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLI  T +  +FLY  +   ++R  + LPPGP+PWP++GNL  LG KPHQS+AA+A  Y
Sbjct  5    LTLIVYTSILCLFLYSFL---RRRRSVRLPPGPRPWPIVGNLLQLGPKPHQSMAALARVY  61

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHL++GFV+VVVAASA VA QFLKVHD+NFSNRPPN+GAE++AYNYQD+VFAPYGPR
Sbjct  62   GPLMHLKMGFVNVVVAASAGVAEQFLKVHDANFSNRPPNAGAEYVAYNYQDMVFAPYGPR  121

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WR+LRKI  VH+FSAKALDDF HVRQEEV  LTR+LASAG+TP +LGQ+LNVC TNA+ R
Sbjct  122  WRLLRKICAVHVFSAKALDDFRHVRQEEVGILTRALASAGQTPARLGQMLNVCATNAIAR  181

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+V        D KAEEFK+M
Sbjct  182  VMLGRRVVGHRHGGGDEKAEEFKAM  206



>gb|AEX07282.1| F3'H [Arachis hypogaea]
Length=517

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 172/206 (83%), Gaps = 3/206 (1%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
            ++ F T+  AI +Y  I++   R  LPLPPGPKPWP++GNLPHLG  PH +IAA+A+ +G
Sbjct  6    SIAFATIALAILIY-RIVKFVTRPSLPLPPGPKPWPIIGNLPHLGPVPHHAIAALAKVHG  64

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHLRLG VDVVVAASA VA QFLKVHD+NFS+RPPN+GA++IAYNYQDLVFAPYGPRW
Sbjct  65   PLMHLRLGMVDVVVAASAKVAEQFLKVHDANFSSRPPNAGAKYIAYNYQDLVFAPYGPRW  124

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTP--VKLGQLLNVCTTNALT  537
            RMLRKI+ +HLFSAKALDDF H+RQ EVA LT+++AS+  T   V LGQLLNVCTTNAL 
Sbjct  125  RMLRKISSLHLFSAKALDDFKHLRQGEVARLTKNIASSTDTSKAVNLGQLLNVCTTNALA  184

Query  538  RVMLGRKVFNDGGSKSDPKAEEFKSM  615
            RVM+GR+VFNDG    DP+A+EFKSM
Sbjct  185  RVMIGRRVFNDGNGGCDPRADEFKSM  210



>gb|ACY06905.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
Length=510

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 172/202 (85%), Gaps = 1/202 (0%)
 Frame = +1

Query  10   IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  189
            +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP +GNLPH+   PHQ +AAMA+ YGPL
Sbjct  5    VLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPSIGNLPHMSPVPHQGLAAMAKVYGPL  64

Query  190  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  369
            MHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRWR+
Sbjct  65   MHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRWRL  124

Query  370  LRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVML  549
            LRK++ +HLFS KALDDF  +R+EE+  L R+LASA KT V LGQLLNVCT NAL +VM+
Sbjct  125  LRKMSSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQVMM  183

Query  550  GRKVFNDGGSKSDPKAEEFKSM  615
            G++VF DG   SDP+A+EFKSM
Sbjct  184  GKRVFGDGSGGSDPEADEFKSM  205



>dbj|BAE71221.1| putative flavonoid 3'-hydroxylase [Trifolium pratense]
Length=510

 Score =   246 bits (628),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 176/205 (86%), Gaps = 3/205 (1%)
 Frame = +1

Query  7    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  186
            ++F T+V AI +  L+  +K +  LPLPPGP PWP++GNLPH+G  PH ++AA+A ++GP
Sbjct  6    IVFVTIVAAILINRLLNLIK-KPTLPLPPGPSPWPIVGNLPHMGPVPHHALAALALKHGP  64

Query  187  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  366
            LMHL+LGFVDV+VAASA+VA QFLKVHD+NFS+RPPNSGA++IAYNYQDLVFAPYGPRWR
Sbjct  65   LMHLQLGFVDVIVAASASVAEQFLKVHDANFSSRPPNSGAKYIAYNYQDLVFAPYGPRWR  124

Query  367  MLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVM  546
            +LRKI++VH+FS+KALDDF H+RQ+EVA L R+L+++G     LGQ+LNVCTTNAL RVM
Sbjct  125  LLRKISYVHMFSSKALDDFRHIRQDEVARLIRNLSNSGSKAANLGQMLNVCTTNALARVM  184

Query  547  LGRKVFND--GGSKSDPKAEEFKSM  615
            +GR+VFN+  GG + DP+A+EFKSM
Sbjct  185  IGRRVFNEGNGGCECDPRADEFKSM  209



>gb|ACO35755.1| chalcone 3-hydroxylase [Cosmos sulphureus]
Length=512

 Score =   245 bits (626),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG  PHQS+A +A +YGPLM+LRLGFVDVVVAASA+VAAQFLKVHD NF++RP +
Sbjct  42   GNLPHLGASPHQSLATLAAKYGPLMYLRLGFVDVVVAASASVAAQFLKVHDLNFASRPLS  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SG ++IAYNYQD+VFAPYGPRWRMLRKI  VH+FSAKA+D F HVRQEEVA LTR+L SA
Sbjct  102  SGGKYIAYNYQDMVFAPYGPRWRMLRKICSVHMFSAKAMDGFRHVRQEEVAILTRTLVSA  161

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            GK+PVKLGQ+LNVCTTNAL RV+LGR+VF DG +  DPKA+EFK M
Sbjct  162  GKSPVKLGQILNVCTTNALARVVLGRRVFADGSAGGDPKADEFKDM  207



>ref|XP_006440736.1| hypothetical protein CICLE_v10019637mg [Citrus clementina]
 gb|ESR53976.1| hypothetical protein CICLE_v10019637mg [Citrus clementina]
Length=538

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG  PHQSIA +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPN
Sbjct  69   GNLPHLGPMPHQSIAGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPN  128

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYNYQD+VF PYGPRWRMLRKI+ VHLFS KALDD+ HVRQEE+A LTR+LASA
Sbjct  129  SGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASA  188

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            G  PV L Q LN+C  NAL RVMLG +VF DG   SDP+A+EFKSM
Sbjct  189  GTEPVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGSDPRADEFKSM  234



>gb|AIU98513.1| flavonoid 3'-hydroxylase [Paeonia suffruticosa]
Length=512

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 173/207 (84%), Gaps = 2/207 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  174
            +T +  TL    F+Y L+ LR +   +P  LPPGP+PWP++GNLPHLG KPHQS+A++A 
Sbjct  4    VTFLLFTLAVTCFVYLLVNLRTLVNSHPHRLPPGPRPWPIVGNLPHLGSKPHQSLASLAR  63

Query  175  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  354
             YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+NF+NRPPNSGA++IAYNYQDLVFAPYG
Sbjct  64   SYGPLMHLRLGFVDVVVAASASVAAQFLKTNDANFANRPPNSGAKYIAYNYQDLVFAPYG  123

Query  355  PRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL  534
            PRWR+LRK++ +HLFS KALDDF H+RQEEVA LT +LASA  + V LGQLLNVCTTNAL
Sbjct  124  PRWRLLRKVSSLHLFSGKALDDFRHLRQEEVAVLTHALASARDSLVNLGQLLNVCTTNAL  183

Query  535  TRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             RVMLG++VF DG   +DPKA++FK M
Sbjct  184  ARVMLGKRVFGDGSGGADPKADKFKDM  210



>gb|AGL81348.1| flavanone 3' hydroxylase [Pyrus communis]
Length=511

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 160/204 (78%), Gaps = 0/204 (0%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
             LI  T+VFA FLY +      R+ LPLPPGPKPWP+ GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIVFTVVFAFFLYRIFAPGWSRHSLPLPPGPKPWPIXGNLPHLGPVPHHSLAALARQYG  62

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PLMHLRLGFVDVVVA SA+VA+QF K  D NFS+RPPNSGA+H+AYNYQ LVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAXSASVASQFXKTXDXNFSSRPPNSGAKHLAYNYQXLVFAPYGPRW  122

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            RM RKI+ VHLFS KALDD  HVRQEEV  L   LASAG  PV L QLLNVCT NAL RV
Sbjct  123  RMXRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSRPVNLAQLLNVCTVNALGRV  182

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            M+GR++F +G    DPKA+EFKSM
Sbjct  183  MVGRRLFGNGKGGEDPKADEFKSM  206



>gb|ADA85879.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 166/205 (81%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A++Y
Sbjct  4    LPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALAKKY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WR+LRKI  VHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNAL R
Sbjct  123  WRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF  G  +S   A EFK M
Sbjct  183  VMLGRRVFGGGIDRS---ANEFKDM  204



>gb|ACO35756.1| flavonoid 3'-hydroxylase [Tagetes erecta]
Length=509

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 171/205 (83%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTL+  T + +  LY L+L ++ R+P  LPPGP PWP++GNLPHLG  PH S+A +A +Y
Sbjct  4    LTLLLYTSITSPVLY-LLLNLRTRHPNRLPPGPTPWPIVGNLPHLGTIPHHSLARLAVKY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFVDVVVAASA+VAAQFLK +D+ F++RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGFVDVVVAASASVAAQFLKTNDAIFASRPPNSGAKHIAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFSAKALDDF H+RQEEVA LTR+L  AG++ VKLGQLLNVCTTNAL R
Sbjct  123  WRMLRKICSVHLFSAKALDDFRHIRQEEVAILTRALIGAGESTVKLGQLLNVCTTNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF D G   D KA+EFK M
Sbjct  183  VMLGRRVFGDTG---DLKADEFKDM  204



>gb|AAO47850.1| defective flavonoid 3'-hydroxylase [Glycine max]
Length=298

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            +GA++IAYNYQDLVFAPYGPRWR+LRK+T VHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
                V LGQLLNVCTTNAL R M+GR+VFNDG    DP+A+EFK+M
Sbjct  162  DTKAVNLGQLLNVCTTNALARAMIGRRVFNDGNGGCDPRADEFKAM  207



>gb|ACO35754.1| flavonoid 3'-hydroxylase [Dahlia pinnata]
Length=509

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 171/205 (83%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTL+  T + +  LY L+L ++ R+P  LPPGP PWP++GNLPHLG  PH S+A +A +Y
Sbjct  4    LTLLLYTSITSPVLY-LLLNLRTRHPNRLPPGPTPWPIVGNLPHLGTIPHHSLARLAVKY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFVDVVVAASA+VAAQFLK +D+ F++RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGFVDVVVAASASVAAQFLKTNDAIFASRPPNSGAKHIAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFSAKALDDF H+RQEEVA LTR+L  AG++ VKLGQLLNVCTTNAL R
Sbjct  123  WRMLRKICSVHLFSAKALDDFRHIRQEEVAILTRALIGAGESTVKLGQLLNVCTTNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF D G   D KA+EFK M
Sbjct  183  VMLGRRVFGDTG---DLKADEFKDM  204



>ref|XP_006477655.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=516

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG  PHQSIA +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPN
Sbjct  47   GNLPHLGPMPHQSIAGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPN  106

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYNYQD+VF PYGPRWRMLRKI+ VHLFS KALDD+ HVRQEE+A L R+LASA
Sbjct  107  SGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLARALASA  166

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            G  PV L Q LN+C  NAL RVMLG +VF DG   SDP+A+EFKSM
Sbjct  167  GTEPVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGSDPRADEFKSM  212



>gb|ACN65827.1| flavonoid 3'-hydroxylase [Centaurea cyanus]
Length=514

 Score =   243 bits (620),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLGK PH ++AAMA++YGPLMHLR G VDVVVAASA+VAAQFLKVHD+NF++RPPN
Sbjct  43   GNLPHLGKMPHHALAAMADKYGPLMHLRFGVVDVVVAASASVAAQFLKVHDANFASRPPN  102

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+H+AY+YQDLVFAPYG +WRMLRKI  VHLFS KALDDF HVR+EEVA LTR+LA A
Sbjct  103  SGAKHLAYDYQDLVFAPYGLKWRMLRKICSVHLFSNKALDDFRHVREEEVAVLTRALAGA  162

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            G + V LGQLLNVCTTNAL RVMLGR+VF DG    D KA+EFK M
Sbjct  163  GGSTVALGQLLNVCTTNALARVMLGRRVFGDGSGGGDRKADEFKEM  208



>gb|ADA85881.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 166/205 (81%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A++Y
Sbjct  4    LPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALAKKY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WR+LRKI  VHLFSAKALDDF HVRQE+VA LTR L SAG +PV+LGQLLNVC TNAL R
Sbjct  123  WRLLRKICSVHLFSAKALDDFRHVRQEKVAVLTRVLVSAGNSPVQLGQLLNVCATNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+V  DG  +S   A EFK M
Sbjct  183  VMLGRRVSGDGIDRS---ANEFKDM  204



>ref|XP_004508739.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=503

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 168/204 (82%), Gaps = 4/204 (2%)
 Frame = +1

Query  13   FCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLM  192
            F T+  AI +Y  I ++  R  +PLPPGP+PWP++GNLPH+G  PH ++AA+A ++GPLM
Sbjct  8    FATIAAAILIY-RIFKLITRPSIPLPPGPRPWPIVGNLPHMGPVPHHALAALAHKHGPLM  66

Query  193  HLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRML  372
            HLRLGFVDV+VAASA VA QFLKVHD+NFS+RPPNSGA+++AYNYQDLVFAPYGPRWR+L
Sbjct  67   HLRLGFVDVIVAASATVAEQFLKVHDANFSSRPPNSGAKYVAYNYQDLVFAPYGPRWRLL  126

Query  373  RKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVMLG  552
            RKI +VH+FS KALDD  H+RQEEV  L R+LAS+G   V L Q+LNVCTTNAL RVM+G
Sbjct  127  RKIAYVHMFSTKALDDVRHLRQEEVGRLIRNLASSGSKAVNLSQMLNVCTTNALARVMIG  186

Query  553  RKVFND---GGSKSDPKAEEFKSM  615
            R+VFN+    G + DP+A+EFKSM
Sbjct  187  RRVFNESNGSGCECDPRADEFKSM  210



>gb|ADZ28515.1| flavonoid-3'-hydroxylase [Camellia nitidissima]
Length=518

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 165/209 (79%), Gaps = 4/209 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLI-LRVK--QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  171
            L  +  +L+   FLY L+ LR     R+P PLPPGPKPWPV+GNLPHLG  PH SIAAMA
Sbjct  4    LAFVLYSLLIGFFLYCLLNLRTLLFNRHPRPLPPGPKPWPVIGNLPHLGTMPHHSIAAMA  63

Query  172  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  351
              YGPLMHLRLG VDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  64   RTYGPLMHLRLGLVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPY  123

Query  352  GPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTR-SLASAGKTPVKLGQLLNVCTTN  528
            GPRWRMLRKI  VHLFS KALDDF HVRQEE+A LTR   ++     V LGQLLNVCTTN
Sbjct  124  GPRWRMLRKICSVHLFSTKALDDFRHVRQEEIAILTRALASAGQAAAVNLGQLLNVCTTN  183

Query  529  ALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            AL RVMLG +VF DG    DPKA+EFK M
Sbjct  184  ALGRVMLGHRVFGDGSGSGDPKADEFKEM  212



>ref|XP_010491421.1| PREDICTED: flavonoid 3'-monooxygenase-like [Camelina sativa]
Length=509

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 166/205 (81%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            +T +F T+V A  L+ L+    +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTTLFLTVVLATVLFCLLFLFSRRRNPRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI+ VHLFSAKAL+DF HVRQEEVAT+TR LA  G   V LGQL+N+C  NAL+R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVATMTRELAQVGTKAVNLGQLVNMCVVNALSR  180

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
             M+GR++F   G+ +D KAEEF+SM
Sbjct  181  EMIGRRLF---GADADHKAEEFRSM  202



>gb|ACM62746.1| flavonoid 3'-hydroxylase [Garcinia mangostana]
Length=507

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 165/202 (82%), Gaps = 3/202 (1%)
 Frame = +1

Query  10   IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  189
            I  +++ AI +Y LI          LPPGP+P P++GNLPHLG  PHQSIA++ ++YGPL
Sbjct  5    ILYSILIAILVYVLIKLGSLSSGRRLPPGPRPLPLVGNLPHLGSMPHQSIASLVKKYGPL  64

Query  190  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  369
            M+LRLG+VDVVVAASA+VAAQ  K HD+NFS+RPPNSGA+++AYNY DLVFAPYGPRWRM
Sbjct  65   MYLRLGYVDVVVAASASVAAQIFKNHDANFSSRPPNSGAKYVAYNYHDLVFAPYGPRWRM  124

Query  370  LRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVML  549
            LRKI+ VHLFS KALDDF H+R+ E+A LT++LASAGK PV LGQLLNVCTTNAL RVM+
Sbjct  125  LRKISSVHLFSNKALDDFRHIREAELAVLTQTLASAGKAPVNLGQLLNVCTTNALGRVMV  184

