BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS054C04

Length=440
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011074396.1|  PREDICTED: polyadenylate-binding protein 8-like    158   3e-42   Sesamum indicum [beniseed]
ref|XP_011074395.1|  PREDICTED: polyadenylate-binding protein 8-like    158   3e-42   Sesamum indicum [beniseed]
ref|XP_009775186.1|  PREDICTED: polyadenylate-binding protein 2-like    155   2e-41   Nicotiana sylvestris
ref|XP_009782956.1|  PREDICTED: polyadenylate-binding protein 2-l...    155   3e-41   Nicotiana sylvestris
ref|XP_009782955.1|  PREDICTED: polyadenylate-binding protein 2-l...    155   3e-41   Nicotiana sylvestris
gb|AAF66825.1|  poly(A)-binding protein                                 153   4e-41   Nicotiana tabacum [American tobacco]
dbj|BAM15222.1|  poly(A)-binding protein                                154   8e-41   Nicotiana tabacum [American tobacco]
ref|XP_009606598.1|  PREDICTED: polyadenylate-binding protein 2-l...    154   9e-41   Nicotiana tomentosiformis
ref|XP_009606599.1|  PREDICTED: polyadenylate-binding protein 2-l...    154   9e-41   Nicotiana tomentosiformis
emb|CAJ38367.1|  polyA-binding protein                                  149   2e-40   Plantago major [cart-track plant]
ref|XP_004252758.1|  PREDICTED: polyadenylate-binding protein 2-like    153   2e-40   Solanum lycopersicum
ref|XP_006342637.1|  PREDICTED: polyadenylate-binding protein 8-like    152   2e-40   
gb|EPS62510.1|  hypothetical protein M569_12280                         140   5e-36   Genlisea aurea
gb|ADE76290.1|  unknown                                                 136   8e-36   Picea sitchensis
ref|XP_009613515.1|  PREDICTED: polyadenylate-binding protein 2-like    139   2e-35   Nicotiana tomentosiformis
gb|AAK30205.1|AF349964_1  poly(A)-binding protein                       138   5e-35   Daucus carota [carrots]
gb|KHN12798.1|  Polyadenylate-binding protein 2                         138   5e-35   Glycine soja [wild soybean]
ref|XP_003550332.1|  PREDICTED: polyadenylate-binding protein 8-like    138   5e-35   Glycine max [soybeans]
ref|XP_002283105.1|  PREDICTED: polyadenylate-binding protein 2         138   6e-35   Vitis vinifera
ref|XP_007160868.1|  hypothetical protein PHAVU_001G023500g             137   7e-35   Phaseolus vulgaris [French bean]
ref|XP_003544466.1|  PREDICTED: polyadenylate-binding protein 8-like    137   8e-35   Glycine max [soybeans]
ref|XP_010270536.1|  PREDICTED: polyadenylate-binding protein 2-l...    137   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_009386708.1|  PREDICTED: polyadenylate-binding protein 2-l...    137   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386707.1|  PREDICTED: polyadenylate-binding protein 2-l...    137   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386706.1|  PREDICTED: polyadenylate-binding protein 2-l...    137   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010270544.1|  PREDICTED: polyadenylate-binding protein 2-l...    136   2e-34   Nelumbo nucifera [Indian lotus]
ref|XP_009386705.1|  PREDICTED: polyadenylate-binding protein 2-l...    137   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK34295.1|  unknown                                                 126   3e-34   Medicago truncatula
ref|XP_003589160.1|  Polyadenylate-binding protein                      134   1e-33   Medicago truncatula
gb|EPS61401.1|  hypothetical protein M569_13396                         133   1e-33   Genlisea aurea
gb|AAF66824.1|AF190656_1  poly(A)-binding protein                       130   1e-33   Nicotiana tabacum [American tobacco]
gb|KDO84108.1|  hypothetical protein CISIN_1g006282mg                   132   2e-33   Citrus sinensis [apfelsine]
gb|EMT14398.1|  Polyadenylate-binding protein 2                         132   3e-33   
gb|KDO84110.1|  hypothetical protein CISIN_1g006282mg                   132   3e-33   Citrus sinensis [apfelsine]
gb|EPS71660.1|  hypothetical protein M569_03099                         125   3e-33   Genlisea aurea
gb|KDO84109.1|  hypothetical protein CISIN_1g006282mg                   132   3e-33   Citrus sinensis [apfelsine]
gb|EMS55649.1|  Polyadenylate-binding protein 2                         132   4e-33   Triticum urartu
gb|AAB38974.1|  poly(A)-binding protein                                 132   4e-33   Triticum aestivum [Canadian hard winter wheat]
gb|KHN05826.1|  Polyadenylate-binding protein 2                         132   5e-33   Glycine soja [wild soybean]
ref|XP_006574897.1|  PREDICTED: polyadenylate-binding protein 8-like    132   5e-33   Glycine max [soybeans]
gb|EEE68458.1|  hypothetical protein OsJ_26852                          127   5e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83349.1|  hypothetical protein OsI_28748                          127   5e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_006434727.1|  hypothetical protein CICLE_v10000537mg             132   6e-33   Citrus clementina [clementine]
ref|XP_003529405.1|  PREDICTED: polyadenylate-binding protein 8-like    132   6e-33   Glycine max [soybeans]
ref|XP_006473293.1|  PREDICTED: polyadenylate-binding protein 8-like    132   6e-33   Citrus sinensis [apfelsine]
dbj|BAJ96406.1|  predicted protein                                      133   6e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAQ56324.1|  putative poly(A)-binding protein                        127   7e-33   Oryza sativa Japonica Group [Japonica rice]
gb|KDO84107.1|  hypothetical protein CISIN_1g006282mg                   132   7e-33   Citrus sinensis [apfelsine]
gb|AFP74112.1|  poly-A binding protein                                  132   7e-33   Nicotiana benthamiana
gb|KCW66377.1|  hypothetical protein EUGRSUZ_F00193                     130   9e-33   Eucalyptus grandis [rose gum]
gb|KJB29450.1|  hypothetical protein B456_005G101600                    131   1e-32   Gossypium raimondii
ref|XP_009600995.1|  PREDICTED: polyadenylate-binding protein 8-like    131   1e-32   Nicotiana tomentosiformis
gb|KCW66375.1|  hypothetical protein EUGRSUZ_F00193                     130   2e-32   Eucalyptus grandis [rose gum]
ref|XP_004230758.1|  PREDICTED: polyadenylate-binding protein 8-like    131   2e-32   Solanum lycopersicum
ref|XP_006346392.1|  PREDICTED: polyadenylate-binding protein 8-like    130   2e-32   Solanum tuberosum [potatoes]
ref|XP_010059905.1|  PREDICTED: polyadenylate-binding protein 2-like    131   2e-32   Eucalyptus grandis [rose gum]
gb|KHN22334.1|  Polyadenylate-binding protein 2                         130   2e-32   Glycine soja [wild soybean]
ref|XP_009395913.1|  PREDICTED: polyadenylate-binding protein 2-like    131   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009768210.1|  PREDICTED: polyadenylate-binding protein 8-like    130   2e-32   Nicotiana sylvestris
ref|XP_003525892.1|  PREDICTED: polyadenylate-binding protein 8-like    130   3e-32   Glycine max [soybeans]
dbj|BAJ53195.1|  JHL03K20.4                                             130   3e-32   Jatropha curcas
ref|XP_010093503.1|  Polyadenylate-binding protein 2                    130   4e-32   Morus notabilis
ref|NP_564554.1|  poly(A) binding protein 8                             129   6e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004956317.1|  PREDICTED: polyadenylate-binding protein 2-like    129   7e-32   Setaria italica
ref|XP_003576878.1|  PREDICTED: polyadenylate-binding protein 2-like    129   7e-32   Brachypodium distachyon [annual false brome]
ref|XP_004499044.1|  PREDICTED: polyadenylate-binding protein 2-l...    129   7e-32   Cicer arietinum [garbanzo]
ref|XP_008220252.1|  PREDICTED: polyadenylate-binding protein 2-like    129   8e-32   Prunus mume [ume]
ref|XP_007226962.1|  hypothetical protein PRUPE_ppa002618mg             129   8e-32   Prunus persica
ref|XP_009415843.1|  PREDICTED: polyadenylate-binding protein 2-like    129   9e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001061515.1|  Os08g0314800                                       129   1e-31   
gb|EMT11581.1|  Polyadenylate-binding protein 2                         122   2e-31   