Query  550  GRKVFNDGGSKSDPKAEEFKSM  615
            GR+VFNDG    DPKA +FK M
Sbjct  185  GRRVFNDG---VDPKASDFKDM  203



>gb|AHY35313.1| flavonoid 3'-hydroxylase 1 [Morus notabilis]
Length=508

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 167/205 (81%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            +T I  +++FA+ +Y L+  +  R    LPPGP+ WPV+GNLPHLG+ PHQ++A +A ++
Sbjct  4    ITTILLSILFAVLVYRLVNNLI-RSRRKLPPGPRQWPVIGNLPHLGQAPHQTMATLARKH  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLG VDVVVAASA++AAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVF PYG R
Sbjct  63   GPLMHLRLGQVDVVVAASASMAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFRPYGQR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WR+LRKIT VHLFS KAL+DF HVRQEEVA L  +LA+ G T V LGQLLNVCT NAL R
Sbjct  123  WRLLRKITSVHLFSGKALEDFRHVRQEEVAVLISALANRGSTAVNLGQLLNVCTVNALGR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
             MLG +VF DG  KS+P+A+EFKSM
Sbjct  183  TMLGYRVFGDGSGKSEPRADEFKSM  207



>ref|XP_010105826.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|AHB19303.1| flavonoid 3'-hydroxylase, partial [Morus alba]
 gb|EXC06425.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=508

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 167/205 (81%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            +T I  +++FA+ +Y L+  +  R    LPPGP+ WPV+GNLPHLG+ PHQ++A +A ++
Sbjct  4    ITTILLSILFAVLVYRLVNNLI-RSRRKLPPGPRQWPVIGNLPHLGQAPHQTMATLARKH  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLG VDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVF PYG R
Sbjct  63   GPLMHLRLGQVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFRPYGQR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WR+LRKIT VHLFS KAL+DF HVRQEEVA L  +LA+ G T V LGQLLNVCT NAL R
Sbjct  123  WRLLRKITSVHLFSGKALEDFRHVRQEEVAVLISALANRGSTAVNLGQLLNVCTVNALGR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
             MLG +VF DG  KS+P+A+EFKSM
Sbjct  183  TMLGYRVFGDGSGKSEPRADEFKSM  207



>gb|ADA85880.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 165/205 (80%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A++Y
Sbjct  4    LPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALAKKY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPL HLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAP GPR
Sbjct  63   GPLTHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPCGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WR+LRKI  VHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNAL R
Sbjct  123  WRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNALAR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG  +S   A EFK M
Sbjct  183  VMLGRRVFGDGIDRS---ANEFKDM  204



>gb|AAO47844.1| gray pubescence flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47845.1| gray pubescence flavonoid 3'-hydroxylase [Glycine max]
Length=394

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            +GA++IAYNYQDLVFAPYGPRWR+LRK+T VHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
                V LGQLLNVCTTNAL R M+GR+VFNDG    DP+A+EFK+M
Sbjct  162  DTKAVNLGQLLNVCTTNALARAMIGRRVFNDGNGGCDPRADEFKAM  207



>ref|XP_007138248.1| hypothetical protein PHAVU_009G192400g [Phaseolus vulgaris]
 gb|ESW10242.1| hypothetical protein PHAVU_009G192400g [Phaseolus vulgaris]
Length=506

 Score =   240 bits (613),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 165/201 (82%), Gaps = 0/201 (0%)
 Frame = +1

Query  13   FCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLM  192
            F T+   I ++ LI  + +   LPLPPGPKPWPV+GN PH+G  PH S+AA+ + +GPLM
Sbjct  8    FATVAAVILVHRLIKFLTRNSSLPLPPGPKPWPVVGNFPHMGPVPHHSLAALVQVHGPLM  67

Query  193  HLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRML  372
            HLRLGFVD+VVAASA+VA QFLK+HDSNFS+RPPN+GA++IAYNYQDLVFAPYGPRWR+L
Sbjct  68   HLRLGFVDMVVAASASVAEQFLKIHDSNFSSRPPNAGAKYIAYNYQDLVFAPYGPRWRLL  127

Query  373  RKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVMLG  552
            RK+T VHLFS KALD F H+R+EEV  LTR+L S+    V LGQ+LNVCTTNAL RVM+G
Sbjct  128  RKLTSVHLFSGKALDVFRHLREEEVGRLTRNLGSSDAKAVNLGQVLNVCTTNALARVMIG  187

Query  553  RKVFNDGGSKSDPKAEEFKSM  615
            R+VFNDG    DP+A+EFKSM
Sbjct  188  RRVFNDGNGGCDPRADEFKSM  208



>ref|XP_006399285.1| hypothetical protein EUTSA_v10013289mg [Eutrema salsugineum]
 gb|ESQ40738.1| hypothetical protein EUTSA_v10013289mg [Eutrema salsugineum]
Length=510

 Score =   240 bits (613),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 165/205 (80%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            +T +F T++ A F++ L+L    R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTTLFITILLATFIFLLVLLFSLRRNHRLPPGPNPWPIIGNLPHMGHKPHQTLAAMVTTY  60

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GP+++LRLGF DVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILYLRLGFADVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI+ VHLFSAKAL+DF HVRQEEV TL R L+ AG  PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELSRAGTKPVNLGQLVNMCVINALGR  180

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
             M+GR++F   G+ +D KAEEF+SM
Sbjct  181  EMIGRRLF---GAGADHKAEEFRSM  202



>ref|XP_010258076.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nelumbo nucifera]
 ref|XP_010258077.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nelumbo nucifera]
Length=516

 Score =   240 bits (613),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 159/196 (81%), Gaps = 0/196 (0%)
 Frame = +1

Query  28   FAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLG  207
            F  FL +  L    RYP PLPPGPKPWP++GNLPHLG  PH +IAA+A  YGPL+HLRLG
Sbjct  12   FVAFLIYFFLNFSNRYPRPLPPGPKPWPIIGNLPHLGPVPHHTIAALARVYGPLLHLRLG  71

Query  208  FvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITF  387
             V VVVAASA+VA+QFLK HD+NFS+RPPNSGA+HIAYNY DLVFAPYGPRWR+LRKI  
Sbjct  72   SVHVVVAASASVASQFLKTHDANFSSRPPNSGAKHIAYNYHDLVFAPYGPRWRLLRKICS  131

Query  388  VHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVMLGRKVFN  567
            VHLFS KALDDF HVRQEEVA LTR+L+ +G +P+ +GQLLNVCTTNAL RVMLGR+VF 
Sbjct  132  VHLFSGKALDDFRHVRQEEVAVLTRALSRSGTSPLNVGQLLNVCTTNALARVMLGRRVFE  191

Query  568  DGGSKSDPKAEEFKSM  615
                  + K++EFK M
Sbjct  192  SDDGTGNRKSDEFKEM  207



>gb|ACO35757.1| flavonoid 3'-hydroxylase [Rudbeckia hirta]
Length=509

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 145/166 (87%), Gaps = 3/166 (2%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG  PH S+A +A +YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+ F++RPPN
Sbjct  42   GNLPHLGTIPHHSLARLAAKYGPLMHLRLGFVDVVVAASASVAAQFLKTNDAIFASRPPN  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI  VHLFSAKALDDF H+RQEEVA LTR+L  A
Sbjct  102  SGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSAKALDDFRHIRQEEVAILTRALIGA  161

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            G++ VKLGQLLNVCTTNAL RVMLGR+VF+D G   D KA+EFK M
Sbjct  162  GESTVKLGQLLNVCTTNALARVMLGRRVFSDTG---DLKADEFKDM  204



>gb|ABY89687.1| flavonoid 3` hydroxylase 1 protein [Brassica rapa subsp. oleifera]
Length=511

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 165/205 (80%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI+ VHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLVRELARANTKPVNLGQLVNMCVLNALGR  180

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
             M+GR++F   G+ +D KAEEF+SM
Sbjct  181  EMIGRRLF---GADADHKAEEFRSM  202



>ref|XP_003598945.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
 gb|AES69196.1| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 144/168 (86%), Gaps = 2/168 (1%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GN+PHLG  PHQSIAA+A+ +GPLMHL+LGFVDV+VAAS +VA QFLKVHD+NFS+RPPN
Sbjct  43   GNMPHLGPAPHQSIAALAKIHGPLMHLKLGFVDVIVAASGSVAEQFLKVHDANFSSRPPN  102

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLAS-  474
            +GA++IAYNYQDLVFAPYGPRWRMLRKI+ VHLFS K +++F H+RQEEVA LT +LAS 
Sbjct  103  TGAKYIAYNYQDLVFAPYGPRWRMLRKISSVHLFSNKVMEEFKHLRQEEVARLTSNLASN  162

Query  475  -AGKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             +    V LGQLLNVCTTNAL RVMLGR+VFNDG    DPKA+EFK M
Sbjct  163  YSNTKAVNLGQLLNVCTTNALARVMLGRRVFNDGNGGCDPKADEFKEM  210



>emb|CDX69984.1| BnaA10g23330D [Brassica napus]
Length=511

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 165/205 (80%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI+ VHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGR  180

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
             M+GR++F   G+ +D KAEEF+SM
Sbjct  181  EMIGRRLF---GADADHKAEEFRSM  202



>gb|ABC58722.1| flavonoid 3'-hydroxylase [Brassica napus]
 gb|ABC58723.1| flavonoid 3'-hydroxylase [Brassica napus]
Length=511

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 165/205 (80%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI+ VHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGR  180

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
             M+GR++F   G+ +D KAEEF+SM
Sbjct  181  EMIGRRLF---GADADHKAEEFRSM  202



>gb|KEH33153.1| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 144/168 (86%), Gaps = 2/168 (1%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GN+PHLG  PHQSIAA+A+ +GPLMHL+LGFVDV+VAAS +VA QFLKVHD+NFS+RPPN
Sbjct  43   GNMPHLGPAPHQSIAALAKIHGPLMHLKLGFVDVIVAASGSVAEQFLKVHDANFSSRPPN  102

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLAS-  474
            +GA++IAYNYQDLVFAPYGPRWRMLRKI+ VHLFS K +++F H+RQEEVA LT +LAS 
Sbjct  103  TGAKYIAYNYQDLVFAPYGPRWRMLRKISSVHLFSNKVMEEFKHLRQEEVARLTSNLASN  162

Query  475  -AGKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             +    V LGQLLNVCTTNAL RVMLGR+VFNDG    DPKA+EFK M
Sbjct  163  YSDTKAVNLGQLLNVCTTNALARVMLGRRVFNDGNGGCDPKADEFKEM  210



>ref|XP_009122411.1| PREDICTED: flavonoid 3'-monooxygenase [Brassica rapa]
Length=511

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 165/205 (80%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI+ VHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGR  180

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
             M+GR++F   G+ +D KAEEF+SM
Sbjct  181  EMIGRRLF---GADADHKAEEFRSM  202



>gb|ABY89688.1| flavonoid 3` hydroxylase 2 protein [Brassica rapa subsp. oleifera]
Length=511

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 165/205 (80%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI+ VHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGR  180

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
             M+GR++F   G+ +D KAEEF+SM
Sbjct  181  EMIGRRLF---GADADHKAEEFRSM  202



>ref|XP_010423152.1| PREDICTED: flavonoid 3'-monooxygenase-like [Camelina sativa]
Length=509

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            +T +F T+V A  L+ L+    +R    LPPGP PWP++GNLPH+G KPH+++ AM   Y
Sbjct  1    MTTLFLTVVLATVLFCLLFLFSRRRNPRLPPGPNPWPIIGNLPHMGPKPHRTLTAMVTTY  60

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI+ VHLFSAKALDDF HVRQEEVATLTR LA  G   V LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALDDFKHVRQEEVATLTRELAQVGTKAVNLGQLVNMCVVNALGR  180

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
             M+GR++F   G+ +D KAEEF+SM
Sbjct  181  EMIGRRLF---GADADHKAEEFRSM  202



>gb|AFI71898.1| flavonoid 3'-hydroxylase [Paeonia lactiflora]
Length=507

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG KPHQS+A++A  YGPLMHLRLG VDVVVAASA+VAAQFLK +D+NF NRPPN
Sbjct  40   GNLPHLGPKPHQSLASLARSYGPLMHLRLGSVDVVVAASASVAAQFLKTNDANFVNRPPN  99

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA++IAYNYQDLVFAPYGPRWR+LRK++ +HLFS KALDDF H+RQEEVA L  +L SA
Sbjct  100  SGAKYIAYNYQDLVFAPYGPRWRLLRKVSSLHLFSGKALDDFRHLRQEEVAVLVHALTSA  159

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
              + V LGQLLNVCTTNAL RVMLG++VF DG    DPKA+EFK M
Sbjct  160  SNSLVNLGQLLNVCTTNALARVMLGKRVFGDGSGGVDPKADEFKDM  205



>gb|AIY51699.1| flavonoid 3'-hydroxylase [Penstemon barbatus]
Length=517

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 165/208 (79%), Gaps = 3/208 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplpl---ppgpkpwpvlGNLPHLGKKPHQSIAAMA  171
            +TL+ CT +    L + I +  QR        PPGP+PWP++GNLP LG KPHQ++AA+A
Sbjct  5    ITLLICTSILGFLLLYWIFQRPQRKAKSTLPLPPGPRPWPIIGNLPQLGPKPHQTMAALA  64

Query  172  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  351
              +GPLMHL++GFV VVVAASA++A QFLKV+D+NFS+RPPN+GA+++AYNYQDLVFAPY
Sbjct  65   RVHGPLMHLKMGFVHVVVAASASMAEQFLKVNDANFSSRPPNAGAKYVAYNYQDLVFAPY  124

Query  352  GPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  531
            GPRWR+LRKI  +HLFSAKALDDF HVRQEEV  LTR+LASAG+  +KLGQ+LN+C TNA
Sbjct  125  GPRWRLLRKICALHLFSAKALDDFRHVRQEEVGILTRTLASAGEMQMKLGQMLNICATNA  184

Query  532  LTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            L RV LGR+V   G    + KAE+FK+M
Sbjct  185  LARVALGRRVVGHGFGDGEVKAEDFKAM  212



>gb|EYU23554.1| hypothetical protein MIMGU_mgv1a004224mg [Erythranthe guttata]
Length=538

 Score =   239 bits (609),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG KPHQS+A +A+ +GPLMHL++G V VVVAASA VA QFLKVHD+NFS+RPPN
Sbjct  65   GNLPQLGPKPHQSMATLAQVHGPLMHLKMGVVHVVVAASAGVAEQFLKVHDANFSSRPPN  124

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+++AYNYQDLVFAPYGPRWRMLRKI  +HLFS KALDDF HVRQEEV  LTRSLASA
Sbjct  125  SGAKYMAYNYQDLVFAPYGPRWRMLRKICTLHLFSTKALDDFRHVRQEEVGILTRSLASA  184

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDG-GSKSDPKAEEFKSM  615
            GKT   +GQ+LNVCTTNA+ RV+LGR+V   G G  +D KAEEFKSM
Sbjct  185  GKTAASIGQMLNVCTTNAIARVVLGRRVIGYGCGGGADAKAEEFKSM  231



>gb|ABB53383.1| flavonoid-3'-hydroxylase [Antirrhinum majus]
Length=520

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 164/203 (81%), Gaps = 7/203 (3%)
 Frame = +1

Query  7    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  186
            L+ CT +    L +  L    R   PLPPGPKPWP++GNLPHLG KPHQS+AA+A  +GP
Sbjct  20   LVPCTFILGFLLLYSFL---NRKVKPLPPGPKPWPIVGNLPHLGPKPHQSMAALARVHGP  76

Query  187  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  366
            L+HL++GFV VVVA+SA+VA +FLKVHD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRWR
Sbjct  77   LIHLKMGFVHVVVASSASVAEKFLKVHDANFSSRPPNSGAKHVAYNYQDLVFAPYGPRWR  136

Query  367  MLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVM  546
            MLRKI  +HLFSAKAL+DF HVRQ+EV  LTR LA AG+TP+KLGQ++N C TNA+ RVM
Sbjct  137  MLRKICALHLFSAKALNDFTHVRQDEVGILTRVLADAGETPLKLGQMMNTCATNAIARVM  196

Query  547  LGRKVFNDGGSKSDPKAEEFKSM  615
            LGR+V       +D KAEEFK+M
Sbjct  197  LGRRVV----GHADSKAEEFKAM  215



>gb|KHN17812.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=513

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            +GA++IAYNYQDLVFAPYGPRWR+LRK+T VHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
                V LGQLLNVCTTNAL R M+GR+VFNDG    DP+A+EFK+M
Sbjct  162  DTKAVNLGQLLNVCTTNALARAMIGRRVFNDGNGGCDPRADEFKAM  207



>ref|NP_001237015.1| flavonoid 3'-hydroxylase [Glycine max]
 dbj|BAB83261.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47846.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47847.1| flavonoid 3'-hydroxylase [Glycine max]
 dbj|BAD97828.1| flavonoid 3'- hydroxylase [Glycine max]
 gb|ABW69385.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|ABW69386.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|ACN81827.1| flavonoid 3'-hydroxylase [Glycine max]
Length=513

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            +GA++IAYNYQDLVFAPYGPRWR+LRK+T VHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
                V LGQLLNVCTTNAL R M+GR+VFNDG    DP+A+EFK+M
Sbjct  162  DTKAVNLGQLLNVCTTNALARAMIGRRVFNDGNGGCDPRADEFKAM  207



>gb|AGO03825.1| flavonoid 3`5`-hydroxylase [Cichorium intybus]
Length=514

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG+ PH+S+AA+A +YGPL+HLRLGF+DVVVAASA+VAAQFLK HD+NF++RPPN
Sbjct  42   GNLPHLGQSPHRSLAALATKYGPLIHLRLGFIDVVVAASASVAAQFLKAHDANFASRPPN  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYNY D+VF PYGPRWRMLRK+  VHLFS KAL+DF H+RQEEVA LTR+L  A
Sbjct  102  SGAKHIAYNYNDMVFEPYGPRWRMLRKLCLVHLFSNKALNDFRHIRQEEVAILTRALGGA  161

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            G++ V+L +LLN+C +NAL+RVMLG++VF DG    DPKA+EFK M
Sbjct  162  GQSIVQLDKLLNLCISNALSRVMLGKRVFGDGSGGEDPKADEFKDM  207



>gb|ACR33790.1| flavonoid 3'-hydroxylase [Glycine max]
Length=513

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            +GA++IAYNYQDLVFAPYGPRWR+LRK+T VHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
                V LGQLLNVCTTNAL R M+GR+VFNDG    DP+A+EFK+M
Sbjct  162  DTKAVNLGQLLNVCTTNALARAMIGRRVFNDGNGGCDPRADEFKAM  207



>gb|AAG49315.1|AF315465_1 flavonoid 3'-hydroxylase [Pelargonium x hortorum]
Length=511

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPH+G  PHQ++AAMA  YGPL++LRLGFVDVVVA SA++A+QFLK HDSNFS+RPPN
Sbjct  44   GNLPHMGSMPHQNLAAMARTYGPLVYLRLGFVDVVVALSASMASQFLKTHDSNFSSRPPN  103

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            +GA+HIAYNY DLVFAPYGPRWR+ RKIT +HLFS KALDD+ HVRQEEV  L  +LA A
Sbjct  104  AGAKHIAYNYHDLVFAPYGPRWRLFRKITSIHLFSGKALDDYRHVRQEEVGVLASNLARA  163

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
              T V LGQLLN+C TNAL R ++G+KVF DG    DPKA+EFKSM
Sbjct  164  VSTIVNLGQLLNICATNALGRAVIGKKVFKDGTDDVDPKADEFKSM  209



>ref|XP_002871298.1| hypothetical protein ARALYDRAFT_487632 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47557.1| hypothetical protein ARALYDRAFT_487632 [Arabidopsis lyrata subsp. 
lyrata]
Length=514

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 165/205 (80%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LT++  T++F   L    LR  + + + LPPGP PWP++GNLPH+G KPH+++AAM   Y
Sbjct  6    LTILLATVIFLFLLRVFSLRRNRSHNIRLPPGPNPWPIIGNLPHMGPKPHRTLAAMVSTY  65

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  66   GPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  125

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WR+LRKI+ VHLFSAKAL+DF HVRQEEV TLTR LA  G  PV LGQL+N+C  NAL R
Sbjct  126  WRLLRKISSVHLFSAKALEDFKHVRQEEVGTLTRELARVGTKPVNLGQLVNMCVVNALGR  185

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
             M+GR++F   G+ +D KA+EF+SM
Sbjct  186  EMIGRRLF---GADADHKADEFRSM  207



>gb|AIB06740.1| flavanone 3'-hydroxylase [Mangifera indica]
Length=515

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 165/206 (80%), Gaps = 4/206 (2%)
 Frame = +1

Query  10   IFCTLVFAIFLYFL--ILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
            I  +L+F + +YFL  I     R  L LPPGPKP P++GNLPH+G  PH S+AA+A  YG
Sbjct  5    ILVSLLFGVLIYFLFNIRSFFNRKSLRLPPGPKPRPIIGNLPHMGPMPHHSLAALARTYG  64

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            P+MHLRLGFVDV+VAASA+VAAQFLKVHD+NFS+RPPNSGA++IAYNYQDLVF PYG +W
Sbjct  65   PIMHLRLGFVDVIVAASASVAAQFLKVHDANFSSRPPNSGAKYIAYNYQDLVFRPYGAKW  124

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAG--KTPVKLGQLLNVCTTNALT  537
            R+LRKIT VHLFS KALDD+  VRQ EVA LTR+LASAG     V L QLLNVCT NAL+
Sbjct  125  RLLRKITSVHLFSGKALDDYRLVRQGEVAVLTRALASAGLKSELVNLAQLLNVCTVNALS  184

Query  538  RVMLGRKVFNDGGSKSDPKAEEFKSM  615
            RVMLGR+VF DG    DPKA+EFKSM
Sbjct  185  RVMLGRRVFGDGTGGKDPKADEFKSM  210



>gb|EPS57881.1| flavonoid 3'-hydroxylase, partial [Genlisea aurea]
Length=425

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 155/195 (79%), Gaps = 0/195 (0%)
 Frame = +1

Query  31   AIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLGF  210
            A+FL+     +++R     PPGP PWP+LGN+P LG KPHQS+AA+A  YGPL+HL++GF
Sbjct  10   ALFLFLAYAFIRRRATKRFPPGPTPWPLLGNIPQLGVKPHQSMAALAGVYGPLLHLKMGF  69

Query  211  vdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITFV  390
              VVVAASA+VA QFLKVHD+NFS+RPPN+G +++AYNYQDLVFAPYGPRWR+LRKI  +
Sbjct  70   QHVVVAASASVAEQFLKVHDANFSSRPPNAGGKYVAYNYQDLVFAPYGPRWRLLRKICAL  129

Query  391  HLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVMLGRKVFND  570
            HLFSAKALDDF HVRQEEV  L R L SAGK PV LGQ+LNVC TNA+ RVMLGR+V   
Sbjct  130  HLFSAKALDDFVHVRQEEVGILGRVLVSAGKNPVALGQVLNVCATNAIARVMLGRRVVGH  189

Query  571  GGSKSDPKAEEFKSM  615
                 D KAEEFK++
Sbjct  190  STGGGDAKAEEFKAL  204



>ref|XP_004515962.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=507

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GN+PHLG  PH S+AA+A+ YGPLMHL+LGFVDV+VAASA+VA QFLKVHD+NFS+RPPN
Sbjct  42   GNIPHLGPVPHHSLAALAKTYGPLMHLKLGFVDVIVAASASVAEQFLKVHDANFSSRPPN  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            +GA+++AYNYQDLVFA YGPRWR+LRK++ +HLFS K+LD+F H+RQEEV+ LTR LA +
Sbjct  102  AGAKYMAYNYQDLVFASYGPRWRLLRKLSSIHLFSNKSLDEFKHMRQEEVSRLTRYLADS  161

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
                V LG LLNVCTTNAL+RVM+G++VFNDG    DPKA+EFKSM
Sbjct  162  DPKSVNLGPLLNVCTTNALSRVMIGKRVFNDGNGGCDPKADEFKSM  207



>gb|AGI16386.1| flavonoid 3' hydroxylase [Ribes nigrum]
Length=524

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG KPHQSIA +A  YGPLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RP N
Sbjct  51   GNLPHLGTKPHQSIAELARTYGPLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPQN  110

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA++IAYNYQDLVFAPYGPRWRMLRKI+ VHLFS KALDDF HVRQEEVA LTR++ + 
Sbjct  111  SGAKYIAYNYQDLVFAPYGPRWRMLRKISQVHLFSNKALDDFRHVRQEEVAVLTRAIVNE  170

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            G   V L +LLNVCTTNAL RVMLG++VF +G    + K++EFK M
Sbjct  171  GDASVDLPRLLNVCTTNALARVMLGKRVFGEGSGSGNAKSDEFKDM  216



>dbj|BAD91808.1| flavonoid 3'-hydroxylase [Gentiana triflora]
Length=524

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 163/206 (79%), Gaps = 3/206 (1%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRY--plplppgpkpwpvlGNLPHLGKKPHQSIAAMAER  177
            T +F   V  IF++  ++  K+ +   LPLPPGP+PWP+LGN+PHLG KPHQ++A MA+ 
Sbjct  12   TAVFGLFVVFIFIFLKLVSRKKGHGRSLPLPPGPRPWPILGNIPHLGSKPHQTLAEMAKT  71

Query  178  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  357
            YGPLMHL+ G  D VVA+SA+VA QFLK HD NFSNRPPNSGA+HIAYNYQDLVFAPYGP
Sbjct  72   YGPLMHLKFGLKDAVVASSASVAEQFLKKHDVNFSNRPPNSGAKHIAYNYQDLVFAPYGP  131

Query  358  RWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALT  537
            RWR+LRKI  VHLFS+KALDDF HVR EE+  L R++AS G  PV LG+LL VCTTNAL 
Sbjct  132  RWRLLRKICSVHLFSSKALDDFQHVRHEEICILIRAIASGGHAPVNLGKLLGVCTTNALA  191

Query  538  RVMLGRKVFNDGGSKSDPKAEEFKSM  615
            RVMLGR+VF +G    +P A+EFKSM
Sbjct  192  RVMLGRRVF-EGDGGENPHADEFKSM  216



>emb|CDX99037.1| BnaC09g47980D [Brassica napus]
Length=717

 Score =   240 bits (613),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 165/205 (80%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI+ VHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGR  180

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
             M+GR++F   G+ +D KAEEF+SM
Sbjct  181  EMIGRRLF---GADADHKAEEFRSM  202


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = +1

Query  436  QEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            QEEV TL R LA A   PV LGQL+N+C  NAL R M+GR++F   G+ +D KAEEF+SM
Sbjct  352  QEEVGTLMRELARANTKPVNLGQLVNMCVLNALGREMIGRRLF---GADADHKAEEFRSM  408



>gb|AIY51698.1| flavonoid 3'-hydroxylase [Penstemon neomexicanus]
Length=517

 Score =   236 bits (601),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 167/208 (80%), Gaps = 3/208 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQR---YplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  171
            +TL+ CT +    L + I +  QR     LPLPPGP+PWP++GNLP LG KPHQ++AA+A
Sbjct  5    ITLLICTSILGFLLLYWIFQRPQRKAKLTLPLPPGPRPWPIIGNLPQLGPKPHQTMAALA  64

Query  172  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  351
              +GPLMHL++GFV VVVAASA++A QFLKV+D+NFS+RPPN+GA+++AYNYQDLVFAPY
Sbjct  65   RVHGPLMHLKMGFVHVVVAASASMAEQFLKVNDANFSSRPPNAGAKYVAYNYQDLVFAPY  124

Query  352  GPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  531
            GPRWR+LRKI  +HLFSAKALDDF HVRQEEV  LTR+LASAG+  + LGQ+LN+C TNA
Sbjct  125  GPRWRLLRKICALHLFSAKALDDFRHVRQEEVGILTRTLASAGEMQMILGQMLNICATNA  184

Query  532  LTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            L RV LGR+V   G    + KAE+FK+M
Sbjct  185  LARVALGRRVVGHGFGDGEVKAEDFKAM  212



>ref|XP_010452770.1| PREDICTED: flavonoid 3'-monooxygenase [Camelina sativa]
Length=509

 Score =   236 bits (601),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 162/202 (80%), Gaps = 3/202 (1%)
 Frame = +1

Query  10   IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  189
            +F T+V A  L+ L+    +R    LPPGP PWP++GNLPH+G KPH+++ AM   YGP+
Sbjct  4    LFLTVVLATVLFCLLFLFSRRRNPRLPPGPNPWPIIGNLPHMGPKPHRALTAMVTTYGPI  63

Query  190  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  369
            +HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG RWRM
Sbjct  64   LHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQRWRM  123

Query  370  LRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVML  549
            LRKI+ VHLFSAKAL+DF HVRQEEVATLTR LA  G   V LGQL+N+C  NAL R M+
Sbjct  124  LRKISSVHLFSAKALEDFKHVRQEEVATLTRELAQVGTKAVNLGQLVNMCVVNALGREMI  183

Query  550  GRKVFNDGGSKSDPKAEEFKSM  615
            GR++F   G+ +D KAEEF+SM
Sbjct  184  GRRLF---GADADHKAEEFRSM  202



>gb|AEE60888.1| flavonoid 3'-hydroxylase [Fragaria chiloensis]
Length=512

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 163/200 (82%), Gaps = 1/200 (1%)
 Frame = +1

Query  19   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  195
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A ++GPLMH
Sbjct  8    TLLVALVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGVFPHHSLADLARKHGPLMH  67

Query  196  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  375
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PYGPRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYGPRWRQFR  127

Query  376  KITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVMLGR  555
            KI+ VHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+GR
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKAVNLAQLLNLCTANALGRVMVGR  187

Query  556  KVFNDGGSKSDPKAEEFKSM  615
            +VF DG    DPKA+EFKSM
Sbjct  188  RVFGDGSGSDDPKADEFKSM  207



>dbj|BAL63027.1| flavonoid 3'-hydroxylase [Fragaria x ananassa]
Length=510

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 160/205 (78%), Gaps = 0/205 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L  +   LV  +   FL     QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A ++
Sbjct  3    LIAVITLLVALVLFRFLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGVFPHHSLADLARKH  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PYGPR
Sbjct  63   GPLMHLRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WR  RKI+ VHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL R
Sbjct  123  WRQFRKISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKAVNLAQLLNLCTVNALGR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VM+GR+VF DG    DPKA+EFKSM
Sbjct  183  VMVGRRVFGDGSGSDDPKADEFKSM  207



>gb|ADE80941.1| flavonoid 3'-hydroxylase [Epimedium sagittatum]
Length=514

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 158/205 (77%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L L+  TL+ +  LY LI  +    P  LPPGPKPWP++GNL HLG+ PH S+AA+A++Y
Sbjct  4    LELVLATLIISTILYTLINSLLNPAPRGLPPGPKPWPIIGNLLHLGRVPHHSLAALAKKY  63

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLG V V+VAAS++VA Q  K HD NFS+RPPNSGA+HIAYNYQDLVFAPYGP+
Sbjct  64   GPLMHLRLGSVHVIVAASSSVATQIFKTHDVNFSSRPPNSGAKHIAYNYQDLVFAPYGPK  123

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI  VHLFSAKALDDF H+RQEEV  L  +L  AGK P  L +LLNVCTTN L R
Sbjct  124  WRMLRKICSVHLFSAKALDDFRHIRQEEVLVLINALFQAGKAPTDLAKLLNVCTTNVLGR  183

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+VF DG    D K+EEFK M
Sbjct  184  VMLGRRVFGDG--SGDEKSEEFKQM  206



>gb|AEE60886.1| flavonoid 3'-hydroxylase, partial [Fragaria x ananassa]
Length=511

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 163/200 (82%), Gaps = 1/200 (1%)
 Frame = +1

Query  19   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  195
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  196  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  375
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  376  KITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVMLGR  555
            KI+ VHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+GR
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRVMVGR  187

Query  556  KVFNDGGSKSDPKAEEFKSM  615
            +VF DG    DPKA+EFKSM
Sbjct  188  RVFGDGSGSDDPKADEFKSM  207



>ref|NP_001274347.1| uncharacterized protein LOC101314754 [Fragaria vesca]
 gb|AEE60884.1| flavonoid 3'-hydroxylase [Fragaria vesca]
 gb|AGT28740.1| flavonoid 3'-hydroxylase [Fragaria vesca]
Length=512

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 163/200 (82%), Gaps = 1/200 (1%)
 Frame = +1

Query  19   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  195
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  196  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  375
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  376  KITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVMLGR  555
            KI+ VHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+GR
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRVMVGR  187

Query  556  KVFNDGGSKSDPKAEEFKSM  615
            +VF DG    DPKA+EFKSM
Sbjct  188  RVFGDGSGSDDPKADEFKSM  207



>gb|AEE60887.1| flavonoid 3'-hydroxylase [Fragaria virginiana]
Length=512

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 163/200 (82%), Gaps = 1/200 (1%)
 Frame = +1

Query  19   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  195
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  196  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  375
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  376  KITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVMLGR  555
            KI+ VHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+GR
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRVMVGR  187

Query  556  KVFNDGGSKSDPKAEEFKSM  615
            +VF DG    DPKA+EFKSM
Sbjct  188  RVFGDGSGSDDPKADEFKSM  207



>gb|AIT52346.1| flavonoid 3'-monooxygenase 1 [Daucus carota]
Length=524

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 157/212 (74%), Gaps = 9/212 (4%)
 Frame = +1

Query  7    LIFCTLVFAIFLYFLIL-------RVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  165
            LI  TLV A+ +Y L+        R       P P GPKPWP++GNLPHLG  PH S+A 
Sbjct  8    LILYTLVLALLIYCLLNLRTLFFNRRSSHPLPPGPKGPKPWPIIGNLPHLGAIPHHSLAE  67

Query  166  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  345
            MA+ YGPL+HLRLG V VVVA+SA VAAQFLK HD+ FSNRPPNSGA+HIAYNYQDLVFA
Sbjct  68   MAQTYGPLLHLRLGLVHVVVASSAGVAAQFLKTHDAKFSNRPPNSGAKHIAYNYQDLVFA  127

Query  346  PYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  525
            PYGP+WR LRKI  VHLFSAKALDDF HVRQEEV  L   LA AGK  V LGQLLN+C T
Sbjct  128  PYGPKWRKLRKICSVHLFSAKALDDFRHVRQEEVGVLVSGLAGAGKRAVHLGQLLNICAT  187