gb|EYU36333.1|  hypothetical protein MIMGU_mgv1a002664mg                128   2e-31   Erythranthe guttata [common monkey flower]
gb|AAF63202.1|AF240679_1  poly(A)-binding protein                       128   2e-31   Cucumis sativus [cucumbers]
ref|XP_004136969.1|  PREDICTED: polyadenylate-binding protein 2-like    128   2e-31   
ref|XP_003603074.1|  Poly(A)-binding protein                            127   3e-31   Medicago truncatula
ref|XP_003573691.1|  PREDICTED: polyadenylate-binding protein 2-like    127   3e-31   Brachypodium distachyon [annual false brome]
ref|XP_008454965.1|  PREDICTED: polyadenylate-binding protein 2         127   4e-31   Cucumis melo [Oriental melon]
ref|XP_002891531.1|  PAB8 binding protein 8                             127   7e-31   Arabidopsis lyrata subsp. lyrata
gb|EYU36334.1|  hypothetical protein MIMGU_mgv1a002624mg                126   8e-31   Erythranthe guttata [common monkey flower]
gb|KHG12838.1|  ELAV-like protein 2                                     126   8e-31   Gossypium arboreum [tree cotton]
gb|KHN04485.1|  Polyadenylate-binding protein 2                         125   1e-30   Glycine soja [wild soybean]
gb|KJB79366.1|  hypothetical protein B456_013G046000                    126   1e-30   Gossypium raimondii
gb|KJB79363.1|  hypothetical protein B456_013G046000                    126   1e-30   Gossypium raimondii
ref|XP_003523956.1|  PREDICTED: polyadenylate-binding protein 8 i...    126   1e-30   Glycine max [soybeans]
ref|XP_006578034.1|  PREDICTED: polyadenylate-binding protein 8 i...    125   1e-30   Glycine max [soybeans]
ref|XP_006578033.1|  PREDICTED: polyadenylate-binding protein 8 i...    125   1e-30   Glycine max [soybeans]
ref|XP_010263472.1|  PREDICTED: polyadenylate-binding protein 2-like    126   1e-30   Nelumbo nucifera [Indian lotus]
ref|NP_001168063.1|  uncharacterized protein LOC100381794               119   1e-30   
ref|XP_006659302.1|  PREDICTED: polyadenylate-binding protein 8-like    125   2e-30   Oryza brachyantha
gb|KHG19377.1|  Polyadenylate-binding protein 1-like 2                  125   3e-30   Gossypium arboreum [tree cotton]
dbj|BAJ90169.1|  predicted protein                                      125   4e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97269.1|  predicted protein                                      124   4e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG25571.1|  Polyadenylate-binding protein 1-like 2                  124   4e-30   Gossypium arboreum [tree cotton]
ref|XP_006855143.1|  hypothetical protein AMTR_s00051p00026490          124   4e-30   Amborella trichopoda
ref|XP_004304018.1|  PREDICTED: polyadenylate-binding protein 8-like    124   4e-30   Fragaria vesca subsp. vesca
gb|KJB32340.1|  hypothetical protein B456_005G236500                    124   5e-30   Gossypium raimondii
gb|KJB40266.1|  hypothetical protein B456_007G054700                    123   7e-30   Gossypium raimondii
ref|XP_010530761.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    124   7e-30   Tarenaya hassleriana [spider flower]
tpg|DAA39543.1|  TPA: hypothetical protein ZEAMMB73_983793              119   8e-30   
ref|XP_010928350.1|  PREDICTED: polyadenylate-binding protein 8-l...    123   1e-29   Elaeis guineensis
ref|XP_010928349.1|  PREDICTED: polyadenylate-binding protein 2-l...    123   1e-29   Elaeis guineensis
ref|XP_010526963.1|  PREDICTED: polyadenylate-binding protein 2-like    122   2e-29   Tarenaya hassleriana [spider flower]
gb|KJB40263.1|  hypothetical protein B456_007G054700                    122   2e-29   Gossypium raimondii
gb|KJB40264.1|  hypothetical protein B456_007G054700                    122   2e-29   Gossypium raimondii
ref|XP_010906557.1|  PREDICTED: polyadenylate-binding protein 8-l...    121   2e-29   
emb|CDX71223.1|  BnaC07g05020D                                          122   3e-29   
ref|XP_006422975.1|  hypothetical protein CICLE_v10027999mg             122   3e-29   Citrus clementina [clementine]
emb|CDP01307.1|  unnamed protein product                                122   4e-29   Coffea canephora [robusta coffee]
ref|XP_008788846.1|  PREDICTED: polyadenylate-binding protein 2-like    122   4e-29   Phoenix dactylifera
gb|AAB61594.1|  poly(A)-binding protein                                 115   5e-29   Mesembryanthemum crystallinum
ref|XP_010906556.1|  PREDICTED: polyadenylate-binding protein 2-l...    121   5e-29   Elaeis guineensis
tpg|DAA39541.1|  TPA: hypothetical protein ZEAMMB73_983793              121   5e-29   
tpg|DAA39542.1|  TPA: hypothetical protein ZEAMMB73_983793              121   5e-29   
ref|XP_010688794.1|  PREDICTED: polyadenylate-binding protein 2-like    121   6e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008347611.1|  PREDICTED: polyadenylate-binding protein 8-like    116   6e-29   
ref|XP_006404818.1|  hypothetical protein EUTSA_v10000075mg             121   8e-29   Eutrema salsugineum [saltwater cress]
emb|CBI19489.3|  unnamed protein product                                120   9e-29   Vitis vinifera
ref|XP_008795896.1|  PREDICTED: polyadenylate-binding protein 2-like    120   1e-28   Phoenix dactylifera
ref|XP_002284923.1|  PREDICTED: polyadenylate-binding protein 8 i...    120   1e-28   Vitis vinifera
gb|KFK40021.1|  hypothetical protein AALP_AA3G319900                    120   1e-28   Arabis alpina [alpine rockcress]
emb|CDX79295.1|  BnaC06g20080D                                          112   2e-28   
ref|XP_006409548.1|  hypothetical protein EUTSA_v10022589mg             120   2e-28   Eutrema salsugineum [saltwater cress]
emb|CDY36634.1|  BnaA07g04230D                                          119   3e-28   Brassica napus [oilseed rape]
ref|XP_009147891.1|  PREDICTED: polyadenylate-binding protein 8         119   3e-28   Brassica rapa
emb|CDY54068.1|  BnaCnng26160D                                          119   3e-28   Brassica napus [oilseed rape]
gb|KFK35979.1|  hypothetical protein AALP_AA4G062600                    119   4e-28   Arabis alpina [alpine rockcress]
ref|XP_008378021.1|  PREDICTED: polyadenylate-binding protein 2-like    119   4e-28   
ref|XP_006421219.1|  hypothetical protein CICLE_v10007158mg             117   4e-28   
dbj|BAD94406.1|  putative poly(A) binding protein                       112   5e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002301171.2|  hypothetical protein POPTR_0002s12570g             119   5e-28   Populus trichocarpa [western balsam poplar]
ref|NP_001167831.1|  uncharacterized protein LOC100381531               114   6e-28   
ref|XP_008393785.1|  PREDICTED: polyadenylate-binding protein 2-like    118   6e-28   
ref|XP_009398670.1|  PREDICTED: polyadenylate-binding protein 2-like    118   6e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009359888.1|  PREDICTED: polyadenylate-binding protein 2-like    118   6e-28   Pyrus x bretschneideri [bai li]
gb|EEE61291.1|  hypothetical protein OsJ_15377                          117   9e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011029544.1|  PREDICTED: polyadenylate-binding protein 2-like    118   9e-28   Populus euphratica
ref|XP_006393217.1|  hypothetical protein EUTSA_v10011289mg             118   9e-28   Eutrema salsugineum [saltwater cress]
pdb|2DYD|A  Chain A, Solution Structure Of The Pabc Domain From T...    109   1e-27   Triticum aestivum [Canadian hard winter wheat]
emb|CAE02947.3|  OSJNBa0014K14.19                                       117   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053248.1|  Os04g0504800                                       117   2e-27   
ref|XP_007017178.1|  Poly(A) binding protein 8 isoform 1                117   2e-27   
gb|EEC77593.1|  hypothetical protein OsI_16552                          117   2e-27   Oryza sativa Indica Group [Indian rice]
emb|CBI19492.3|  unnamed protein product                                110   2e-27   Vitis vinifera
ref|XP_008651618.1|  PREDICTED: uncharacterized protein LOC100381...    117   2e-27   
ref|XP_008456143.1|  PREDICTED: polyadenylate-binding protein 8-l...    116   2e-27   Cucumis melo [Oriental melon]
ref|XP_002518733.1|  polyadenylate-binding protein, putative            117   2e-27   Ricinus communis
emb|CDX89562.1|  BnaC04g35810D                                          117   2e-27   
ref|XP_009408013.1|  PREDICTED: polyadenylate-binding protein 2-like    117   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB63886.1|  hypothetical protein B456_010G021800                    116   2e-27   Gossypium raimondii
ref|XP_004161443.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    116   2e-27   
gb|KJB63885.1|  hypothetical protein B456_010G021800                    116   2e-27   Gossypium raimondii
emb|CDO97198.1|  unnamed protein product                                117   3e-27   Coffea canephora [robusta coffee]
gb|KFK32750.1|  poly binding protein                                    116   3e-27   Arabis alpina [alpine rockcress]
ref|XP_009119410.1|  PREDICTED: polyadenylate-binding protein 2         116   3e-27   Brassica rapa
emb|CDO97200.1|  unnamed protein product                                116   3e-27   Coffea canephora [robusta coffee]
ref|XP_006374904.1|  hypothetical protein POPTR_0014s02550g             116   3e-27   Populus trichocarpa [western balsam poplar]
dbj|BAJ86310.1|  predicted protein                                      117   3e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007047341.1|  Poly(A) binding protein 8                          116   4e-27   
ref|XP_011017176.1|  PREDICTED: polyadenylate-binding protein 8-like    116   4e-27   Populus euphratica
ref|XP_004140705.1|  PREDICTED: polyadenylate-binding protein 2-like    116   4e-27   Cucumis sativus [cucumbers]
ref|XP_008456142.1|  PREDICTED: polyadenylate-binding protein 2-l...    116   4e-27   Cucumis melo [Oriental melon]
gb|EMT03423.1|  Polyadenylate-binding protein 2                         115   4e-27   
gb|ABK94932.1|  unknown                                                 114   5e-27   Populus trichocarpa [western balsam poplar]
emb|CDY08990.1|  BnaC01g31010D                                          107   5e-27   Brassica napus [oilseed rape]
ref|XP_010519297.1|  PREDICTED: polyadenylate-binding protein 8-like    115   5e-27   Tarenaya hassleriana [spider flower]
ref|XP_006295403.1|  hypothetical protein CARUB_v10024499mg             115   6e-27   Capsella rubella
ref|XP_010107907.1|  Polyadenylate-binding protein 2                    115   7e-27   Morus notabilis
emb|CDX89664.1|  BnaC03g45780D                                          115   7e-27   
ref|XP_010555994.1|  PREDICTED: polyadenylate-binding protein 8         115   8e-27   Tarenaya hassleriana [spider flower]
ref|XP_010417088.1|  PREDICTED: polyadenylate-binding protein 4-like    115   8e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010432464.1|  PREDICTED: polyadenylate-binding protein 2-like    115   8e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010447142.1|  PREDICTED: polyadenylate-binding protein 2-like    115   9e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006425948.1|  hypothetical protein CICLE_v10025109mg             115   9e-27   Citrus clementina [clementine]
ref|XP_010437669.1|  PREDICTED: polyadenylate-binding protein 2-like    115   9e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006425947.1|  hypothetical protein CICLE_v10025109mg             115   1e-26   
ref|XP_010432462.1|  PREDICTED: polyadenylate-binding protein 2-l...    115   1e-26   Camelina sativa [gold-of-pleasure]
gb|KDO79129.1|  hypothetical protein CISIN_1g006290mg                   115   1e-26   Citrus sinensis [apfelsine]
ref|XP_006842170.1|  hypothetical protein AMTR_s00078p00149860          115   1e-26   
ref|NP_001275799.1|  poly A-binding protein 2                           115   1e-26   Citrus sinensis [apfelsine]
ref|NP_179916.1|  poly(A) binding protein 4                             115   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006494495.1|  PREDICTED: polyadenylate-binding protein 4         115   1e-26   
dbj|BAJ53194.1|  JHL03K20.3                                             115   1e-26   Jatropha curcas
gb|AAK25927.1|AF360217_1  putative poly(A) binding protein              115   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412276.1|  hypothetical protein EUTSA_v10024683mg             114   1e-26   
ref|XP_002878680.1|  PAB4 binding protein 4                             114   1e-26   Arabidopsis lyrata subsp. lyrata
ref|XP_006412275.1|  hypothetical protein EUTSA_v10024683mg             114   1e-26   Eutrema salsugineum [saltwater cress]
ref|XP_010110808.1|  Polyadenylate-binding protein 2                    114   1e-26   Morus notabilis
gb|EMS47633.1|  Polyadenylate-binding protein 2                         114   2e-26   Triticum urartu
ref|XP_002313862.1|  polyadenylate-binding family protein               114   2e-26   
ref|XP_006283328.1|  hypothetical protein CARUB_v10004368mg             114   2e-26   Capsella rubella
ref|XP_011092554.1|  PREDICTED: polyadenylate-binding protein 2-like    114   2e-26   Sesamum indicum [beniseed]
ref|XP_010447143.1|  PREDICTED: polyadenylate-binding protein 2         114   2e-26   Camelina sativa [gold-of-pleasure]
gb|KHG04776.1|  Polyadenylate-binding 2 -like protein                   114   3e-26   Gossypium arboreum [tree cotton]
ref|NP_001062583.1|  Os09g0115400                                       114   3e-26   
gb|KHG16756.1|  Polyadenylate-binding 2 -like protein                   112   3e-26   Gossypium arboreum [tree cotton]
ref|XP_010531254.1|  PREDICTED: polyadenylate-binding protein 4         113   4e-26   Tarenaya hassleriana [spider flower]
emb|CDY67364.1|  BnaA03g57630D                                          110   4e-26   Brassica napus [oilseed rape]
gb|KCW55175.1|  hypothetical protein EUGRSUZ_I01129                     111   5e-26   Eucalyptus grandis [rose gum]
ref|XP_002300227.1|  polyadenylate-binding family protein               113   5e-26   Populus trichocarpa [western balsam poplar]
ref|XP_002510185.1|  polyadenylate-binding protein, putative            113   5e-26   Ricinus communis
ref|XP_009136273.1|  PREDICTED: polyadenylate-binding protein 2-l...    112   5e-26   Brassica rapa
ref|XP_009136272.1|  PREDICTED: polyadenylate-binding protein 2-l...    112   5e-26   Brassica rapa
ref|XP_011000130.1|  PREDICTED: polyadenylate-binding protein 8-like    113   6e-26   Populus euphratica
ref|XP_007042478.1|  Poly(A) binding protein 8                          113   6e-26   
gb|AID60122.1|  poly(A) binding protein 8                               112   7e-26   Brassica napus [oilseed rape]
emb|CDX75397.1|  BnaA01g03050D                                          112   7e-26   
ref|XP_002869174.1|  predicted protein                                  112   7e-26   
ref|XP_006661030.1|  PREDICTED: polyadenylate-binding protein 8-like    112   9e-26   
ref|XP_003580095.1|  PREDICTED: polyadenylate-binding protein 2-like    112   9e-26   Brachypodium distachyon [annual false brome]
ref|XP_010028424.1|  PREDICTED: polyadenylate-binding protein 2         112   1e-25   Eucalyptus grandis [rose gum]
ref|XP_008364810.1|  PREDICTED: polyadenylate-binding protein 8-like    112   1e-25   
emb|CDY62723.1|  BnaC03g77220D                                          112   1e-25   Brassica napus [oilseed rape]
ref|XP_010691731.1|  PREDICTED: polyadenylate-binding protein 2-like    112   1e-25   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY51957.1|  BnaA08g11610D                                          111   1e-25   Brassica napus [oilseed rape]
ref|XP_003607922.1|  Poly(A)-binding protein                            112   1e-25   Medicago truncatula
ref|XP_009108756.1|  PREDICTED: polyadenylate-binding protein 2         111   1e-25   Brassica rapa
ref|XP_010429282.1|  PREDICTED: polyadenylate-binding protein 4         111   2e-25   Camelina sativa [gold-of-pleasure]
emb|CDX69025.1|  BnaC01g04280D                                          111   3e-25   
ref|XP_010261307.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    111   3e-25   
ref|XP_002448132.1|  hypothetical protein SORBIDRAFT_06g021850          110   4e-25   Sorghum bicolor [broomcorn]
gb|AFW58788.1|  hypothetical protein ZEAMMB73_448418                    105   4e-25   