Query  526  NALTRVMLGRKVFNDGGS--KSDPKAEEFKSM  615
            NAL RVMLG++VF+ G S    D KA+EFK M
Sbjct  188  NALGRVMLGKRVFSYGTSAGTGDAKADEFKDM  219



>gb|AEE60883.1| flavonoid 3'-hydroxylase [Fragaria vesca]
Length=512

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 163/200 (82%), Gaps = 1/200 (1%)
 Frame = +1

Query  19   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  195
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKPQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  196  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  375
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  376  KITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVMLGR  555
            KI+ VHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+GR
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRVMVGR  187

Query  556  KVFNDGGSKSDPKAEEFKSM  615
            +VF DG    DPKA+EFKSM
Sbjct  188  RVFGDGSGSDDPKADEFKSM  207



>gb|ACN65826.1| flavonoid 3'-hydroxylase [Echinops bannaticus]
Length=508

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG+ PH S+A +A +YGPL+HLRLGFVDVVVA SA+VAAQFLKVHD+NF++RPPN
Sbjct  44   GNLPHLGRVPHHSLADLATKYGPLLHLRLGFVDVVVAGSASVAAQFLKVHDANFASRPPN  103

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+H+AYNYQD+VFAPYGP+WRMLRKI  VHLFS KALDDF HVRQEEVA L R+L  A
Sbjct  104  SGAKHMAYNYQDMVFAPYGPKWRMLRKICSVHLFSTKALDDFRHVRQEEVAILARALVGA  163

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            G++ VKLGQLLNVCTTNAL RVMLGR+VF DG    D K++EFK M
Sbjct  164  GESTVKLGQLLNVCTTNALARVMLGRRVFGDGSGGGDSKSDEFKDM  209



>gb|AAG49301.1|AF313491_1 flavonoid 3'-hydroxylase [Matthiola incana]
Length=513

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 140/166 (84%), Gaps = 3/166 (2%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPH+G KPHQ++AAM   YGP++HLRLGFV+VVVAAS +VA QFLK+HD+NF++RPPN
Sbjct  43   GNLPHMGPKPHQTLAAMVTTYGPILHLRLGFVNVVVAASKSVAEQFLKIHDANFASRPPN  102

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYNYQDLVFAPYG RWRMLRKI+ VHLFSAKAL+DF HVRQEE+  LTR +A A
Sbjct  103  SGAKHIAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDFKHVRQEEIGRLTREVARA  162

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
               PV LGQL+N+C  NAL R M+GR++F DG   +D KAEEF+SM
Sbjct  163  DTKPVNLGQLVNMCVVNALGREMIGRRLFGDG---ADHKAEEFRSM  205



>gb|AGT28741.1| flavonoid 3'-hydroxylase [Fragaria x ananassa]
Length=513

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 162/200 (81%), Gaps = 1/200 (1%)
 Frame = +1

Query  19   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  195
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A ++GPLMH
Sbjct  8    TLLVALVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGVFPHHSLADLARKHGPLMH  67

Query  196  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  375
            LR G+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PYGPRWR  R
Sbjct  68   LRFGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYGPRWRQFR  127

Query  376  KITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVMLGR  555
            KI+ VHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+GR
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKAVNLAQLLNLCTVNALGRVMVGR  187

Query  556  KVFNDGGSKSDPKAEEFKSM  615
            +VF DG    DPKA+EFKSM
Sbjct  188  RVFGDGSGSDDPKADEFKSM  207



>gb|AEE60885.1| flavonoid 3'-hydroxylase, partial [Fragaria x ananassa]
Length=511

 Score =   233 bits (593),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 163/200 (82%), Gaps = 1/200 (1%)
 Frame = +1

Query  19   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  195
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  196  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  375
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  376  KITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVMLGR  555
            KI+ VHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+G+
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRVMVGQ  187

Query  556  KVFNDGGSKSDPKAEEFKSM  615
            +VF DG    DPKA+EFKSM
Sbjct  188  RVFGDGSGSDDPKADEFKSM  207



>gb|ACJ85671.1| unknown [Medicago truncatula]
Length=418

 Score =   230 bits (586),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 163/205 (80%), Gaps = 2/205 (1%)
 Frame = +1

Query  7    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  186
            + F + + +I +Y L+    +   LPLPPGPKPWP++GNLPHLG  PHQS+A +AE YGP
Sbjct  6    IAFSSCILSILIYRLVKFATRTSSLPLPPGPKPWPIIGNLPHLGPAPHQSLATLAETYGP  65

Query  187  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  366
            LMHL+LG VDV+VAASA+VA QFLKVHD+NFS+RPPN+GA++I YNYQDLVF PYGPRWR
Sbjct  66   LMHLKLGSVDVIVAASASVAEQFLKVHDANFSSRPPNAGAKYIGYNYQDLVFGPYGPRWR  125

Query  367  MLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLAS--AGKTPVKLGQLLNVCTTNALTR  540
            +LRKIT VHLFS ++LD+F H+RQEEV  L  +LAS  +    V LGQLLNVCTTNAL R
Sbjct  126  LLRKITTVHLFSNQSLDEFKHLRQEEVTRLVNNLASNHSNSKVVNLGQLLNVCTTNALAR  185

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
             ++GR+VFN+G    DPKA +FK+M
Sbjct  186  AVIGRRVFNEGNGDFDPKAGDFKAM  210



>gb|ABB43031.1| flavonoid 3'5'-hydroxylase [Osteospermum hybrid cultivar]
Length=508

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 165/205 (80%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            +TL+  T +  + +++++L ++ R+P  LPPGP PWP++GNLPHLG  PH ++AA A++Y
Sbjct  5    MTLLMDTCI-TVLVFYVLLNLRTRHPNRLPPGPTPWPIVGNLPHLGPLPHHTLAAFAKKY  63

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPL+HLR GFVDVVVA+S  VA+QFL+ +D NF++RPPNSGA+H+AYNYQDLVFAPYGPR
Sbjct  64   GPLIHLRFGFVDVVVASSPTVASQFLRDNDLNFASRPPNSGAKHMAYNYQDLVFAPYGPR  123

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            W MLRKI   HLFS+KALD+F HVR+EEVA LTR LASAG++ VKL QLLNVCT N L R
Sbjct  124  WTMLRKICKDHLFSSKALDNFRHVREEEVAILTRILASAGESTVKLSQLLNVCTANTLAR  183

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            +ML  ++F DG    DPKA+EFK M
Sbjct  184  MMLDMRLFGDGNGSGDPKADEFKDM  208



>gb|AJD25177.1| cytochrome P450 CYP75B79 [Salvia miltiorrhiza]
Length=511

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 168/205 (82%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTL+ C+ V    L + IL   +R P  LPPGP+PWP++GNLP LG KPHQS+AA+A+ Y
Sbjct  6    LTLLVCSAVLGFLLLYSIL--VRRRPEKLPPGPRPWPIVGNLPQLGPKPHQSMAALAQVY  63

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHL++GFV VVVAASAAVA QFLK HD+NFS+RPPN+GA+++AYNYQDLVFAPYGPR
Sbjct  64   GPLMHLKMGFVHVVVAASAAVAQQFLKAHDANFSSRPPNAGAKYVAYNYQDLVFAPYGPR  123

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WR+LRKI  +HLFSAKALDDF HVRQEE   L  +LASAG+ PV+LGQ+LNVC TNA++R
Sbjct  124  WRLLRKICALHLFSAKALDDFRHVRQEEAGILCGALASAGQMPVRLGQMLNVCATNAISR  183

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLGR+V   GG   D KAEEFK+M
Sbjct  184  VMLGRRVVGHGGGGGDEKAEEFKAM  208



>gb|AGO03824.1| flavonoid 3`5`-hydroxylase [Echinops bannaticus]
Length=510

 Score =   230 bits (586),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFL-ILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAER  177
            LTL+  T +  +  Y L +L ++  +P  LPPGP PWP++GNLPH+G  PHQS+AA+A +
Sbjct  4    LTLLLYTCITGLVFYVLQLLNLRTPHPNRLPPGPTPWPIVGNLPHIGTAPHQSLAALATK  63

Query  178  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  357
            YGPLMHLRLGFVDVVVA SA+VAAQ  K HD NFSNRP  SG +HIAYNYQDLVFAPYGP
Sbjct  64   YGPLMHLRLGFVDVVVAGSASVAAQIFKAHDVNFSNRPRVSGGKHIAYNYQDLVFAPYGP  123

Query  358  RWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALT  537
            +WRMLRKI  VHLFS KALDDF HVRQEE A L  +LA AG++ VKLG+L+NVC TNAL 
Sbjct  124  KWRMLRKICSVHLFSTKALDDFRHVRQEEAAILAGTLAGAGESTVKLGELVNVCITNALA  183

Query  538  RVMLGRKVFNDGGSKSDPKAEEFKSM  615
            RV+LGR+VF D     D KA+EF+ M
Sbjct  184  RVVLGRRVFVDVSGDGDLKAKEFQDM  209



>gb|AGY55961.1| flavonoid 3'-hydroxylase, partial [Punica granatum]
Length=332

 Score =   225 bits (573),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 114/122 (93%), Gaps = 3/122 (2%)
 Frame = +1

Query  250  QFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCH  429
            QFLK+HD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPRWRMLRKI+ VHLFSAKALDDF H
Sbjct  14   QFLKIHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPRWRMLRKISSVHLFSAKALDDFRH  73

Query  430  VRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFK  609
            VRQEEVA LTR+LASAGKTPVKLGQLLNVCTTNAL RVMLGR+VF DGG   DPKA+EFK
Sbjct  74   VRQEEVAILTRALASAGKTPVKLGQLLNVCTTNALARVMLGRRVFGDGG---DPKADEFK  130

Query  610  SM  615
            SM
Sbjct  131  SM  132



>dbj|BAB59005.1| flavonoid 3'-hydroxylase [Perilla frutescens var. crispa]
Length=523

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 161/210 (77%), Gaps = 5/210 (2%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAER  177
            ++LI CT +  + +YFL LR        PLPPGP+PWP++GNLP LG KPHQS+AA+A  
Sbjct  6    VSLIICTSILGVLVYFLFLRRGGGSNGRPLPPGPRPWPIVGNLPQLGPKPHQSMAALARV  65

Query  178  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  357
            +GPLMHL++GFV VVVAASA VA +FLKVHD+NF +RPPNSGAEHIAYNY DLVFAP+GP
Sbjct  66   HGPLMHLKMGFVHVVVAASATVAEKFLKVHDTNFLSRPPNSGAEHIAYNYNDLVFAPHGP  125

Query  358  RWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALT  537
            RWR+LRKI  +HLFS+KALDDF HVR+EEV  L R+LAS G+ P  +GQ++ VC TNA++
Sbjct  126  RWRLLRKICALHLFSSKALDDFRHVREEEVGILIRNLASVGEMPASIGQMMYVCATNAIS  185

Query  538  RVMLGRKVFND----GGSKSDPKAEEFKSM  615
            RVMLGR V  D         D  AEEFK+M
Sbjct  186  RVMLGRHVLGDEHRGAAGGGDTTAEEFKAM  215



>ref|NP_196416.1| Flavonoid 3'-monooxygenase [Arabidopsis thaliana]
 sp|Q9SD85.1|F3PH_ARATH RecName: Full=Flavonoid 3'-monooxygenase; AltName: Full=Cytochrome 
P450 75B1; AltName: Full=Flavonoid 3'-hydroxylase; Short=AtF3'H; 
AltName: Full=Protein TRANSPARENT TESTA 7 [Arabidopsis 
thaliana]
 gb|AAF73253.1|AF155171_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 gb|AAG16745.1|AF271650_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 gb|AAG16746.1|AF271651_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 emb|CAB62611.1| flavonoid 3'-hydroxylase-like protein [Arabidopsis thaliana]
 gb|AAF60189.1| flavonoid 3'hydroxylase [Arabidopsis thaliana]
 gb|AED91232.1| Flavonoid 3'-monooxygenase [Arabidopsis thaliana]
Length=513

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 166/210 (79%), Gaps = 9/210 (4%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRV-----KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  165
            +  +F T++ A  L FLILR+      + +   LPPGP PWP++GNLPH+G KPH++++A
Sbjct  1    MATLFLTILLATVL-FLILRIFSHRRNRSHNNRLPPGPNPWPIIGNLPHMGTKPHRTLSA  59

Query  166  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  345
            M   YGP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFA
Sbjct  60   MVTTYGPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFA  119

Query  346  PYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  525
            PYG RWR+LRKI+ VHLFSAKAL+DF HVRQEEV TLTR L   G  PV LGQL+N+C  
Sbjct  120  PYGHRWRLLRKISSVHLFSAKALEDFKHVRQEEVGTLTRELVRVGTKPVNLGQLVNMCVV  179

Query  526  NALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            NAL R M+GR++F   G+ +D KA+EF+SM
Sbjct  180  NALGREMIGRRLF---GADADHKADEFRSM  206



>ref|XP_010030575.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW83703.1| hypothetical protein EUGRSUZ_B00578 [Eucalyptus grandis]
Length=514

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 159/204 (78%), Gaps = 1/204 (0%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
            +LI  T+  ++ LY L L    R   PLPPGPKPWP++GNLPHLG  PHQS+AA+A  YG
Sbjct  5    SLILATIAISVILYSL-LSYLARPARPLPPGPKPWPLVGNLPHLGPMPHQSMAALARAYG  63

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PL+HLRLG VDVVVA+SA+VA+QFLK H++NF +RPP+S A+H++YNYQDLV  PYGPRW
Sbjct  64   PLLHLRLGLVDVVVASSASVASQFLKTHEANFLSRPPHSAAKHLSYNYQDLVSLPYGPRW  123

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            RMLRKI+ +HLFS KALDD+ HVR EEV  LT +LA    TP KL QLLNVCT N L RV
Sbjct  124  RMLRKISSIHLFSGKALDDYRHVRHEEVVVLTHALAHVSSTPKKLAQLLNVCTANVLGRV  183

Query  544  MLGRKVFNDGGSKSDPKAEEFKSM  615
            MLG++VF DG    DP+A+EFKSM
Sbjct  184  MLGKRVFGDGNGGGDPRADEFKSM  207



>gb|AES69199.2| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 163/205 (80%), Gaps = 2/205 (1%)
 Frame = +1

Query  7    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  186
            + F + + +I +Y L+    +   LPLPPGPKPWP++GNLPHLG  PHQS+A +AE YGP
Sbjct  6    IAFSSCILSILIYRLVKFATRTSSLPLPPGPKPWPIIGNLPHLGPAPHQSLATLAETYGP  65

Query  187  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  366
            LMHL+LG VDV+VAASA+VA QFLKVHD+NFS+RPPN+GA++I YNYQDLVF PYGPRWR
Sbjct  66   LMHLKLGSVDVIVAASASVAEQFLKVHDANFSSRPPNAGAKYIGYNYQDLVFGPYGPRWR  125

Query  367  MLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLAS--AGKTPVKLGQLLNVCTTNALTR  540
            +LRKIT VHLFS ++LD+F H+RQEEV  L  +LAS  +    V LGQLLNVCTTNAL R
Sbjct  126  LLRKITTVHLFSNQSLDEFKHLRQEEVTRLVNNLASNHSNSKVVNLGQLLNVCTTNALAR  185

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
             ++GR+VFN+G    DPKA +FK+M
Sbjct  186  AVIGRRVFNEGNGDFDPKAGDFKAM  210



>ref|XP_003598948.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
Length=597

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 163/205 (80%), Gaps = 2/205 (1%)
 Frame = +1

Query  7    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  186
            + F + + +I +Y L+    +   LPLPPGPKPWP++GNLPHLG  PHQS+A +AE YGP
Sbjct  6    IAFSSCILSILIYRLVKFATRTSSLPLPPGPKPWPIIGNLPHLGPAPHQSLATLAETYGP  65

Query  187  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  366
            LMHL+LG VDV+VAASA+VA QFLKVHD+NFS+RPPN+GA++I YNYQDLVF PYGPRWR
Sbjct  66   LMHLKLGSVDVIVAASASVAEQFLKVHDANFSSRPPNAGAKYIGYNYQDLVFGPYGPRWR  125

Query  367  MLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLAS--AGKTPVKLGQLLNVCTTNALTR  540
            +LRKIT VHLFS ++LD+F H+RQEEV  L  +LAS  +    V LGQLLNVCTTNAL R
Sbjct  126  LLRKITTVHLFSNQSLDEFKHLRQEEVTRLVNNLASNHSNSKVVNLGQLLNVCTTNALAR  185

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
             ++GR+VFN+G    DPKA +FK+M
Sbjct  186  AVIGRRVFNEGNGDFDPKAGDFKAM  210



>ref|XP_006287545.1| hypothetical protein CARUB_v10000754mg [Capsella rubella]
 gb|EOA20443.1| hypothetical protein CARUB_v10000754mg [Capsella rubella]
Length=509

 Score =   225 bits (574),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 160/205 (78%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            +T +F T+V A  L+ L+     R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTPLFLTIVLATVLFCLLFLFSLRRNHRLPPGPNPWPIVGNLPHMGTKPHQTLAAMVTTY  60

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GP++HLRLGFVDVVVAAS +VA QFLK HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFVDVVVAASKSVAEQFLKTHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI+ VHLFSAKAL+DF H+RQEEV TL+  LA  G   V LGQL+N+C  N+L R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHIRQEEVGTLSGELARVGTKAVNLGQLVNMCVINSLGR  180