dbj|BAD94856.1|  poly(A)-binding protein                                103   5e-25   Arabidopsis thaliana [mouse-ear cress]
gb|EYU37653.1|  hypothetical protein MIMGU_mgv1a002809mg                110   5e-25   Erythranthe guttata [common monkey flower]
ref|XP_011092553.1|  PREDICTED: polyadenylate-binding protein 2-like    110   6e-25   Sesamum indicum [beniseed]
ref|XP_009117148.1|  PREDICTED: polyadenylate-binding protein 2         110   6e-25   Brassica rapa
gb|KDP31970.1|  hypothetical protein JCGZ_12431                         110   7e-25   Jatropha curcas
ref|XP_004291087.1|  PREDICTED: polyadenylate-binding protein 2-like    109   8e-25   Fragaria vesca subsp. vesca
ref|NP_001151785.1|  LOC100285420                                       109   1e-24   Zea mays [maize]
gb|KFK30042.1|  hypothetical protein AALP_AA7G209600                    108   2e-24   Arabis alpina [alpine rockcress]
gb|KJB58541.1|  hypothetical protein B456_009G214100                    108   3e-24   Gossypium raimondii
emb|CDY38939.1|  BnaA04g13600D                                          108   3e-24   Brassica napus [oilseed rape]
ref|XP_009140459.1|  PREDICTED: polyadenylate-binding protein 4-like    108   3e-24   Brassica rapa
ref|XP_008663371.1|  PREDICTED: polyadenylate-binding protein 2-like    107   6e-24   
ref|XP_002285190.1|  PREDICTED: polyadenylate-binding protein 2         107   7e-24   Vitis vinifera
emb|CBI32381.3|  unnamed protein product                                107   1e-23   Vitis vinifera
ref|XP_002307526.2|  hypothetical protein POPTR_0005s22040g             106   1e-23   
ref|XP_001761821.1|  predicted protein                                  100   1e-23   
ref|XP_002863435.1|  predicted protein                                  103   1e-23   
ref|XP_011000826.1|  PREDICTED: polyadenylate-binding protein 8-like    106   1e-23   Populus euphratica
ref|XP_002987288.1|  hypothetical protein SELMODRAFT_269256             105   2e-23   Selaginella moellendorffii
gb|EYU42687.1|  hypothetical protein MIMGU_mgv1a002746mg                105   2e-23   Erythranthe guttata [common monkey flower]
ref|XP_007201196.1|  hypothetical protein PRUPE_ppa002584mg             105   3e-23   Prunus persica
ref|XP_008236485.1|  PREDICTED: polyadenylate-binding protein 8         105   4e-23   Prunus mume [ume]
ref|XP_007201197.1|  hypothetical protein PRUPE_ppa002607mg             105   4e-23   Prunus persica
ref|XP_010527159.1|  PREDICTED: polyadenylate-binding protein 4-like    105   4e-23   Tarenaya hassleriana [spider flower]
ref|XP_007153579.1|  hypothetical protein PHAVU_003G0475001g            104   5e-23   Phaseolus vulgaris [French bean]
ref|XP_002883899.1|  hypothetical protein ARALYDRAFT_899764             104   5e-23   Arabidopsis lyrata subsp. lyrata
gb|KJB14629.1|  hypothetical protein B456_002G134900                    104   6e-23   Gossypium raimondii
gb|AAL86321.1|  putative poly(A)-binding protein                        104   6e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KJB14633.1|  hypothetical protein B456_002G134900                    104   7e-23   Gossypium raimondii
ref|XP_008237538.1|  PREDICTED: polyadenylate-binding protein 3-like    104   7e-23   
gb|KHG04753.1|  Polyadenylate-binding 2 -like protein                   103   7e-23   Gossypium arboreum [tree cotton]
ref|NP_195137.5|  polyadenylate-binding protein 2                       104   7e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010089427.1|  Polyadenylate-binding protein 3                    104   8e-23   
gb|AAT08650.1|  poly(A)-binding protein                               97.4    1e-22   Hyacinthus orientalis [common hyacinth]
ref|XP_008337230.1|  PREDICTED: polyadenylate-binding protein 3-like    103   2e-22   
ref|XP_011459765.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    103   2e-22   Fragaria vesca subsp. vesca
ref|XP_008787484.1|  PREDICTED: polyadenylate-binding protein 2-like    103   2e-22   
ref|XP_001770548.1|  predicted protein                                  102   3e-22   
ref|XP_001779388.1|  predicted protein                                  101   7e-22   
emb|CAN75447.1|  hypothetical protein VITISV_030926                     101   8e-22   Vitis vinifera
ref|XP_011044832.1|  PREDICTED: polyadenylate-binding protein 3-like    101   8e-22   Populus euphratica
ref|XP_010645822.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    101   1e-21   
emb|CBI29360.3|  unnamed protein product                                100   1e-21   Vitis vinifera
ref|XP_009335160.1|  PREDICTED: polyadenylate-binding protein 3         100   1e-21   
ref|XP_008373847.1|  PREDICTED: polyadenylate-binding protein 8-like    100   2e-21   
gb|KJB14632.1|  hypothetical protein B456_002G134900                    100   2e-21   Gossypium raimondii
ref|XP_002960874.1|  hypothetical protein SELMODRAFT_21095            99.4    4e-21   
gb|EYU24331.1|  hypothetical protein MIMGU_mgv1a025142mg              98.6    7e-21   Erythranthe guttata [common monkey flower]
ref|XP_009608720.1|  PREDICTED: polyadenylate-binding protein 3       98.6    8e-21   Nicotiana tomentosiformis
ref|XP_001780529.1|  predicted protein                                98.2    9e-21   
ref|XP_002974435.1|  hypothetical protein SELMODRAFT_101161           97.4    2e-20   
ref|XP_002985732.1|  hypothetical protein SELMODRAFT_122762           97.4    2e-20   
ref|XP_008456718.1|  PREDICTED: polyadenylate-binding protein 3       96.7    4e-20   Cucumis melo [Oriental melon]
ref|XP_008793488.1|  PREDICTED: polyadenylate-binding protein 3       96.7    4e-20   Phoenix dactylifera
ref|XP_009342699.1|  PREDICTED: polyadenylate-binding protein 3       96.3    5e-20   Pyrus x bretschneideri [bai li]
gb|ABC47858.1|  poly(A)-binding protein                               89.0    6e-20   Glycine max [soybeans]
ref|XP_007140277.1|  hypothetical protein PHAVU_008G098700g           95.9    6e-20   Phaseolus vulgaris [French bean]
ref|XP_009402160.1|  PREDICTED: polyadenylate-binding protein 5-like  95.9    7e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011042916.1|  PREDICTED: polyadenylate-binding protein 3-like  95.1    1e-19   
ref|XP_009786468.1|  PREDICTED: polyadenylate-binding protein 3-l...  95.1    1e-19   
ref|XP_002527095.1|  polyadenylate-binding protein, putative          95.1    1e-19   
ref|XP_011026320.1|  PREDICTED: polyadenylate-binding protein 3       95.1    1e-19   
ref|XP_009786467.1|  PREDICTED: polyadenylate-binding protein 3-l...  95.1    1e-19   
ref|XP_010540373.1|  PREDICTED: polyadenylate-binding protein 2-like  94.7    2e-19   
emb|CDX92325.1|  BnaA05g20820D                                        92.0    2e-19   
ref|XP_004496416.1|  PREDICTED: polyadenylate-binding protein 3-l...  94.4    3e-19   
ref|XP_004496415.1|  PREDICTED: polyadenylate-binding protein 3-l...  94.4    3e-19   
ref|XP_006359024.1|  PREDICTED: polyadenylate-binding protein 3-like  94.4    3e-19   
gb|KEH43623.1|  polyadenylate-binding protein                         93.6    5e-19   
ref|XP_002300896.1|  Polyadenylate-binding protein 5                  93.6    5e-19   
gb|AAK51123.1|  polyadenylated mRNA-binding protein 2                 92.4    6e-19   
ref|XP_010915083.1|  PREDICTED: polyadenylate-binding protein 3       93.2    6e-19   
ref|XP_004253267.1|  PREDICTED: polyadenylate-binding protein 3 i...  93.2    7e-19   
ref|XP_010314905.1|  PREDICTED: polyadenylate-binding protein 3 i...  93.2    7e-19   
emb|CAN82615.1|  hypothetical protein VITISV_036127                   86.3    9e-19   
ref|XP_004978120.1|  PREDICTED: polyadenylate-binding protein 2-like  92.8    1e-18   
ref|XP_011100720.1|  PREDICTED: polyadenylate-binding protein 3       92.4    1e-18   
emb|CDY67921.1|  BnaC08g49200D                                        91.7    2e-18   
ref|XP_007019672.1|  Polyadenylate-binding protein 3-binding prot...  91.3    3e-18   
ref|XP_009117286.1|  PREDICTED: polyadenylate-binding protein 4-like  90.9    3e-18   
emb|CDY46079.1|  BnaA09g42030D                                        90.9    4e-18   
ref|XP_006434548.1|  hypothetical protein CICLE_v10003530mg           90.9    4e-18   