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
             M+GR++F   G  +D KAEEF+SM
Sbjct  181  EMIGRRLF---GPDADHKAEEFRSM  202



>gb|AAG49299.1|AF313489_1 flavonoid 3',5'-hydroxylase [Callistephus chinensis]
Length=510

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG  PH ++AA+A +YGPL++LRLGFV VVVA+S +VAAQFLKVHD  F++RPPN
Sbjct  43   GNLPHLGAIPHHTLAALATKYGPLVYLRLGFVHVVVASSPSVAAQFLKVHDLKFASRPPN  102

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYNYQD+VFAPYGP+W M RKI   HLFS+KALDDF HVRQEEVA L R LA A
Sbjct  103  SGAKHIAYNYQDMVFAPYGPQWTMFRKICKDHLFSSKALDDFRHVRQEEVAILARGLAGA  162

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            G++ V LGQ LN+CT N L R+ML ++VF +     DPKA EFK M
Sbjct  163  GRSKVNLGQQLNMCTANTLARMMLDKRVFGNESGGDDPKANEFKEM  208



>emb|CDP16533.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 133/151 (88%), Gaps = 5/151 (3%)
 Frame = +1

Query  166  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  345
            MA+ YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFA
Sbjct  1    MAKTYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHMAYNYQDLVFA  60

Query  346  PYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRS-LASAGKTPVKLGQLLNVCT  522
            PYGPRWR+LRKI  VHLFSAKALDDF  VR+EEVA LTR+ LAS GK  V LGQLLNVCT
Sbjct  61   PYGPRWRLLRKICSVHLFSAKALDDFHLVREEEVAILTRTLLASVGKDSVNLGQLLNVCT  120

Query  523  TNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            TNAL RVMLGR+VF+DG    DPKA+EFKSM
Sbjct  121  TNALGRVMLGRRVFSDG----DPKADEFKSM  147



>ref|XP_010522799.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X6 [Tarenaya 
hassleriana]
Length=391

 Score =   217 bits (552),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 131/161 (81%), Gaps = 3/161 (2%)
 Frame = +1

Query  133  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  312
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  313  IAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  492
            IAYNYQDLVFAPYG RWRMLRKI+ VHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  493  KLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             L QL+NVC  NAL RVM+GR++F   G  +DP+AEEFKSM
Sbjct  121  NLSQLVNVCVVNALGRVMIGRRLF---GVGADPRAEEFKSM  158



>gb|AGT50310.1| flavonoid 3'-hydroxylase, partial [Meconopsis simplicifolia]
Length=468

 Score =   219 bits (557),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 135/170 (79%), Gaps = 4/170 (2%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  3    GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  62

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYNYQDLVFAPYG RWRM RKI  VHL S KALD+F HVR+EEVA LT++LA +
Sbjct  63   SGAKHIAYNYQDLVFAPYGRRWRMFRKICAVHLLSGKALDEFRHVREEEVAVLTKALAQS  122

Query  478  GK----TPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             K    +PV L  LLNVCTTNAL RV+LG +V  DG   +D K++EFK M
Sbjct  123  NKNSKGSPVNLADLLNVCTTNALARVLLGTRVCGDGEGLADKKSQEFKEM  172



>ref|XP_010105825.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|AHB19304.1| flavonoid 3'-hydroxylase, partial [Morus alba]
 gb|EXC06424.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=517

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG  PHQ+IAA+A ++GPLMHLR G VDVV AASA+VAAQFLK HD+NF +RPP+
Sbjct  46   GNLPQLGPAPHQTIAALARKHGPLMHLRFGLVDVVAAASASVAAQFLKAHDTNFLSRPPS  105

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            S A+H+ YNY DLV APYGPRWR++RKI  VHL S KAL+DF +VRQEE A L R LA+A
Sbjct  106  SAAKHVGYNYHDLVLAPYGPRWRLMRKIASVHLLSGKALEDFRYVRQEEAAVLIRGLANA  165

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            G T + L QLL++CTTN L R MLG +VF DG  KSDP+A+EFKSM
Sbjct  166  GPTAINLAQLLHLCTTNTLGRAMLGYRVFGDGSGKSDPRADEFKSM  211



>gb|AGT50309.1| flavonoid 3'-hydroxylase, partial [Meconopsis delavayi]
Length=476

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 136/170 (80%), Gaps = 4/170 (2%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  3    GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  62

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYNYQDLVFAPYG RWRM RKI  VHLFS KALD+F +VR+EEVA LT++LA +
Sbjct  63   SGAKHIAYNYQDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQS  122

Query  478  GK----TPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             K    +PV L  LLNVCTTNAL RV+LG +V  DG   +D K++EFK M
Sbjct  123  NKNSKGSPVNLADLLNVCTTNALARVLLGTRVCGDGEGLADKKSQEFKEM  172



>ref|XP_010522791.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X5 [Tarenaya 
hassleriana]
Length=469

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 131/161 (81%), Gaps = 3/161 (2%)
 Frame = +1

Query  133  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  312
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  313  IAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  492
            IAYNYQDLVFAPYG RWRMLRKI+ VHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  493  KLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             L QL+NVC  NAL RVM+GR++F   G  +DP+AEEFKSM
Sbjct  121  NLSQLVNVCVVNALGRVMIGRRLF---GVGADPRAEEFKSM  158



>ref|XP_003525447.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=513

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 160/202 (79%), Gaps = 1/202 (0%)
 Frame = +1

Query  13   FCTLVFAIFLYFLILRV-KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  189
            F T++ A+ +Y ++  + +    LPLPPGP+PWP++GNLPH+G  PHQ +A +A+ +GPL
Sbjct  8    FATIIAAVLIYRVLKPISRPSSSLPLPPGPRPWPIVGNLPHMGPAPHQGLANLAQTHGPL  67

Query  190  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  369
            MHLRLGFVDVVVAASA+VA QFLK+HD+NF +RP N    ++AYN QDLVFAPYGP+WR 
Sbjct  68   MHLRLGFVDVVVAASASVAEQFLKIHDANFCSRPLNFRTTYLAYNKQDLVFAPYGPKWRF  127

Query  370  LRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVML  549
            LRK+T VH+FSAKA+DDF  +RQEEVA LT  LA +    V L QLLNVCTTNALTR+M+
Sbjct  128  LRKLTTVHMFSAKAMDDFSQLRQEEVARLTCKLARSSSKAVNLRQLLNVCTTNALTRIMI  187

Query  550  GRKVFNDGGSKSDPKAEEFKSM  615
            GR++FND  S  DPKA+EFKSM
Sbjct  188  GRRIFNDDSSGCDPKADEFKSM  209



>gb|AGT50311.1| flavonoid 3'-hydroxylase, partial [Meconopsis horridula]
Length=484

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 136/170 (80%), Gaps = 4/170 (2%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  11   GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  70

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYNYQDLVFAPYG RWRM RKI  VHLFS KALD+F +VR+EEVA LT++LA +
Sbjct  71   SGAKHIAYNYQDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQS  130

Query  478  GK----TPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             K    +PV L  LLNVCTTNAL RV+LG +V  DG   +D K++EFK M
Sbjct  131  NKNSKGSPVNLADLLNVCTTNALARVLLGTRVCGDGEGLADKKSQEFKEM  180



>ref|XP_010522775.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X4 [Tarenaya 
hassleriana]
 ref|XP_010522783.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X4 [Tarenaya 
hassleriana]
Length=488

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 131/161 (81%), Gaps = 3/161 (2%)
 Frame = +1

Query  133  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  312
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  313  IAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  492
            IAYNYQDLVFAPYG RWRMLRKI+ VHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  493  KLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             L QL+NVC  NAL RVM+GR++F   G  +DP+AEEFKSM
Sbjct  121  NLSQLVNVCVVNALGRVMIGRRLF---GVGADPRAEEFKSM  158



>ref|XP_010522758.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010522767.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X3 [Tarenaya 
hassleriana]
Length=489

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 131/161 (81%), Gaps = 3/161 (2%)
 Frame = +1

Query  133  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  312
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  313  IAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  492
            IAYNYQDLVFAPYG RWRMLRKI+ VHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  493  KLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             L QL+NVC  NAL RVM+GR++F   G  +DP+AEEFKSM
Sbjct  121  NLSQLVNVCVVNALGRVMIGRRLF---GVGADPRAEEFKSM  158



>gb|ABB43030.1| flavonoid 3'5'-hydroxylase [Pericallis cruenta]
Length=504

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 159/205 (78%), Gaps = 6/205 (3%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLI CT +  +  Y L+  +  R    LPPGP PWP++GNL HLGK PH S+A +A++Y
Sbjct  4    LTLI-CTFITGLMFYGLV-NLLSRRASRLPPGPTPWPIIGNLMHLGKLPHHSLADLAKKY  61

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPL+H+RLG VDVVVA+SA+VA QFLKVHD+NF+NRPPNSGA+H+AYNY D+VFAPYGPR
Sbjct  62   GPLIHVRLGSVDVVVASSASVAGQFLKVHDANFANRPPNSGAKHMAYNYHDMVFAPYGPR  121

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRK+  +HLFSAKAL DF  VRQEEV  LTR LA  G++ VKL Q LNVC  N L+R
Sbjct  122  WRMLRKMCSMHLFSAKALTDFRQVRQEEVTILTRVLARTGQSAVKLDQQLNVCFANTLSR  181

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            +ML R+VF DG    DPKA+++K M
Sbjct  182  MMLDRRVFGDG----DPKADDYKDM  202



>gb|AJD25178.1| cytochrome P450 CYP75B80 [Salvia miltiorrhiza]
Length=514

 Score =   217 bits (553),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 152/207 (73%), Gaps = 8/207 (4%)
 Frame = +1

Query  4    TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  183
            +LI CT +  +  Y    + ++  P P P         GNLP LG KPHQS+AA+A  +G
Sbjct  6    SLIICTSILGLLFYLFFQKRRRLPPGPRPWPIV-----GNLPQLGAKPHQSMAALARVHG  60

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            PL+HL++GFV VVVAASA VA QFL+VHD+NF +RPPN+GAEH+AYNYQDLVFAPYGPRW
Sbjct  61   PLLHLKMGFVHVVVAASAGVAEQFLRVHDTNFLSRPPNAGAEHVAYNYQDLVFAPYGPRW  120

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRV  543
            R+LRKI  +HLFSAKALDDF HVR+EEV  + R+LA AG  PV++ + ++VC TNA+ RV
Sbjct  121  RLLRKICALHLFSAKALDDFRHVREEEVGIIVRTLADAGHKPVRISETVHVCATNAIARV  180

Query  544  MLGRKVF---NDGGSKSDPKAEEFKSM  615
            MLGR+V    N GG+  D  AEE K+M
Sbjct  181  MLGRRVLGHGNGGGACGDTTAEELKAM  207



>gb|AGT50313.1| flavonoid 3'-hydroxylase, partial [Meconopsis lancifolia]
Length=476

 Score =   216 bits (550),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 136/170 (80%), Gaps = 4/170 (2%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  3    GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  62

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYN+QDLVFAPYG RWRM RKI  VHLFS KALD+F +VR+EEVA LT++LA +
Sbjct  63   SGAKHIAYNHQDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQS  122

Query  478  GK----TPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             K    +PV L  LLNVCTTNAL RV+LG +V  DG   +D K++EFK M
Sbjct  123  NKNSKGSPVNLADLLNVCTTNALARVLLGTRVCGDGEGLADKKSQEFKEM  172



>ref|XP_002514665.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF47771.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=461

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +1

Query  157  IAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDL  336
            +AA+A+ YGPLMHLR+GFVDV+VAASA+VAAQFLK HD NFS+RP N+GA+++AYN+QDL
Sbjct  1    MAALAQVYGPLMHLRMGFVDVIVAASASVAAQFLKTHDVNFSSRPTNAGAKYVAYNHQDL  60

Query  337  VFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNV  516
            VFAPYGPRWR+LRKI+ VHLFSAKALDDF HVR++EV  LT +LA A +TP+ LG+LLN 
Sbjct  61   VFAPYGPRWRLLRKISSVHLFSAKALDDFRHVREQEVGILTHALADACETPINLGRLLNT  120

Query  517  CTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            CTTNAL RVM+GR+VF DG    D KA+EFKSM
Sbjct  121  CTTNALGRVMIGRRVFGDGSGGGDAKADEFKSM  153



>gb|AGT50318.1| flavonoid 3'-hydroxylase, partial [Meconopsis punicea]
Length=485

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 136/171 (80%), Gaps = 5/171 (3%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  11   GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  70

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+HIAYNYQDLVFAPYG RWRM RKI  +HLFS KALD+F +VR+EEVA LT++LA +
Sbjct  71   SGAKHIAYNYQDLVFAPYGRRWRMFRKICALHLFSGKALDEFRYVREEEVAVLTKALAQS  130

Query  478  GK-----TPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             K     +PV L  LLNVCTTNAL RV+LG +V  DG   +D K++EFK M
Sbjct  131  NKNSKAGSPVNLADLLNVCTTNALARVLLGTRVCGDGEGLADKKSQEFKEM  181



>ref|XP_010522740.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Tarenaya 
hassleriana]
Length=589

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 131/161 (81%), Gaps = 3/161 (2%)
 Frame = +1

Query  133  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  312
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  313  IAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  492
            IAYNYQDLVFAPYG RWRMLRKI+ VHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  493  KLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             L QL+NVC  NAL RVM+GR++F   G  +DP+AEEFKSM
Sbjct  121  NLSQLVNVCVVNALGRVMIGRRLF---GVGADPRAEEFKSM  158



>ref|XP_010522750.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X2 [Tarenaya 
hassleriana]
Length=565

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 131/161 (81%), Gaps = 3/161 (2%)
 Frame = +1

Query  133  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  312
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  313  IAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  492
            IAYNYQDLVFAPYG RWRMLRKI+ VHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  493  KLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             L QL+NVC  NAL RVM+GR++F   G  +DP+AEEFKSM
Sbjct  121  NLSQLVNVCVVNALGRVMIGRRLF---GVGADPRAEEFKSM  158



>gb|AGO03826.1| flavonoid 3`5`-hydroxylase [Billardiera heterophylla]
Length=521

 Score =   215 bits (547),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 162/208 (78%), Gaps = 7/208 (3%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVK---QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  171
            L  I C  + A+   + IL ++    R+P  LPPGP+PWP++GNLPHLG KPH SIAAMA
Sbjct  5    LEFILCFTITALPFLYCILNMRILLNRHPRSLPPGPRPWPIVGNLPHLGTKPHHSIAAMA  64

Query  172  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  351
             +YGPL+HLR+G V VVVAASA VAAQFLK +D+NFS+RPPNSGA+H+AYNY D+VFAPY
Sbjct  65   RKYGPLLHLRMGIVHVVVAASADVAAQFLK-NDANFSSRPPNSGAKHMAYNYHDMVFAPY  123

Query  352  GPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  531
            GPRWRMLRKI  +H+FSAKALDDF  VR+EEVA L R+LA AG+ PV LGQL + C  NA
Sbjct  124  GPRWRMLRKICALHIFSAKALDDFHRVREEEVAILARTLAHAGQKPVNLGQLFSTCNANA  183

Query  532  LTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            L+ +MLGR++F+   ++ D KA +FK M
Sbjct  184  LSVLMLGRRLFS---TEVDSKAYDFKQM  208



>gb|AAX19888.1| flavonoid-3',5'-hydroxylase [Pericallis cruenta]
Length=504

 Score =   214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 158/205 (77%), Gaps = 6/205 (3%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLI CT +  +  Y L+  +  R    LPPGP PWP++GNL HLGK PH S+A +A++Y
Sbjct  4    LTLI-CTFITGLMFYGLV-NLLSRRASRLPPGPTPWPIIGNLMHLGKLPHHSLADLAKKY  61

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPL+H+RLG VDVVVA+SA+VA QFLKVHD+NF+NRPPNSGA+H+AYNY D+VFAPYGPR
Sbjct  62   GPLIHVRLGSVDVVVASSASVAGQFLKVHDANFANRPPNSGAKHMAYNYHDMVFAPYGPR  121

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRK+  +HLFSAKAL DF  VRQEEV  LTR LA   ++ VKL Q LNVC  N L+R
Sbjct  122  WRMLRKMCSMHLFSAKALADFRQVRQEEVMILTRVLAGTEQSAVKLDQQLNVCFANTLSR  181

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            +ML R+VF DG    DPKA+++K M
Sbjct  182  MMLDRRVFGDG----DPKADDYKDM  202



>gb|KHN18348.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=519

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L +   T+V AI  Y L+  + +R  L LPPGP+PWPV+GNLPH+G   H+++A +A  Y
Sbjct  5    LIIGLATIVAAILSYRLLKLIIRRPSLHLPPGPRPWPVVGNLPHIGPLLHRALAVLARTY  64

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLM+LRLGFVDVVVAASA+VA QFLKVHD+NFS+RP NS   ++ YN +DL FAPYGPR
Sbjct  65   GPLMYLRLGFVDVVVAASASVAEQFLKVHDANFSSRPLNSMTTYMTYNQKDLAFAPYGPR  124

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WR LRKI+ VH+FS KALDDF  +RQEEV  LT +LAS+G T V LGQL+NVCTTN L R
Sbjct  125  WRFLRKISSVHMFSVKALDDFRQLRQEEVERLTSNLASSGSTAVNLGQLVNVCTTNTLAR  184

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VM+GR++FND  S  D KA+EFKSM
Sbjct  185  VMIGRRLFNDSRSSWDAKADEFKSM  209



>dbj|BAE72874.1| flavonoid 3'-hydroxylase [Verbena x hybrida]
Length=465

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +1

Query  157  IAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDL  336
            +AA++  YGPLMHL++GFV VVVAASA  A QFLKV+D+NFSNRPPN+GA+++AYNYQDL
Sbjct  1    MAALSRVYGPLMHLKMGFVHVVVAASAGAAEQFLKVNDANFSNRPPNAGAKYVAYNYQDL  60

Query  337  VFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNV  516
            VFAPYGPRWR+LRKI  +HLFSAKAL+DF  VRQEEV  LTR+LASAG+TP  LGQ+LNV
Sbjct  61   VFAPYGPRWRLLRKICALHLFSAKALEDFRTVRQEEVGILTRALASAGQTPASLGQMLNV  120

Query  517  CTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            C TNA+ RVMLGR+V        D KAEEFK M
Sbjct  121  CATNAIARVMLGRRVVGHSSGGGDEKAEEFKEM  153



>dbj|BAB87838.1| flavonoid 3'-hydroxylase [Torenia hybrid cultivar]
Length=512

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 134/166 (81%), Gaps = 2/166 (1%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG KPH S+A +A  YGPLMHL++GFV VVVA+SA+ A Q L+VHD+NF +RPPN
Sbjct  45   GNLPHLGPKPHASMAELARAYGPLMHLKMGFVHVVVASSASAAEQCLRVHDANFLSRPPN  104

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGA+H+AYNY+DLVF PYGP+WR+LRKI   H+FS KA+DDF  VR+EEVA L+R+L  A
Sbjct  105  SGAKHVAYNYEDLVFRPYGPKWRLLRKICAQHIFSVKAMDDFRRVREEEVAILSRAL--A  162

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            GK  V +GQ+LNVC TNAL+RVM+GR+V       +D KAEEFK+M
Sbjct  163  GKRAVPIGQMLNVCATNALSRVMMGRRVVGHADGTNDAKAEEFKAM  208



>ref|XP_003525448.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Glycine 
max]
Length=512

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPH+G  PHQ +AA+A+ +GPLMHLRLGFVDVVVA+SA+VA QFLK+HD+NF +RP N
Sbjct  42   GNLPHMGPAPHQGLAALAQTHGPLMHLRLGFVDVVVASSASVAEQFLKIHDANFCSRPCN  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            S   ++ YN QDLVFAPYGPRWR LRK++ VH+FSAKA+DDF  +RQEEV  LT +LA +
Sbjct  102  SRTTYLTYNQQDLVFAPYGPRWRFLRKLSTVHMFSAKAMDDFRELRQEEVERLTCNLARS  161

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
                V L QLLNVCTTN L R+M+GR++F+D  S  DP+A+EFKSM
Sbjct  162  SSKVVNLRQLLNVCTTNILARIMIGRRIFSDNSSNCDPRADEFKSM  207



>gb|KHN48735.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=512

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPH+G  PHQ +AA+A+ +GPLMHLRLGFVDVVVA+SA+VA QFLK+HD+NF +RP N
Sbjct  42   GNLPHMGPAPHQGLAALAKTHGPLMHLRLGFVDVVVASSASVAEQFLKIHDANFCSRPCN  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            S   ++ YN QDLVFAPYGPRWR LRK++ VH+FSAKA+DDF  +RQEEV  LT +LA +
Sbjct  102  SRTTYLTYNQQDLVFAPYGPRWRFLRKLSTVHMFSAKAMDDFRELRQEEVERLTCNLARS  161

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
                V L QLLNVCTTN L R+M+GR++F+D  S  DP+A+EFKSM
Sbjct  162  SSKVVNLRQLLNVCTTNILARIMIGRRIFSDNSSNCDPRADEFKSM  207



>ref|XP_003550701.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=526

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPH+G   H+++A +A  YGPLM+LRLGFVDVVVAASA+VA QFLKVHD+NFS+RP N
Sbjct  51   GNLPHIGPLLHRALAVLARTYGPLMYLRLGFVDVVVAASASVAEQFLKVHDANFSSRPLN  110

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            S   ++ YN +DL FAPYGPRWR LRKI+ VH+FS KALDDF  +RQEEV  LT +LAS+
Sbjct  111  SMTTYMTYNQKDLAFAPYGPRWRFLRKISSVHMFSVKALDDFRQLRQEEVERLTSNLASS  170

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            G T V LGQL+NVCTTN L RVM+GR++FND  S  D KA+EFKSM
Sbjct  171  GSTAVNLGQLVNVCTTNTLARVMIGRRLFNDSRSSWDAKADEFKSM  216



>dbj|BAB87839.1| flavonoid 3'-hydroxalase [Torenia hybrid cultivar]
Length=457

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 123/150 (82%), Gaps = 1/150 (1%)
 Frame = +1

Query  166  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  345
            MA+ YGPLMHL+ G  D VVA+SA+VA QFLK HD NFSNRPPNSGA+HIAYNYQDLVFA
Sbjct  1    MAKTYGPLMHLKFGLKDAVVASSASVAEQFLKKHDVNFSNRPPNSGAKHIAYNYQDLVFA  60

Query  346  PYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  525
            PYGPRWR+LRKI  VHLFS+KALDDF HVR EE+  L R++AS G  PV LG+LL VCTT
Sbjct  61   PYGPRWRLLRKICSVHLFSSKALDDFQHVRHEEICILIRAIASGGHAPVNLGKLLGVCTT  120

Query  526  NALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            NAL RVMLGR+VF +G    +P A+EFKSM
Sbjct  121  NALARVMLGRRVF-EGDGGENPHADEFKSM  149



>ref|XP_010030579.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
Length=514

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 151/205 (74%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            L+ I   +  +IFL  L L    R    LPPGPKPWP++GNLPHLG  PH+S+AA+A  Y
Sbjct  4    LSFILAAIAISIFLRSL-LGYLTRPTRALPPGPKPWPLVGNLPHLGPMPHRSMAALARSY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPL+HLRLG VDVVVAAS ++A QFLK HD+NF +RPP S  +H+ YN+Q +   PYG R
Sbjct  63   GPLLHLRLGLVDVVVAASGSMATQFLKTHDANFLSRPPRSAGKHLGYNHQGIGAVPYGSR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTR  540
            WRMLRKI+ VHLFS+KALDDF HVRQEEVA LT +LA  G   V L QLLNVCT NAL R
Sbjct  123  WRMLRKISTVHLFSSKALDDFRHVRQEEVAILTCALAHVGSASVNLAQLLNVCTANALGR  182

Query  541  VMLGRKVFNDGGSKSDPKAEEFKSM  615
            VMLG++V  +G  + + KA+EF+SM
Sbjct  183  VMLGKRVLGEGKGRDNLKADEFRSM  207



>gb|AFK73718.1| cytochrome P450 [Papaver somniferum]
Length=475

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 130/160 (81%), Gaps = 4/160 (3%)
 Frame = +1

Query  148  HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNY  327
            HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNY
Sbjct  4    HQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNY  63

Query  328  QDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVK  495
            QDLVFAPYG RWRM RKI  VHLFS KALD+F +VR+EEVA LT++LA + K    +PV 
Sbjct  64   QDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAKSNKNGQGSPVN  123

Query  496  LGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            L  LLNVCTTNAL RV+LG +V  DG   +D K++EFK M
Sbjct  124  LADLLNVCTTNALARVLLGTRVCGDGEGYADQKSQEFKEM  163



>gb|AHY35314.1| flavonoid 3'-hydroxylase 2 [Morus notabilis]
Length=490

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = +1

Query  130  HLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAE  309
             LG  PHQ+IAA+A ++GPLMHLR G VDVV AASA+VAAQFLK HD+NF +RPP+S A+
Sbjct  23   QLGPAPHQTIAALARKHGPLMHLRFGLVDVVAAASASVAAQFLKAHDTNFLSRPPSSAAK  82

Query  310  HIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTP  489
            H+ Y+Y DLV APYGPRWR++RKI  VHL S KAL+DF +VRQEE A L R LA+AG T 
Sbjct  83   HVGYDYHDLVLAPYGPRWRLMRKIASVHLLSGKALEDFRYVRQEEAAVLIRGLANAGPTA  142

Query  490  VKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            + L QLL++CTTN L R MLG +VF  G  KSDP+A+EFKSM
Sbjct  143  INLAQLLHLCTTNTLGRAMLGYRVFGGGSGKSDPRADEFKSM  184



>dbj|BAM28972.1| flavonoid 3'-hydroxylase [Lilium hybrid division I]
Length=514

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 131/166 (79%), Gaps = 3/166 (2%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG KPHQ++ A+++ +GPL  LRLG  +V+VAASA++A++FL+ HD+NFSNRPPN
Sbjct  43   GNLPHLGPKPHQTMHALSKLHGPLFRLRLGSAEVIVAASASIASEFLRTHDTNFSNRPPN  102

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGAEHIAYNY DLVFAPYGPRWR LRK+  +HLFS KAL+D C+VR++EVA L R LA +
Sbjct  103  SGAEHIAYNYNDLVFAPYGPRWRALRKLCALHLFSQKALEDLCYVREQEVAILARDLAGS  162

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             + PV LG+ LNVC TNAL+R  +G +VF   G   D  AEEFK M
Sbjct  163  SR-PVNLGETLNVCATNALSRATIGWRVFV--GKGEDVTAEEFKDM  205



>gb|AHL83556.1| flavonoid-3'-hydroxylase [Iris x hollandica]
Length=514

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 131/169 (78%), Gaps = 5/169 (3%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG KPHQ++AAM++ YGPL  LR G VDVVVAAS+ VAAQFL+ +D+NFSNRPPN
Sbjct  46   GNLPQLGTKPHQTLAAMSKLYGPLFRLRFGSVDVVVAASSTVAAQFLRTYDANFSNRPPN  105

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSL---  468
            SGAEH+AYNYQDLVFAPYGPRWRMLRK+  +HLFS KALDD   VRQ EVA L  +L   
Sbjct  106  SGAEHVAYNYQDLVFAPYGPRWRMLRKLCALHLFSLKALDDLRLVRQGEVAALAANLHRH  165

Query  469  ASAGKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            A+ G  PV LG+ LNVC TNAL R MLGRKVF +   + +  A+EFK M
Sbjct  166  AANGHPPVNLGRALNVCATNALARAMLGRKVFTEEEGRGE--ADEFKEM  212



>dbj|BAM28971.1| flavonoid 3'-hydroxylase [Lilium hybrid division I]
Length=514

 Score =   204 bits (519),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 130/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPHLG KPHQ++ A+++ +GPL  LRLG  +V+VAASA +A++FL+ HD+NFSNRPPN
Sbjct  43   GNLPHLGPKPHQTMHALSKLHGPLFRLRLGSAEVIVAASAPIASEFLRTHDTNFSNRPPN  102

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGAEHIAYNY DLVFAPYGPRWR LRK+  +HLFS KAL+D C+VR++EVA L R LA +
Sbjct  103  SGAEHIAYNYNDLVFAPYGPRWRTLRKLCALHLFSQKALEDLCYVREQEVAILARDLAGS  162

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             + PV LG+ LNVC TNAL+R  +G +VF   G   D  AEEFK M
Sbjct  163  CR-PVNLGETLNVCATNALSRATIGWRVFV--GKGEDVTAEEFKDM  205



>ref|XP_008453263.1| PREDICTED: flavonoid 3'-monooxygenase [Cucumis melo]
Length=521

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = +1

Query  118  GNLPHLGKKP-HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPP  294
            GN+P +G  P H  +AAMA +YGPLM+LRLG VD+VVAASAAVA Q LK+HD+NF +RPP
Sbjct  43   GNMPQIGGAPLHSLLAAMAGKYGPLMYLRLGSVDMVVAASAAVAEQVLKIHDTNFLSRPP  102

Query  295  NSGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLAS  474
            N+GA++IAYNYQD+VFAPYGPRWR+LRKI+ VHLFS+KALDD   +RQ+E++ L ++LA 
Sbjct  103  NAGAKYIAYNYQDMVFAPYGPRWRLLRKISAVHLFSSKALDDHRRIRQDEISVLVQALAR  162

Query  475  AGKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            +G+ P  LG LL VC  N+L R M+GR+VF DG    D ++ +FK+M
Sbjct  163  SGEAPANLGSLLTVCIANSLGRTMIGRRVFGDGSGSDDLESNQFKAM  209



>gb|KCW83706.1| hypothetical protein EUGRSUZ_B00580 [Eucalyptus grandis]
Length=465

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +1

Query  145  PHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYN  324
            PH+S+AA+A  YGPL+HLRLG VDVVVAAS ++A QFLK HD+NF +RPP S  +H+ YN
Sbjct  2    PHRSMAALARSYGPLLHLRLGLVDVVVAASGSMATQFLKTHDANFLSRPPRSAGKHLGYN  61

Query  325  YQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ  504
            +Q +   PYG RWRMLRKI+ VHLFS+KALDDF HVRQEEVA LT +LA  G   V L Q
Sbjct  62   HQGIGAVPYGSRWRMLRKISTVHLFSSKALDDFRHVRQEEVAILTCALAHVGSASVNLAQ  121

Query  505  LLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            LLNVCT NAL RVMLG++V  +G  + + KA+EF+SM
Sbjct  122  LLNVCTANALGRVMLGKRVLGEGKGRDNLKADEFRSM  158



>ref|XP_003525450.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=511

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 123/166 (74%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPH+G  PHQ +AA+A+ +GPLMHLRLGFV VVVAASAAVA QFLKVHD+NF NRP N
Sbjct  42   GNLPHMGPAPHQGLAALAKTHGPLMHLRLGFVHVVVAASAAVAEQFLKVHDANFCNRPYN  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
                ++ YN +D+ F PYGPRWR LRKI  VH+FS KA+D+F  +RQEEV  L  +L  +
Sbjct  102  FRTTYMTYNKKDIAFYPYGPRWRFLRKICTVHMFSGKAMDNFSQLRQEEVERLACNLTRS  161

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
                V L QLLNVC TN + R+ +GR++FND     DP+A+EFKSM
Sbjct  162  NSKAVNLRQLLNVCITNIMARITIGRRIFNDDSCNCDPRADEFKSM  207



>gb|KCW83705.1| hypothetical protein EUGRSUZ_B00580 [Eucalyptus grandis]
Length=478

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +1

Query  145  PHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYN  324
            PH+S+AA+A  YGPL+HLRLG VDVVVAAS ++A QFLK HD+NF +RPP S  +H+ YN
Sbjct  2    PHRSMAALARSYGPLLHLRLGLVDVVVAASGSMATQFLKTHDANFLSRPPRSAGKHLGYN  61

Query  325  YQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ  504
            +Q +   PYG RWRMLRKI+ VHLFS+KALDDF HVRQEEVA LT +LA  G   V L Q
Sbjct  62   HQGIGAVPYGSRWRMLRKISTVHLFSSKALDDFRHVRQEEVAILTCALAHVGSASVNLAQ  121

Query  505  LLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            LLNVCT NAL RVMLG++V  +G  + + KA+EF+SM
Sbjct  122  LLNVCTANALGRVMLGKRVLGEGKGRDNLKADEFRSM  158



>gb|KHN48734.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=506

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 123/166 (74%), Gaps = 0/166 (0%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLPH+G  PHQ +AA+A+ +GPLMHLRLGFV VVVAASAAVA QFLKVHD+NF NRP N
Sbjct  37   GNLPHMGPAPHQGLAALAKTHGPLMHLRLGFVHVVVAASAAVAEQFLKVHDANFCNRPYN  96

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
                ++ YN +D+ F PYGPRWR LRKI  VH+FS KA+D+F  +RQEEV  L  +L  +
Sbjct  97   FRTTYMTYNKKDIAFYPYGPRWRFLRKICTVHMFSGKAMDNFSQLRQEEVERLACNLTRS  156

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
                V L QLLNVC TN + R+ +GR++FND     DP+A+EFKSM
Sbjct  157  NSKAVNLRQLLNVCITNIMARITIGRRIFNDDSCNCDPRADEFKSM  202



>ref|XP_006665050.1| PREDICTED: flavonoid 3'-monooxygenase-like [Oryza brachyantha]
Length=522

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 125/169 (74%), Gaps = 7/169 (4%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG KPHQ++ A+A  YGPL  LR G  +VVVAASA VAAQFL+VHD+NFSNRPPN
Sbjct  46   GNLPQLGDKPHQTMCALAREYGPLFRLRFGCAEVVVAASADVAAQFLRVHDANFSNRPPN  105

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLA--  471
            SGAEH+AYNYQDLVFAPYG RWR LRK+  +HLFSAKAL+D   VR+ EVA + R+LA  
Sbjct  106  SGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSAKALEDLRAVREGEVALMVRNLARQ  165