gb|KDO83840.1|  hypothetical protein CISIN_1g006641mg                 90.9    4e-18   
ref|XP_006473877.1|  PREDICTED: polyadenylate-binding protein 3-like  90.9    4e-18   
emb|CAA81127.1|  poly(A)-mRNA binding protein                         89.4    1e-17   
gb|KJB66300.1|  hypothetical protein B456_010G134400                  88.2    3e-17   
ref|XP_007011217.1|  Poly(A) binding 8-like protein                   84.3    4e-17   
gb|AFG69765.1|  hypothetical protein CL4424Contig1_01                 81.6    5e-17   
ref|XP_010681423.1|  PREDICTED: polyadenylate-binding protein 5       87.4    7e-17   
ref|XP_003556172.1|  PREDICTED: polyadenylate-binding protein 3-l...  86.3    1e-16   
gb|AFX97758.1|  poly(A)-binding protein                               79.7    2e-16   
gb|AEW09165.1|  hypothetical protein CL4424Contig1_01                 80.1    2e-16   
ref|XP_010415886.1|  PREDICTED: polyadenylate-binding protein 5-like  85.9    3e-16   
ref|XP_006406512.1|  hypothetical protein EUTSA_v10020750mg           84.3    3e-16   
ref|XP_002888846.1|  hypothetical protein ARALYDRAFT_339396           85.5    3e-16   
ref|XP_007143593.1|  hypothetical protein PHAVU_007G084800g           85.1    3e-16   
ref|XP_010471184.1|  PREDICTED: polyadenylate-binding protein 5 i...  85.1    4e-16   
ref|XP_010471183.1|  PREDICTED: polyadenylate-binding protein 5 i...  85.1    4e-16   
emb|CAN78155.1|  hypothetical protein VITISV_032623                   84.7    5e-16   
ref|XP_006406511.1|  hypothetical protein EUTSA_v10021822mg           79.3    5e-16   
ref|XP_006406509.1|  hypothetical protein EUTSA_v10021769mg           79.7    5e-16   
ref|XP_010925352.1|  PREDICTED: polyadenylate-binding protein 2-like  84.7    6e-16   
gb|KDP36031.1|  hypothetical protein JCGZ_09997                       84.7    6e-16   
ref|XP_010428010.1|  PREDICTED: polyadenylate-binding protein 5-l...  84.3    7e-16   
ref|XP_010428009.1|  PREDICTED: polyadenylate-binding protein 5-l...  84.3    7e-16   
emb|CDY37229.1|  BnaA09g08500D                                        81.3    7e-16   
emb|CEF98830.1|  Polyadenylate-binding protein/Hyperplastic disc ...  84.0    9e-16   
gb|AGF69179.1|  polyadenylate-binding protein 2-like protein          83.2    1e-15   
ref|XP_010549244.1|  PREDICTED: polyadenylate-binding protein 8-l...  80.9    4e-15   
ref|XP_010549245.1|  PREDICTED: polyadenylate-binding protein 8-l...  80.9    4e-15   
ref|XP_010549241.1|  PREDICTED: polyadenylate-binding protein 8-l...  80.9    6e-15   
gb|KHN32825.1|  Polyadenylate-binding protein 2                       80.9    1e-14   
ref|XP_006599461.1|  PREDICTED: polyadenylate-binding protein 3-like  80.5    1e-14   
ref|XP_001418998.1|  predicted protein                                79.7    2e-14   
ref|XP_007513597.1|  predicted protein                                80.1    2e-14   
ref|XP_006390745.1|  hypothetical protein EUTSA_v10018219mg           79.7    3e-14   
ref|XP_010462849.1|  PREDICTED: polyadenylate-binding protein 3-like  76.6    4e-14   
ref|XP_004140947.1|  PREDICTED: polyadenylate-binding protein 3-like  79.3    4e-14   
gb|KFK44367.1|  hypothetical protein AALP_AA1G248100                  79.3    4e-14   
ref|XP_004159436.1|  PREDICTED: polyadenylate-binding protein 3-like  79.3    4e-14   
gb|KGN46101.1|  hypothetical protein Csa_6G052760                     79.3    4e-14   
gb|AAN15424.1|  Strong similarity to poly(A)-binding protein (PABP5)  77.8    5e-14   
ref|XP_003055549.1|  predicted protein                                78.6    6e-14   
emb|CDX91689.1|  BnaC08g06080D                                        76.3    7e-14   
gb|AAG02117.1|AF293840_1  poly(A) binding protein                     78.2    9e-14   
ref|XP_010477542.1|  PREDICTED: polyadenylate-binding protein 3       78.2    9e-14   
ref|NP_173690.1|  polyadenylate-binding protein 3                     78.2    9e-14   
gb|AAC25510.1|  Strong similarity to gb|M97657 poly(A)-binding pr...  78.2    9e-14   
ref|XP_010498759.1|  PREDICTED: polyadenylate-binding protein 3-l...  78.2    9e-14   
ref|XP_010460042.1|  PREDICTED: polyadenylate-binding protein 3-like  78.2    1e-13   
ref|XP_006304937.1|  hypothetical protein CARUB_v10011423mg           78.2    1e-13   
emb|CDY37935.1|  BnaC02g20760D                                        78.2    1e-13   
ref|XP_002890531.1|  PAB3 binding protein 3                           78.2    1e-13   
gb|EPS71718.1|  hypothetical protein M569_03039                       77.8    1e-13   
ref|NP_177322.2|  polyadenylate-binding protein 5                     77.8    1e-13   
gb|AAF43230.1|AC012654_14  Identical to the polyadenylate-binding...  77.8    1e-13   
emb|CAN61506.1|  hypothetical protein VITISV_011738                   77.0    1e-13   
gb|EYU42686.1|  hypothetical protein MIMGU_mgv1a023047mg              77.4    2e-13   
emb|CDY41472.1|  BnaA08g20740D                                        77.4    2e-13   
ref|XP_009110128.1|  PREDICTED: polyadenylate-binding protein 3       77.0    2e-13   
emb|CDY36684.1|  BnaCnng07860D                                        77.0    2e-13   
ref|XP_010521107.1|  PREDICTED: polyadenylate-binding protein 3 i...  76.6    3e-13   
ref|XP_010521108.1|  PREDICTED: polyadenylate-binding protein 3 i...  76.6    3e-13   
ref|XP_004292808.1|  PREDICTED: NAC domain-containing protein 66-...  74.7    3e-13   
ref|XP_009104896.1|  PREDICTED: polyadenylate-binding protein 5-like  76.6    4e-13   
emb|CDX68303.1|  BnaA07g23430D                                        76.3    4e-13   
emb|CDX96344.1|  BnaA07g29550D                                        75.9    5e-13   
ref|XP_009105835.1|  PREDICTED: polyadenylate-binding protein 5       75.9    5e-13   
emb|CDX72826.1|  BnaC06g32740D                                        75.9    5e-13   
gb|KFK41598.1|  hypothetical protein AALP_AA2G149300                  75.9    6e-13   
gb|EEE65951.1|  hypothetical protein OsJ_21832                        75.9    6e-13   
gb|EAZ01506.1|  hypothetical protein OsI_23538                        75.9    6e-13   
ref|NP_001057963.1|  Os06g0589700                                     74.7    7e-13   
gb|AAA32832.1|  poly(A)-binding protein                               75.5    7e-13   
dbj|BAD32907.1|  putative polyadenylate-binding protein               75.5    8e-13   
gb|AGT16777.1|  hypothetical protein SHCRBa_152_D05_F_250             73.9    3e-12   
ref|XP_003519971.2|  PREDICTED: polyadenylate-binding protein 3-like  73.6    4e-12   
emb|CDY03685.1|  BnaA02g15520D                                        73.6    4e-12   
pdb|2X04|A  Chain A, Crystal Structure Of The Pabc-Tnrc6c Complex     68.2    4e-12   
pdb|3KUS|A  Chain A, Crystal Structure Of The Mlle Domain Of Poly...  68.6    4e-12   
pdb|3KUR|A  Chain A, Crystal Structure Of The Mlle Domain Of Poly...  68.2    4e-12   
pdb|1JGN|A  Chain A, Solution Structure Of The C-Terminal Pabc Do...  68.6    5e-12   
pdb|3PTH|A  Chain A, The Pabc1 Mlle Domain Bound To The Variant P...  68.2    5e-12   
gb|EJK57169.1|  hypothetical protein THAOC_22818                      69.7    5e-12   
ref|XP_004266769.1|  PREDICTED: polyadenylate-binding protein 4-like  68.9    5e-12   
pdb|2RQG|B  Chain B, Structure Of Gspt1ERF3A-Pabc                     68.2    5e-12   
ref|XP_002438617.1|  hypothetical protein SORBIDRAFT_10g022900        73.2    5e-12   
ref|XP_002503581.1|  predicted protein                                72.8    5e-12   
gb|EAX07261.1|  poly(A) binding protein, cytoplasmic 4 (inducible...  68.9    6e-12   
ref|XP_002294914.1|  polyadenlyte binding protein                     72.8    7e-12   
ref|XP_007164842.1|  PREDICTED: polyadenylate-binding protein 4-like  68.9    9e-12   
ref|XP_006788161.1|  PREDICTED: polyadenylate-binding protein 1-like  68.2    9e-12   
gb|ABQ22585.1|  polyadenylate-binding protein 4-like protein          68.6    1e-11   
ref|NP_001005062.1|  embryonic polyadenylate-binding protein          72.0    1e-11   
ref|XP_008946692.1|  PREDICTED: polyadenylate-binding protein 1       68.6    1e-11   
dbj|BAC56450.1|  similar to poly(A)-binding protein 1                 68.2    1e-11   
pdb|1G9L|A  Chain A, Solution Structure Of The Pabc Domain Of Hum...  68.2    1e-11   
ref|XP_006301512.1|  hypothetical protein CARUB_v10021938mg           72.0    1e-11   
gb|EPB83095.1|  hypothetical protein HMPREF1544_10184                 71.6    1e-11   
gb|EPY78475.1|  Polyadenylate-binding protein 4 isoform 11-like p...  72.0    2e-11   
ref|XP_006745961.1|  PREDICTED: polyadenylate-binding protein 1-like  69.3    2e-11   
gb|KGG51518.1|  hypothetical protein DI09_32p30                       71.6    2e-11   
ref|XP_002883174.1|  predicted protein                                67.4    2e-11   
emb|CDX82300.1|  BnaA03g35210D                                        67.0    2e-11   
dbj|BAK62140.1|  polyadenylate-binding protein 4                      68.9    2e-11   
dbj|BAE36770.1|  unnamed protein product                              68.6    2e-11   
ref|XP_009041134.1|  hypothetical protein AURANDRAFT_70409            70.9    2e-11   
gb|ADX97143.1|  polyadenylate-binding protein 1                       68.6    2e-11   
gb|AEM37675.1|  molicular identification of Poly A binding protein    67.8    3e-11   
gb|EJK49989.1|  hypothetical protein THAOC_31088                      70.9    3e-11   
gb|ABB92431.1|  PABP3                                                 70.9    3e-11   
dbj|BAE35896.1|  unnamed protein product                              68.2    3e-11   
ref|XP_002824146.2|  PREDICTED: polyadenylate-binding protein 3       70.9    3e-11   
ref|XP_008538220.1|  PREDICTED: polyadenylate-binding protein 4       66.6    3e-11   
ref|XP_005907837.1|  PREDICTED: polyadenylate-binding protein 4-like  68.6    3e-11   
ref|XP_007527156.1|  PREDICTED: polyadenylate-binding protein 4 i...  70.9    3e-11   
ref|XP_007527155.1|  PREDICTED: polyadenylate-binding protein 4 i...  70.9    3e-11   
gb|ABB92428.1|  PABP3                                                 70.9    3e-11   
ref|XP_005084444.1|  PREDICTED: polyadenylate-binding protein 4       70.1    3e-11   
gb|AAZ38995.1|  polyA binding protein                                 68.9    3e-11   
gb|AGT16204.1|  poly(A)-binding protein                               66.6    3e-11   
ref|XP_010787592.1|  PREDICTED: polyadenylate-binding protein 1       68.2    4e-11   
ref|XP_011101467.1|  PREDICTED: polyadenylate-binding protein 7-like  70.5    4e-11   
gb|EGV92576.1|  Polyadenylate-binding protein 4                       65.9    4e-11   
gb|AEG78330.1|  poly A binding protein, cytoplasmic 1 b               67.8    4e-11   
ref|XP_010624186.1|  PREDICTED: polyadenylate-binding protein 4 i...  70.1    4e-11   
gb|EDL75007.1|  rCG64099                                              68.6    4e-11   
ref|XP_009789806.1|  PREDICTED: polyadenylate-binding protein 7-like  70.1    4e-11   
ref|XP_005031213.1|  PREDICTED: polyadenylate-binding protein 4-like  65.5    5e-11   
gb|EGV98598.1|  Polyadenylate-binding protein 1                       66.6    5e-11   
ref|XP_005704169.1|  poly(A) binding / translation initiation factor  70.1    5e-11   
ref|XP_003765434.1|  PREDICTED: polyadenylate-binding protein 4       70.1    5e-11   
dbj|BAE22747.1|  unnamed protein product                              70.1    5e-11   
ref|XP_001365269.1|  PREDICTED: polyadenylate-binding protein 4       70.1    5e-11   
ref|XP_011094453.1|  PREDICTED: polyadenylate-binding protein 7       70.1    6e-11   
ref|XP_010855455.1|  PREDICTED: polyadenylate-binding protein 1       65.9    6e-11   
gb|ELK19486.1|  Polyadenylate-binding protein 4                       70.1    6e-11   
ref|XP_004450673.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    6e-11   
dbj|BAD92199.1|  PABPC4 protein variant                               68.9    6e-11   
ref|XP_010332911.1|  PREDICTED: polyadenylate-binding protein 3 i...  69.7    6e-11   
ref|XP_009045956.1|  hypothetical protein LOTGIDRAFT_137449           69.7    6e-11   
ref|XP_011238800.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    6e-11   
dbj|BAD96637.1|  PABPC4 protein variant                               68.9    6e-11   
ref|XP_004450667.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    6e-11   
ref|XP_004450668.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_004450666.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_009928681.1|  PREDICTED: polyadenylate-binding protein 1 i...  69.7    7e-11   
ref|XP_008834426.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
gb|AAH88337.1|  Pabpc4 protein                                        68.9    7e-11   
ref|XP_009674261.1|  PREDICTED: polyadenylate-binding protein 1       69.7    7e-11   
ref|XP_008692580.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_005395304.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_008834424.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_010593542.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_008966619.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_010593543.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_004266463.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|NP_001129126.1|  polyadenylate-binding protein 4 isoform 3        69.7    7e-11   
ref|XP_008564081.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_004450675.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.3    7e-11   
ref|XP_010624185.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_008756722.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  69.7    7e-11   
ref|XP_006238863.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_005868705.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_004906347.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
gb|EOA96058.1|  Polyadenylate-binding protein 1                       69.7    7e-11   
ref|XP_004266461.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_003127861.2|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_005140133.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_011215430.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_008692579.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_003989937.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_004402674.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_004266462.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_003273360.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_008628904.1|  PREDICTED: polyadenylate-binding protein 1       69.7    7e-11   
ref|XP_005027092.1|  PREDICTED: polyadenylate-binding protein 1       69.7    7e-11   
gb|KFV81862.1|  Polyadenylate-binding protein 1                       69.7    7e-11   
gb|KFQ29370.1|  Polyadenylate-binding protein 1                       69.7    7e-11   
gb|EHH49800.1|  hypothetical protein EGM_00521                        69.7    7e-11   
ref|XP_011215431.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_009203794.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_006188094.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_006099180.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_005317914.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_010004756.1|  PREDICTED: polyadenylate-binding protein 1       69.7    7e-11   
ref|XP_006188093.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_005665309.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_003415568.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_006992307.1|  PREDICTED: polyadenylate-binding protein 4       69.7    7e-11   
gb|EMC90664.1|  Polyadenylate-binding protein 1                       69.7    7e-11   
ref|XP_008263745.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_004740764.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_004371966.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_003937075.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_008564083.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_857000.1|  PREDICTED: polyadenylate-binding protein 4 isof...  69.7    7e-11   
ref|XP_003989936.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   
ref|XP_011215429.1|  PREDICTED: polyadenylate-binding protein 4 i...  69.7    7e-11   