Query  472  SAGKTPVKLGQLLNVCTTNALTRVMLGRKVFN-DGGSKSDPKAEEFKSM  615
            +A   PV LGQ  NVC TN L R  +GR+VF  DGG      A EFK M
Sbjct  166  AAATAPVVLGQEANVCATNTLARATIGRRVFAVDGGE----GAREFKEM  210



>gb|AAS48419.1| flavonoid 3'-hydroxylase [Allium cepa]
Length=510

 Score =   193 bits (491),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 126/169 (75%), Gaps = 5/169 (3%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG KPHQS+  ++  YGPL  LR G+VDVVVAASA VA QFL+VHD NFSNRPPN
Sbjct  42   GNLPQLGAKPHQSLCELSRTYGPLFGLRFGYVDVVVAASADVAEQFLRVHDVNFSNRPPN  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSL---  468
            SGAEHIAYNYQDLVFAPYGPRWRMLRK+  +HLFS KAL+D   VR  EVATL  +L   
Sbjct  102  SGAEHIAYNYQDLVFAPYGPRWRMLRKLCALHLFSPKALEDLSPVRSLEVATLANTLYLR  161

Query  469  ASAGKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            A + +  V L Q+L  CTTNAL++ M+GR+VF +    +D +  +FK M
Sbjct  162  AQSDQPTVNLAQMLTTCTTNALSKAMMGRRVFVN--ETTDTETSKFKDM  208



>ref|XP_009394321.1| PREDICTED: flavonoid 3'-monooxygenase [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 125/166 (75%), Gaps = 2/166 (1%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG KPH+++ A+A+ +GPL  LR G VDVVVAASAAVA+Q L+ HD+ F +RPPN
Sbjct  42   GNLPQLGPKPHRTLHALAKVHGPLFRLRFGSVDVVVAASAAVASQLLRAHDAIFCDRPPN  101

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGAEH+AYNYQDLVFAPYGPRWRMLRK+  VHLFSAKALDD   VRQ EV  L  +L + 
Sbjct  102  SGAEHVAYNYQDLVFAPYGPRWRMLRKLCSVHLFSAKALDDLRWVRQGEVGLLVHALRAC  161

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            G  PV LG  +NVC TNAL R  +GR+VF + GS+    A EFK M
Sbjct  162  GDAPVNLGYAVNVCATNALARATMGRRVFEEDGSRE--GAGEFKEM  205



>gb|AGJ50589.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
 gb|AGL98427.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
 gb|AGL98428.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
Length=510

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 126/166 (76%), Gaps = 3/166 (2%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG KPHQ++ A+++ +GPL  L+LG  +VVVAAS+ VAA+FL+ HD+NFSNRPPN
Sbjct  45   GNLPQLGTKPHQTMHALSKVHGPLFRLKLGSAEVVVAASSTVAAEFLRSHDANFSNRPPN  104

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGAEHIAYNY DLVFAPYGPRWR LRK+  +HLFS KAL+D  +VR++EV  L   LAS 
Sbjct  105  SGAEHIAYNYNDLVFAPYGPRWRALRKLCALHLFSQKALEDLRYVREQEVGILAGDLAST  164

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             + PV LG+ LNVC TNAL+R  +G +VF   G   D  AEEFK M
Sbjct  165  SR-PVNLGEALNVCATNALSRATVGWRVFV--GKGEDMTAEEFKDM  207



>gb|AGT50323.1| flavonoid 3'-hydroxylase, partial [Meconopsis pseudohorridula]
Length=452

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 120/148 (81%), Gaps = 4/148 (3%)
 Frame = +1

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  531
            RM RKI  VHLFS KALD+F +VR+EEVA LT++LA   K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQTNKNSKGSPVNLADLLNVCTTNA  120

Query  532  LTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            L RV+LGR+V  DG   +D K++EFK M
Sbjct  121  LARVLLGRRVCGDGEGLADKKSQEFKEM  148



>gb|AFW72123.1| red aleurone1 [Zea mays]
Length=515

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 122/170 (72%), Gaps = 8/170 (5%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP +G KPH ++ AMA  YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  46   GNLPQVGAKPHHTMCAMAREYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPN  105

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLA--  471
            SGAEH+AYNYQDLVFAPYG RWR LRK+  +HLFSAKALDD   VR+ EVA + R LA  
Sbjct  106  SGAEHVAYNYQDLVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARQ  165

Query  472  -SAGKTPVKLGQLLNVCTTNALTRVMLGRKVFN-DGGSKSDPKAEEFKSM  615
               G+  V LGQ+ NVC TN L R  +GR+VF  DGG      A EFK M
Sbjct  166  GERGRAAVALGQVANVCATNTLARATVGRRVFAVDGGE----GAREFKEM  211



>gb|AIC73642.1| flavonoid 3'-hydroxylase [Anthurium andraeanum]
Length=511

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 123/166 (74%), Gaps = 3/166 (2%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG KPH ++AA++  YGPL+HLRLG V  VVA+SA+VAA FLK HD+NFS+RPPN
Sbjct  46   GNLPQLGAKPHHTLAALSRAYGPLLHLRLGRVHAVVASSASVAAAFLKTHDANFSSRPPN  105

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGAEH+AYNYQDLVFAPYGPRWR LRK+  VHLF  +AL+ F HVR+EE   L R+L   
Sbjct  106  SGAEHVAYNYQDLVFAPYGPRWRTLRKLCSVHLFCTRALEGFRHVREEEAGVLARALLGR  165

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
              +   +G+ +NVC  NAL R ++GR+VF  G  +   + EEFK M
Sbjct  166  RGSAADVGEEVNVCAANALARAVMGRRVFGGGLGR---ETEEFKEM  208



>gb|KGN63720.1| Flavonoid 3' hydroxylase [Cucumis sativus]
Length=488

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 131/167 (78%), Gaps = 1/167 (1%)
 Frame = +1

Query  118  GNLPHLGKKP-HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPP  294
            GN+P +G+   H  +A MA +YGPLM+LRLG VD+VVAASAAVA Q LK+HD+NF +RPP
Sbjct  43   GNMPQIGEAHLHSLLATMAGKYGPLMYLRLGSVDMVVAASAAVAEQVLKIHDTNFLSRPP  102

Query  295  NSGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLAS  474
            N+GA++IAYNYQD+VFAPYGPRWR+LRKI+ VHLFS+KALDD   +R+EE++ L ++LA 
Sbjct  103  NAGAKYIAYNYQDMVFAPYGPRWRLLRKISTVHLFSSKALDDHRRIREEEISVLVQALAR  162

Query  475  AGKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            +G+ P  LG LL VC  N+L R M+GR+VF DG    D ++ +FK M
Sbjct  163  SGEAPANLGSLLTVCIANSLGRTMIGRRVFGDGSGSDDLESNQFKLM  209



>ref|XP_004138192.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
 ref|XP_004154949.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=522

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 131/167 (78%), Gaps = 1/167 (1%)
 Frame = +1

Query  118  GNLPHLGKKP-HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPP  294
            GN+P +G+   H  +A MA +YGPLM+LRLG VD+VVAASAAVA Q LK+HD+NF +RPP
Sbjct  43   GNMPQIGEAHLHSLLATMAGKYGPLMYLRLGSVDMVVAASAAVAEQVLKIHDTNFLSRPP  102

Query  295  NSGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLAS  474
            N+GA++IAYNYQD+VFAPYGPRWR+LRKI+ VHLFS+KALDD   +R+EE++ L ++LA 
Sbjct  103  NAGAKYIAYNYQDMVFAPYGPRWRLLRKISTVHLFSSKALDDHRRIREEEISVLVQALAR  162

Query  475  AGKTPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            +G+ P  LG LL VC  N+L R M+GR+VF DG    D ++ +FK M
Sbjct  163  SGEAPANLGSLLTVCIANSLGRTMIGRRVFGDGSGSDDLESNQFKLM  209



>ref|XP_004983036.1| PREDICTED: flavonoid 3'-monooxygenase-like [Setaria italica]
Length=515

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 121/167 (72%), Gaps = 5/167 (3%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG KPH ++AAMA  +GPL  LR G  +VVVAASAAVAAQFL+ HD+NFSNRPPN
Sbjct  46   GNLPQLGAKPHHTMAAMAREHGPLFRLRFGSAEVVVAASAAVAAQFLRAHDANFSNRPPN  105

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGAEH+AYNYQDLVFAPYG RWR LRK+  +HLFSA+ALDD   VR+ EVA + R LA  
Sbjct  106  SGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSARALDDLRAVREGEVALMVRELARQ  165

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFN-DGGSKSDPKAEEFKSM  615
                V LGQ  NVC TN L R  +GR+VF  DGG      A EFK M
Sbjct  166  RGPAVALGQAANVCATNTLARATVGRRVFAVDGGE----GAREFKEM  208



>dbj|BAM28973.1| flavonoid 3'-hydroxylase, partial [Lilium hybrid division I]
Length=453

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 123/157 (78%), Gaps = 3/157 (2%)
 Frame = +1

Query  145  PHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYN  324
            PHQ++ A+++ +GPL  LRLG  +V+VAASA++A++FL+ HD+NFSNRPPNSGAEHIAYN
Sbjct  1    PHQTMHALSKLHGPLFRLRLGSAEVIVAASASIASEFLRTHDTNFSNRPPNSGAEHIAYN  60

Query  325  YQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ  504
            Y DLVFAPYGPRWR LRK+  +HLFS KAL+D C+VR++EVA L R LA + + PV LG+
Sbjct  61   YNDLVFAPYGPRWRALRKLCALHLFSQKALEDLCYVREQEVALLARDLAGSSR-PVNLGE  119

Query  505  LLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             LNVC TNAL+R  +G +VF   G   D  AEEFK M
Sbjct  120  TLNVCATNALSRATIGWRVFV--GKGEDVTAEEFKDM  154



>gb|AGT50312.1| flavonoid 3'-hydroxylase, partial [Meconopsis racemosa]
Length=445

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 120/148 (81%), Gaps = 4/148 (3%)
 Frame = +1

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  531
            RM RKI  VHLFS KALD+F +VR+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLADLLNVCTTNA  120

Query  532  LTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            L RV+LG +V  DG   +D K++EFK M
Sbjct  121  LARVLLGTRVCGDGEGLADKKSQEFKEM  148



>gb|AGT50315.1| flavonoid 3'-hydroxylase, partial [Meconopsis betonicifolia]
Length=452

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 120/148 (81%), Gaps = 4/148 (3%)
 Frame = +1

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  531
            RM RKI  VHLFS KALD+F +VR+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLADLLNVCTTNA  120

Query  532  LTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            L RV+LG +V  DG   +D K++EFK M
Sbjct  121  LARVLLGTRVCGDGEGLADKKSQEFKEM  148



>gb|AGT50317.1| flavonoid 3'-hydroxylase, partial [Meconopsis zangnanensis]
Length=442

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 120/150 (80%), Gaps = 4/150 (3%)
 Frame = +1

Query  178  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  357
            YGP+++LR G V+VVVA SA++A+QFLK  DSNFSNRPPNSGA+HIAYNYQDLVFAPYG 
Sbjct  4    YGPIIYLRFGSVNVVVACSASIASQFLKTRDSNFSNRPPNSGAKHIAYNYQDLVFAPYGR  63

Query  358  RWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTT  525
            RWRM RKI  VHLFS KALD+F +VR+EEVA LT++LA + +    +PV L  LLNVCTT
Sbjct  64   RWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNENSKGSPVNLADLLNVCTT  123

Query  526  NALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            NAL RV+LG +V  DG   +D K++EFK M
Sbjct  124  NALARVLLGTRVCGDGEGLADKKSQEFKEM  153



>gb|AGT50324.1| flavonoid 3'-hydroxylase, partial [Papaver nudicaule]
Length=449

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 120/148 (81%), Gaps = 4/148 (3%)
 Frame = +1

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            P+++LRLG V+VVVA SA++A+QFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  531
            RM RKI  VHLFS KALD+F ++R+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFWYIREEEVAVLTKALAQSSKNNKGSPVNLADLLNVCTTNA  120

Query  532  LTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            L RV+LG +V  DG   +D K++EFK M
Sbjct  121  LARVLLGTRVCGDGEGLADKKSQEFKEM  148



>gb|AGT50314.1| flavonoid 3'-hydroxylase, partial [Meconopsis henrici]
Length=445

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 120/148 (81%), Gaps = 4/148 (3%)
 Frame = +1

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  531
            RM RKI  VHLFS KALD+F +VR+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLADLLNVCTTNA  120

Query  532  LTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            L RV+LG +V  DG   +D K++EFK M
Sbjct  121  LARVLLGTRVCGDGEGFADRKSQEFKEM  148



>dbj|BAH22519.1| flavonoid 3' hydroxylase [Tricyrtis hirta]
Length=505

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 138/199 (69%), Gaps = 8/199 (4%)
 Frame = +1

Query  19   TLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHL  198
            TLVFA  LY L+     R P      P      GNLP LG KPHQ++ A+++ +GPL  L
Sbjct  11   TLVFASLLYHLLSGPAHRLPPGPRGWPIL----GNLPQLGPKPHQTLHALSKAHGPLFLL  66

Query  199  RLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRK  378
            RLG VDVVVAASAAVAA FL+ HD+ FSNRPPNSGAEHIAYNYQDLVFAPYGPRWR LRK
Sbjct  67   RLGSVDVVVAASAAVAAAFLRQHDAIFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRHLRK  126

Query  379  ITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALTRVMLGRK  558
            +  +HLFS+KALDD   +R++E+  LTRSL      PV LG+ +NVC TNAL R  +G +
Sbjct  127  LCSLHLFSSKALDDLRPIREQEIQRLTRSLLVG--RPVNLGEAVNVCATNALARATVGWR  184

Query  559  VFNDGGSKSDPKAEEFKSM  615
            VF   G   D  AEEFK M
Sbjct  185  VFV--GEGEDTAAEEFKEM  201



>gb|AGT50325.1| flavonoid 3'-hydroxylase, partial [Papaver radicatum]
Length=449

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 120/148 (81%), Gaps = 4/148 (3%)
 Frame = +1

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            P+++LRLG V+VVVA SA++A+QFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  531
            RM RKI  VHLFS KALD+F ++R+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYIREEEVAVLTKALAQSSKNNKGSPVNLADLLNVCTTNA  120

Query  532  LTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            L RV+LG +V  DG   +D K++EFK M
Sbjct  121  LARVLLGTRVCGDGEGLADKKSQEFKEM  148



>gb|AGT50316.1| flavonoid 3'-hydroxylase, partial [Meconopsis integrifolia]
Length=445

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 120/148 (81%), Gaps = 4/148 (3%)
 Frame = +1

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPP+SGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPDSGAKHIAYNYQDLVFAPYGRRW  60

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  531
            RM RKI  VHLFS KALD+F +VR+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLSDLLNVCTTNA  120

Query  532  LTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            L RV+LG +V  DG   +D K++EFK M
Sbjct  121  LARVLLGTRVCGDGEGLADKKSQEFKEM  148



>gb|AGT50319.1| flavonoid 3'-hydroxylase, partial [Meconopsis quintuplinervia]
Length=454

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 120/149 (81%), Gaps = 5/149 (3%)
 Frame = +1

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGK-----TPVKLGQLLNVCTTN  528
            RM RKI  +HLFS KALD+F +VR+EEVA LT++LA + K     +PV L  LLNVCTTN
Sbjct  61   RMFRKICALHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKAGSPVNLADLLNVCTTN  120

Query  529  ALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            AL RV+LG +V  DG   +D K++EFK M
Sbjct  121  ALARVLLGTRVCGDGEGLADKKSQEFKDM  149



>gb|AGT50321.1| flavonoid 3'-hydroxylase, partial [Meconopsis wilsonii]
Length=445

 Score =   186 bits (473),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 118/148 (80%), Gaps = 4/148 (3%)
 Frame = +1

Query  184  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  363
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGARHIAYNYQDLVFAPYGRRW  60

Query  364  RMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  531
            RM RKI  VHLFS KALD+F + R+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYAREEEVAVLTKALAQSNKNSKGSPVNLADLLNVCTTNA  120

Query  532  LTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            L RV+LG +V  DG   +D K++EFK M
Sbjct  121  LARVLLGTRVCGDGEGFADKKSQEFKEM  148



>ref|NP_001064338.1| Os10g0320100 [Oryza sativa Japonica Group]
 gb|AAM00948.1|AC021892_12 Putative flavonoid 3'-hydroxylase [Oryza sativa Japonica Group]
 gb|AAN04937.1| Putative chalcone flavonoid 3' - hydroxylase [Oryza sativa Japonica 
Group]
 gb|AAP52914.1| Flavonoid 3'-monooxygenase, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26252.1| Os10g0320100 [Oryza sativa Japonica Group]
 gb|EAY78007.1| hypothetical protein OsI_33047 [Oryza sativa Indica Group]
 gb|EAZ15637.1| hypothetical protein OsJ_31048 [Oryza sativa Japonica Group]
 dbj|BAG89180.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEK31169.1| flavonoid 3'-hydroxylase [Oryza sativa Japonica Group]
Length=526

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 120/167 (72%), Gaps = 5/167 (3%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG KPH ++ A+A +YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  52   GNLPQLGDKPHHTMCALARQYGPLFRLRFGCAEVVVAASAPVAAQFLRGHDANFSNRPPN  111