>ref|XP_011074396.1| PREDICTED: polyadenylate-binding protein 8-like [Sesamum indicum]
Length=654

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITALASALANA PEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES
Sbjct  556  PMPITALASALANATPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  615

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA++V RNVQQA SPADQLASLSLNDNLV+
Sbjct  616  PEALKAKVAEAMDVLRNVQQANSPADQLASLSLNDNLVS  654



>ref|XP_011074395.1| PREDICTED: polyadenylate-binding protein 8-like [Sesamum indicum]
Length=654

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITALASALANA PEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES
Sbjct  556  PMPITALASALANATPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  615

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA++V RNVQQA SPADQLASLSLNDNLV+
Sbjct  616  PEALKAKVAEAMDVLRNVQQANSPADQLASLSLNDNLVS  654



>ref|XP_009775186.1| PREDICTED: polyadenylate-binding protein 2-like [Nicotiana sylvestris]
Length=662

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI+ LASALANAPPEQQRTMLGE+LYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES
Sbjct  564  PMPISTLASALANAPPEQQRTMLGESLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  623

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            PEALKAKV EA+EV +NVQQA SPADQLASLSLNDNLV+
Sbjct  624  PEALKAKVNEAMEVLKNVQQANSPADQLASLSLNDNLVS  662



>ref|XP_009782956.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Nicotiana 
sylvestris]
Length=658

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI+ LASALANAPPEQQRTMLGE+LYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES
Sbjct  560  PMPISTLASALANAPPEQQRTMLGESLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  619

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNVQQ  SPADQLASLSLNDNLV+
Sbjct  620  PEALKAKVAEAMEVLRNVQQTASPADQLASLSLNDNLVS  658



>ref|XP_009782955.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Nicotiana 
sylvestris]
Length=661

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI+ LASALANAPPEQQRTMLGE+LYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES
Sbjct  563  PMPISTLASALANAPPEQQRTMLGESLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  622

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNVQQ  SPADQLASLSLNDNLV+
Sbjct  623  PEALKAKVAEAMEVLRNVQQTASPADQLASLSLNDNLVS  661



>gb|AAF66825.1| poly(A)-binding protein [Nicotiana tabacum]
Length=479

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI+ LASALANAPPEQQRTMLGE+LYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES
Sbjct  381  PMPISTLASALANAPPEQQRTMLGESLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  440

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNVQQ  +PADQLASLSLNDNLV+
Sbjct  441  PEALKAKVAEAMEVLRNVQQTTNPADQLASLSLNDNLVS  479



>dbj|BAM15222.1| poly(A)-binding protein [Nicotiana tabacum]
Length=657

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI+ LASALANAPPEQQRTMLGE+LYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES
Sbjct  559  PMPISTLASALANAPPEQQRTMLGESLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  618

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNVQQ  +PADQLASLSLNDNLV+
Sbjct  619  PEALKAKVAEAMEVLRNVQQTTNPADQLASLSLNDNLVS  657



>ref|XP_009606598.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=660

 Score =   154 bits (388),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI+ LASALANAPPEQQRTMLGE+LYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES
Sbjct  562  PMPISTLASALANAPPEQQRTMLGESLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  621

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNVQQ  +PADQLASLSLNDNLV+
Sbjct  622  PEALKAKVAEAMEVLRNVQQTANPADQLASLSLNDNLVS  660



>ref|XP_009606599.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=657

 Score =   154 bits (388),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI+ LASALANAPPEQQRTMLGE+LYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES
Sbjct  559  PMPISTLASALANAPPEQQRTMLGESLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  618

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNVQQ  +PADQLASLSLNDNLV+
Sbjct  619  PEALKAKVAEAMEVLRNVQQTANPADQLASLSLNDNLVS  657



>emb|CAJ38367.1| polyA-binding protein [Plantago major]
Length=314

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+P+TALASALANA PEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES
Sbjct  214  PMPVTALASALANATPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  273

Query  252  PealkakvaealevXRNVQQA--KSPADQLASLSLNDNLVA  136
            P+ALK+KV EA+EV RNVQQ    SPADQLASLSLNDNLV+
Sbjct  274  PDALKSKVNEAMEVLRNVQQQGNNSPADQLASLSLNDNLVS  314



>ref|XP_004252758.1| PREDICTED: polyadenylate-binding protein 2-like [Solanum lycopersicum]
Length=666

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 96/100 (96%), Gaps = 1/100 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI+ LA+ALANAPPEQQRTMLGE+LYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES
Sbjct  567  PVPISTLATALANAPPEQQRTMLGESLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  626

Query  252  PealkakvaealevXRNVQQA-KSPADQLASLSLNDNLVA  136
            PEALKAKV+EA++V RNVQQA  SPADQLASLSLNDNLV+
Sbjct  627  PEALKAKVSEAMDVLRNVQQATSSPADQLASLSLNDNLVS  666



>ref|XP_006342637.1| PREDICTED: polyadenylate-binding protein 8-like [Solanum tuberosum]
Length=665

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 96/100 (96%), Gaps = 1/100 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI+ LA+ALANAPPEQQRTMLGE+LYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES
Sbjct  566  PVPISTLATALANAPPEQQRTMLGESLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  625

Query  252  PealkakvaealevXRNVQQA-KSPADQLASLSLNDNLVA  136
            PEALKAKV+EA++V RNVQQA  SPADQLASLSLNDNLV+
Sbjct  626  PEALKAKVSEAMDVLRNVQQATSSPADQLASLSLNDNLVS  665



>gb|EPS62510.1| hypothetical protein M569_12280, partial [Genlisea aurea]
Length=524

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 3/96 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITALASALANA  EQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES
Sbjct  432  PMPITALASALANATLEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  491

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLNDN  145
            P+ALKAKV EA++V RNVQQ   PADQLASLSLND+
Sbjct  492  PDALKAKVGEAMDVLRNVQQ---PADQLASLSLNDD  524



>gb|ADE76290.1| unknown [Picea sitchensis]
Length=313

 Score =   136 bits (343),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 94/100 (94%), Gaps = 1/100 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA PEQQRTMLGE+LYPLVDQLEH+HAAKVTGMLLEMDQTEVLHLLES
Sbjct  214  PIPIGALASALANATPEQQRTMLGESLYPLVDQLEHDHAAKVTGMLLEMDQTEVLHLLES  273

Query  252  PealkakvaealevXRNVQQAKS-PADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV QA++ PA+QLA+LSLN+ LV+
Sbjct  274  PEALKAKVAEAMEVLRNVTQAQANPAEQLAALSLNETLVS  313



>ref|XP_009613515.1| PREDICTED: polyadenylate-binding protein 2-like [Nicotiana tomentosiformis]
Length=663

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI+ALASALANAPPEQQRTMLGE+LYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES
Sbjct  565  PMPISALASALANAPPEQQRTMLGESLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  624

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            PEALKAKV EA+EV +NVQQA SPADQLASLSLNDNLV+
Sbjct  625  PEALKAKVNEAMEVLKNVQQANSPADQLASLSLNDNLVS  663



>gb|AAK30205.1|AF349964_1 poly(A)-binding protein [Daucus carota]
Length=658

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 91/99 (92%), Gaps = 1/99 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITALASALANAP +QQRTMLGENLYPLVDQLEH+HAAKVTGMLLEMDQTEVLHLLES
Sbjct  561  PMPITALASALANAPADQQRTMLGENLYPLVDQLEHDHAAKVTGMLLEMDQTEVLHLLES  620

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            P+ALKAKVAEA++V RNV Q  + ADQL  LSLN+NLV+
Sbjct  621  PDALKAKVAEAMDVLRNVSQP-NVADQLGGLSLNENLVS  658



>gb|KHN12798.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=654

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 1/100 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALA+ALANAPPEQQRTMLGE LYPLVDQLEH+ AAKVTGMLLEMDQ EVLHL+ES
Sbjct  555  PMPIQALATALANAPPEQQRTMLGEALYPLVDQLEHDSAAKVTGMLLEMDQPEVLHLIES  614

Query  252  PealkakvaealevXRNV-QQAKSPADQLASLSLNDNLVA  136
            P+ALKAKVAEA++V RNV QQ  +PADQLASLSLNDNLV+
Sbjct  615  PDALKAKVAEAMDVLRNVAQQQTNPADQLASLSLNDNLVS  654



>ref|XP_003550332.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
Length=654

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 1/100 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALA+ALANAPPEQQRTMLGE LYPLVDQLEH+ AAKVTGMLLEMDQ EVLHL+ES
Sbjct  555  PMPIQALATALANAPPEQQRTMLGEALYPLVDQLEHDSAAKVTGMLLEMDQPEVLHLIES  614