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGAEH+AYNYQDLVFAPYG RWR LRK+  +HLFSAKALDD   VR+ EVA + R+LA  
Sbjct  112  SGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSAKALDDLRAVREGEVALMVRNLARQ  171

Query  478  GKTPVKLGQLLNVCTTNALTRVMLGRKVFN-DGGSKSDPKAEEFKSM  615
                V LGQ  NVC TN L R  +G +VF  DGG      A EFK M
Sbjct  172  QAASVALGQEANVCATNTLARATIGHRVFAVDGGE----GAREFKEM  214



>gb|AFP95893.1| F3'H [Narcissus tazetta]
Length=528

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 123/168 (73%), Gaps = 6/168 (4%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNL  LG KPHQ++ A++  YGPL  LR G V+V+   SA VAAQFL+ HD+NFSNRPPN
Sbjct  63   GNLLQLGAKPHQTLCALSRVYGPLFSLRFGSVNVIAVTSADVAAQFLRTHDANFSNRPPN  122

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGAEH+ YNYQDLVFAPYGPRWRMLRK+  +HLFSAKALDDF  VR  EVA L  +L S 
Sbjct  123  SGAEHVVYNYQDLVFAPYGPRWRMLRKLCALHLFSAKALDDFRPVRAGEVAILANTLYSH  182

Query  478  GKT--PVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             ++     LG+LL +CTTNAL++ +LG +VF + G+     A +FK +
Sbjct  183  AQSRREANLGELLTICTTNALSKAVLGLRVFGEAGN----GASDFKEL  226



>gb|AGG40645.1| flavanone 3'-hydroxylase [Narcissus tazetta]
Length=529

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 122/168 (73%), Gaps = 6/168 (4%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            G+L  LG KPHQ++ A++  YGPL  LR G V+V+   SA VAAQFL+ HD+NFSNRPPN
Sbjct  63   GSLLQLGAKPHQTLCALSRVYGPLFSLRFGSVNVIAVTSADVAAQFLRTHDANFSNRPPN  122

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SGAEH+AYNYQDLVFAPYGPRWRMLRK+  +HLFS KALDD   VR  EVA L  +L + 
Sbjct  123  SGAEHVAYNYQDLVFAPYGPRWRMLRKLCALHLFSPKALDDLRPVRAGEVAILANTLYNH  182

Query  478  GKT--PVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
             +T     LG+LL +CTTNAL++ MLG +VF + G+     A +FK +
Sbjct  183  AQTHGEANLGELLTICTTNALSKAMLGLRVFGEAGN----GASDFKEL  226



>ref|XP_008678758.1| PREDICTED: flavonoid 3'-monooxygenase-like [Zea mays]
 gb|AFW62811.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=521

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 147/214 (69%), Gaps = 13/214 (6%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRV--KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  174
            L L+  +L  ++ ++ L+LR     +   PLPPGP+ WPVLGNLP +G KPH ++ A+A 
Sbjct  5    LPLLLGSLAVSVMVWCLVLRRGGDGKGKRPLPPGPRGWPVLGNLPQVGAKPHHTMCALAR  64

Query  175  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  354
             YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPNSGAEH+AYNY+DLVFAPYG
Sbjct  65   EYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPNSGAEHVAYNYRDLVFAPYG  124

Query  355  PRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLA-----SAGK-TPVKLGQLLNV  516
             RWR LRK+  +HLFSAKALDD   VR+ EVA + R LA       G+   V LGQ+ NV
Sbjct  125  SRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARPRRGEGGRAAAVALGQVANV  184

Query  517  CTTNALTRVMLGRKVFN-DGGSKSDPKAEEFKSM  615
            C TN L R  +GR+VF  DGG      A EFK M
Sbjct  185  CATNTLARATVGRRVFAVDGGE----GAREFKEM  214



>gb|ABG54319.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 123/172 (72%), Gaps = 13/172 (8%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP +G  PH ++ A+A+ YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQVGSHPHHTMCALAKEYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPN  107

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLAS-  474
            SGAEH+AYNYQDLVFAPYG RWR LRK+  +HLFSAKALDD   VR+ EVA + R LA  
Sbjct  108  SGAEHVAYNYQDLVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARH  167

Query  475  ----AGKTPVKLGQLLNVCTTNALTRVMLGRKVFN-DGGSKSDPKAEEFKSM  615
                AG   V LGQ+ NVC TN L R  +GR+VF  DGG     +A EFK M
Sbjct  168  QHQHAG---VPLGQVANVCATNTLARATVGRRVFAVDGGE----EAREFKDM  212



>emb|CDP16353.1| unnamed protein product [Coffea canephora]
Length=151

 Score =   174 bits (441),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 125/149 (84%), Gaps = 1/149 (1%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  180
            LTLIF + + A FL + IL+        LPPGPKPWP++GNLPHLG KPH S+AAMA+ Y
Sbjct  4    LTLIFISSLLA-FLLYSILKKAGNPSKSLPPGPKPWPIVGNLPHLGTKPHHSLAAMAKTY  62

Query  181  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  360
            GPLMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  63   GPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPR  122

Query  361  WRMLRKITFVHLFSAKALDDFCHVRQEEV  447
            WR+LRKI  +HLFSAKALDDF  VRQ ++
Sbjct  123  WRLLRKICSIHLFSAKALDDFHLVRQVKI  151



>gb|ABG54320.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 123/172 (72%), Gaps = 13/172 (8%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG  PH ++ A+A++YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQLGSHPHHTMCALAKKYGPLFRLRFGSAEVVVAASARVAAQFLRTHDANFSNRPPN  107

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLAS-  474
            SGAEH+AYNYQD+ FAPYG RWR LRK+  +HLFSAKALDD   +R+ EVA L R L+  
Sbjct  108  SGAEHVAYNYQDMAFAPYGSRWRALRKLCALHLFSAKALDDLRSIREGEVALLVRELSRH  167

Query  475  ----AGKTPVKLGQLLNVCTTNALTRVMLGRKVFN-DGGSKSDPKAEEFKSM  615
                AG   V LGQ+ NVC TN L R  +GR+VF  DGG     +A EFK M
Sbjct  168  QHQHAG---VPLGQVANVCATNTLARATVGRRVFAVDGGE----EAREFKDM  212



>ref|XP_002452380.1| hypothetical protein SORBIDRAFT_04g024710 [Sorghum bicolor]
 gb|EES05356.1| hypothetical protein SORBIDRAFT_04g024710 [Sorghum bicolor]
Length=517

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 123/172 (72%), Gaps = 13/172 (8%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG  PH ++ A+A++YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQLGSHPHHTMCALAKKYGPLFRLRFGSAEVVVAASARVAAQFLRTHDANFSNRPPN  107

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLAS-  474
            SGAEH+AYNYQD+ FAPYG RWR LRK+  +HLFSAKALDD   +R+ EVA L R L+  
Sbjct  108  SGAEHVAYNYQDMAFAPYGSRWRALRKLCALHLFSAKALDDLRSIREGEVALLVRELSRH  167

Query  475  ----AGKTPVKLGQLLNVCTTNALTRVMLGRKVFN-DGGSKSDPKAEEFKSM  615
                AG   V LGQ+ NVC TN L R  +GR+VF  DGG     +A EFK M
Sbjct  168  QHQHAG---VPLGQVANVCATNTLARATVGRRVFAVDGGE----EAREFKDM  212



>gb|AGT50322.1| flavonoid 3'-hydroxylase, partial [Meconopsis gracilipes]
Length=428

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 100/126 (79%), Gaps = 4/126 (3%)
 Frame = +1

Query  250  QFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCH  429
            QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RWRM RKI  VHLFS KALD+F +
Sbjct  14   QFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRWRMFRKICAVHLFSGKALDEFQY  73

Query  430  VRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKA  597
            VR+EEVA LT++LA + K    +PV L  LLNVCTTNAL RV+LG +V  DG   +D K+
Sbjct  74   VREEEVAVLTKALAQSNKNSKGSPVNLADLLNVCTTNALARVLLGTRVCGDGEGFADKKS  133

Query  598  EEFKSM  615
            +EFK M
Sbjct  134  QEFKEM  139



>gb|AII26680.1| flavonoid 3'-hydroxylase [Indosasa hispida]
Length=521

 Score =   183 bits (464),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 140/202 (69%), Gaps = 9/202 (4%)
 Frame = +1

Query  25   VFAIFLYFLILRV-KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLR  201
            V AI  Y L  R  K R   PLPPGP+ WPVLGNLP LG K HQ++  M + YGPL+ LR
Sbjct  14   VSAIVCYVLFFRAGKARRRAPLPPGPRGWPVLGNLPQLGGKTHQTLHVMTKVYGPLLRLR  73

Query  202  LGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKI  381
             G  DVVVA SAAVA QFL++HD+ FSNRPPNSG EH+AYNYQD+VF PYGPRWR +RK+
Sbjct  74   FGSSDVVVAGSAAVAEQFLRIHDAKFSNRPPNSGGEHMAYNYQDVVFGPYGPRWRAMRKV  133

Query  382  TFVHLFSAKALDDFCHVRQEEVATLTRSLASA----GKTPVKLGQLLNVCTTNALTRVML  549
              V+LFSA+ALDD   VR+ E A + RSL  A    G   V LG+ +NVCTTNAL+R  +
Sbjct  134  CAVNLFSARALDDLRAVREREAALMVRSLVEASAPRGAPAVPLGKAVNVCTTNALSRAAV  193

Query  550  GRKVFNDGGSKSDPKAEEFKSM  615
            GR+VF  G       A+EFK +
Sbjct  194  GRRVFAAGSE----VAKEFKEI  211



>gb|AEF33624.1| flavonoid 3' hydroxylase [Zea mays]
Length=517

 Score =   182 bits (463),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 122/172 (71%), Gaps = 13/172 (8%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG  PH ++ A+A++YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQLGSHPHHTMCALAKKYGPLFRLRFGSAEVVVAASARVAAQFLRTHDANFSNRPPN  107

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLAS-  474
            SGAEH+AYNYQD+ FAPYG RWR LRK+  +HLFSAKALDD   +R+ EVA L R L+  
Sbjct  108  SGAEHVAYNYQDMAFAPYGSRWRALRKLCALHLFSAKALDDLRSIREGEVALLVRELSRH  167

Query  475  ----AGKTPVKLGQLLNVCTTNALTRVMLGRKVFN-DGGSKSDPKAEEFKSM  615
                AG   V LGQ+ NVC TN L R   GR+VF  DGG     +A EFK M
Sbjct  168  QHQHAG---VPLGQVANVCATNTLARATAGRRVFAVDGGE----EAREFKDM  212



>ref|XP_002439914.1| hypothetical protein SORBIDRAFT_09g022480 [Sorghum bicolor]
 gb|EES18344.1| hypothetical protein SORBIDRAFT_09g022480 [Sorghum bicolor]
Length=535

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 116/153 (76%), Gaps = 4/153 (3%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG K HQ++  + + YGPL+ LR G  DVVVA SAAVA QFL+VHD+NFS RPPN
Sbjct  58   GNLPQLGGKTHQTLHELTKVYGPLLRLRFGSSDVVVAGSAAVAEQFLRVHDANFSCRPPN  117

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLASA  477
            SG E +AYNYQD+VFAPYGPRWR +RK+  V+LFSA+ALDD C VR+ E A + RSLA  
Sbjct  118  SGGELMAYNYQDVVFAPYGPRWRAMRKVCAVNLFSARALDDICDVREREAALMVRSLAEQ  177

Query  478  G----KTPVKLGQLLNVCTTNALTRVMLGRKVF  564
                  TPV LG+ +NVCTTNAL+R  +GR+VF
Sbjct  178  AARDRNTPVALGKAVNVCTTNALSRAAVGRRVF  210



>ref|XP_002454110.1| hypothetical protein SORBIDRAFT_04g024750 [Sorghum bicolor]
 gb|EES07086.1| hypothetical protein SORBIDRAFT_04g024750 [Sorghum bicolor]
Length=517

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 123/172 (72%), Gaps = 13/172 (8%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP +G  P+ ++ A+A+ YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQVGSHPYHTMCALAKEYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPN  107

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLAS-  474
            SGAEH+AYNYQDLVFAPYG RWR LRK+  +HLFSAKALDD   VR+ EVA + R LA  
Sbjct  108  SGAEHVAYNYQDLVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARH  167

Query  475  ----AGKTPVKLGQLLNVCTTNALTRVMLGRKVFN-DGGSKSDPKAEEFKSM  615
                AG   V LGQ+ NVC TN L R  +GR+VF  DGG     +A EFK M
Sbjct  168  QHQHAG---VPLGQVANVCATNTLARATVGRRVFAVDGGE----EAREFKDM  212



>gb|ABG54321.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=515

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 120/169 (71%), Gaps = 7/169 (4%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP +G  PH ++ A+A+ YGPL  LR G  DVVVAASA VA QFL+ HD+NFSNRPPN
Sbjct  46   GNLPQVGSHPHHTMYALAKEYGPLFRLRFGSADVVVAASARVAVQFLRAHDANFSNRPPN  105

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLA--  471
            SGAEH+AYNYQD+VFAPYG RWR LRK+  +HLFSAKALDD   VR+ EVA + R LA  
Sbjct  106  SGAEHMAYNYQDMVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRQLALH  165

Query  472  SAGKTPVKLGQLLNVCTTNALTRVMLGRKVFN-DGGSKSDPKAEEFKSM  615
                  V LGQ+ NVC TN L R  +GR+VF  DGG     +A EFK M
Sbjct  166  QHQHAGVPLGQVANVCATNTLARATVGRRVFAVDGGE----EAREFKDM  210



>ref|XP_002452385.1| hypothetical protein SORBIDRAFT_04g024730 [Sorghum bicolor]
 gb|EES05361.1| hypothetical protein SORBIDRAFT_04g024730 [Sorghum bicolor]
Length=517

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 120/169 (71%), Gaps = 7/169 (4%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP +G  PH ++ A+A+ YGPL  LR G  DVVVAASA VA QFL+ HD+NFSNRPPN
Sbjct  48   GNLPQVGSHPHHTMYALAKEYGPLFRLRFGSADVVVAASARVAVQFLRAHDANFSNRPPN  107

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLA--  471
            SGAEH+AYNYQD+VFAPYG RWR LRK+  +HLFSAKALDD   VR+ EVA + R LA  
Sbjct  108  SGAEHMAYNYQDMVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRQLALH  167

Query  472  SAGKTPVKLGQLLNVCTTNALTRVMLGRKVFN-DGGSKSDPKAEEFKSM  615
                  V LGQ+ NVC TN L R  +GR+VF  DGG     +A EFK M
Sbjct  168  QHQHAGVPLGQVANVCATNTLARATVGRRVFAVDGGE----EAREFKDM  212



>gb|AFW62812.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=944

 Score =   184 bits (467),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 147/214 (69%), Gaps = 13/214 (6%)
 Frame = +1

Query  1    LTLIFCTLVFAIFLYFLILRV--KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  174
            L L+  +L  ++ ++ L+LR     +   PLPPGP+ WPVLGNLP +G KPH ++ A+A 
Sbjct  5    LPLLLGSLAVSVMVWCLVLRRGGDGKGKRPLPPGPRGWPVLGNLPQVGAKPHHTMCALAR  64

Query  175  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  354
             YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPNSGAEH+AYNY+DLVFAPYG
Sbjct  65   EYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPNSGAEHVAYNYRDLVFAPYG  124

Query  355  PRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLA-----SAGK-TPVKLGQLLNV  516
             RWR LRK+  +HLFSAKALDD   VR+ EVA + R LA       G+   V LGQ+ NV
Sbjct  125  SRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARPRRGEGGRAAAVALGQVANV  184

Query  517  CTTNALTRVMLGRKVFN-DGGSKSDPKAEEFKSM  615
            C TN L R  +GR+VF  DGG      A EFK M
Sbjct  185  CATNTLARATVGRRVFAVDGGE----GAREFKEM  214



>ref|XP_008791304.1| PREDICTED: flavonoid 3'-monooxygenase-like [Phoenix dactylifera]
Length=517

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 125/168 (74%), Gaps = 5/168 (3%)
 Frame = +1

Query  118  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  297
            GNLP LG KPH ++ A++  +GPL  LRLG VDVVVAASAAVAAQFL+ HD+NFSNRPPN
Sbjct  45   GNLPQLGPKPHHTLHALSRAHGPLFRLRLGSVDVVVAASAAVAAQFLRAHDANFSNRPPN  104

Query  298  SGAEHIAYNYQDLVFAPYGPRWRMLRKITFVHLFSAKALDDFCHVRQEEVATLTRSLAS-  474
            SGAEHIAYNYQDLVFAPYGP WR  RK+  VHLFS KAL+D   VR+ E+A L R+L   
Sbjct  105  SGAEHIAYNYQDLVFAPYGPGWRARRKLLNVHLFSGKALEDLRPVREGELALLVRALRDR  164

Query  475  AGKTP-VKLGQLLNVCTTNALTRVMLGRKVFNDGGSKSDPKAEEFKSM  615
            AG    V LG+  N C TNAL R M+GR+VF +   + D KA EF++M
Sbjct  165  AGANELVDLGRAANKCATNALARAMVGRRVFQE---EEDEKAAEFENM  209



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090