Query  252  PealkakvaealevXRNV-QQAKSPADQLASLSLNDNLVA  136
            P+ALKAKVAEA++V RNV QQ  +PADQLASLSLNDNLV+
Sbjct  615  PDALKAKVAEAMDVLRNVAQQQTNPADQLASLSLNDNLVS  654



>ref|XP_002283105.1| PREDICTED: polyadenylate-binding protein 2 [Vitis vinifera]
 emb|CBI21386.3| unnamed protein product [Vitis vinifera]
Length=654

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALA+ALANAPP+QQRT+LGENLYPLVDQLEHE AAKVTGMLLEMDQTEVLHLLES
Sbjct  554  PMPIGALATALANAPPDQQRTLLGENLYPLVDQLEHEMAAKVTGMLLEMDQTEVLHLLES  613

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV  QQA +P D++ASLSLND L +
Sbjct  614  PEALKAKVAEAMEVLRNVAQQQANNPTDRMASLSLNDTLTS  654



>ref|XP_007160868.1| hypothetical protein PHAVU_001G023500g [Phaseolus vulgaris]
 gb|ESW32862.1| hypothetical protein PHAVU_001G023500g [Phaseolus vulgaris]
Length=651

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 1/100 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALA+ALANAPPEQQRTMLGE LYPLVDQLEH+ AAKVTGMLLEMDQ EVLHL+ES
Sbjct  552  PMPIQALATALANAPPEQQRTMLGEALYPLVDQLEHDAAAKVTGMLLEMDQPEVLHLIES  611

Query  252  PealkakvaealevXRNV-QQAKSPADQLASLSLNDNLVA  136
            P+ALKAKVAEA++V RNV QQ  +PADQLASLSLNDNLV+
Sbjct  612  PDALKAKVAEAMDVLRNVAQQQTNPADQLASLSLNDNLVS  651



>ref|XP_003544466.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
 gb|KHN35693.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=652

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 1/100 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALA+ALANAPPEQQRTMLGE LYPLVDQLEH+ AAKVTGMLLEMDQ EVLHL+ES
Sbjct  553  PMPIQALATALANAPPEQQRTMLGEALYPLVDQLEHDAAAKVTGMLLEMDQPEVLHLIES  612

Query  252  PealkakvaealevXRNV-QQAKSPADQLASLSLNDNLVA  136
            P+ALKAKVAEA++V RNV QQ  +PADQLASLSLNDNLV+
Sbjct  613  PDALKAKVAEAMDVLRNVAQQQTNPADQLASLSLNDNLVS  652



>ref|XP_010270536.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Nelumbo 
nucifera]
Length=654

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 93/104 (89%), Gaps = 5/104 (5%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA PEQQRTMLGE+LYPLVDQLEHE AAKVTGMLLEMDQTEVLHLLES
Sbjct  551  PIPIGALASALANATPEQQRTMLGESLYPLVDQLEHEMAAKVTGMLLEMDQTEVLHLLES  610

Query  252  PealkakvaealevXRNV-----QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV     QQ+ SP DQLASLSLNDNLV+
Sbjct  611  PEALKAKVAEAMEVLRNVAQQQQQQSVSPTDQLASLSLNDNLVS  654



>ref|XP_009386708.1| PREDICTED: polyadenylate-binding protein 2-like isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=652

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 91/102 (89%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA PEQQR MLGENLYPLV+QLEH+HAAKVTGMLLEMDQTEVLHLLES
Sbjct  551  PIPIGALASALANATPEQQRMMLGENLYPLVEQLEHDHAAKVTGMLLEMDQTEVLHLLES  610

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            P+ALKAKVAEA+EV RNV    QA +P DQLA+LSLND LV+
Sbjct  611  PDALKAKVAEAMEVLRNVAQQHQANAPTDQLAALSLNDGLVS  652



>ref|XP_009386707.1| PREDICTED: polyadenylate-binding protein 2-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=653

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 91/102 (89%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA PEQQR MLGENLYPLV+QLEH+HAAKVTGMLLEMDQTEVLHLLES
Sbjct  552  PIPIGALASALANATPEQQRMMLGENLYPLVEQLEHDHAAKVTGMLLEMDQTEVLHLLES  611

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            P+ALKAKVAEA+EV RNV    QA +P DQLA+LSLND LV+
Sbjct  612  PDALKAKVAEAMEVLRNVAQQHQANAPTDQLAALSLNDGLVS  653



>ref|XP_009386706.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=657

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 91/102 (89%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA PEQQR MLGENLYPLV+QLEH+HAAKVTGMLLEMDQTEVLHLLES
Sbjct  556  PIPIGALASALANATPEQQRMMLGENLYPLVEQLEHDHAAKVTGMLLEMDQTEVLHLLES  615

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            P+ALKAKVAEA+EV RNV    QA +P DQLA+LSLND LV+
Sbjct  616  PDALKAKVAEAMEVLRNVAQQHQANAPTDQLAALSLNDGLVS  657



>ref|XP_010270544.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Nelumbo 
nucifera]
Length=648

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 93/104 (89%), Gaps = 5/104 (5%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA PEQQRTMLGE+LYPLVDQLEHE AAKVTGMLLEMDQTEVLHLLES
Sbjct  545  PIPIGALASALANATPEQQRTMLGESLYPLVDQLEHEMAAKVTGMLLEMDQTEVLHLLES  604

Query  252  PealkakvaealevXRNV-----QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV     QQ+ SP DQLASLSLNDNLV+
Sbjct  605  PEALKAKVAEAMEVLRNVAQQQQQQSVSPTDQLASLSLNDNLVS  648



>ref|XP_009386705.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=658

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 91/102 (89%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA PEQQR MLGENLYPLV+QLEH+HAAKVTGMLLEMDQTEVLHLLES
Sbjct  557  PIPIGALASALANATPEQQRMMLGENLYPLVEQLEHDHAAKVTGMLLEMDQTEVLHLLES  616

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            P+ALKAKVAEA+EV RNV    QA +P DQLA+LSLND LV+
Sbjct  617  PDALKAKVAEAMEVLRNVAQQHQANAPTDQLAALSLNDGLVS  658



>gb|AFK34295.1| unknown [Medicago truncatula]
Length=107

 Score =   126 bits (317),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 87/101 (86%), Gaps = 2/101 (2%)
 Frame = -3

Query  438  AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLL  259
            A   P+ ALA+ALANAPPEQQRTMLGE LYPLV+++EH  AAKVTGMLLEMDQ EVLHL+
Sbjct  5    AGGTPMQALATALANAPPEQQRTMLGEVLYPLVEKIEHAGAAKVTGMLLEMDQPEVLHLI  64

Query  258  ESPealkakvaealevXRNV--QQAKSPADQLASLSLNDNL  142
            ESPEALK KVAEA++V RNV  QQ+ SP DQLASLSLNDNL
Sbjct  65   ESPEALKTKVAEAVDVLRNVAQQQSNSPTDQLASLSLNDNL  105



>ref|XP_003589160.1| Polyadenylate-binding protein [Medicago truncatula]
 gb|AES59411.1| polyadenylate-binding protein [Medicago truncatula]
Length=647

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 89/98 (91%), Gaps = 2/98 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALA+ALANAPPEQQRTMLGE LYPLVDQLEH+ AAKVTGMLLEMDQ EVLHL+ES
Sbjct  550  PMPIHALATALANAPPEQQRTMLGEALYPLVDQLEHDSAAKVTGMLLEMDQPEVLHLIES  609

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDN  145
            P+ALKAKVAEA+EV RNV  QQ  SPADQLASLSLND+
Sbjct  610  PDALKAKVAEAMEVLRNVSQQQGNSPADQLASLSLNDS  647



>gb|EPS61401.1| hypothetical protein M569_13396, partial [Genlisea aurea]
Length=551

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITALASALAN+ PEQQRTMLGENLYPLVDQLEHEHAAK+TGMLLEMDQTEVLHLLES
Sbjct  463  PMPITALASALANSTPEQQRTMLGENLYPLVDQLEHEHAAKITGMLLEMDQTEVLHLLES  522

Query  252  PealkakvaealevXRNVQQAKSPADQLA  166
            PEALKAKV+EA++V RNV+ A S ADQLA
Sbjct  523  PEALKAKVSEAIDVLRNVEHANSAADQLA  551



>gb|AAF66824.1|AF190656_1 poly(A)-binding protein [Nicotiana tabacum]
Length=330

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 91/101 (90%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+P+ ALA+ALAN+ P +QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  230  PIPVGALATALANSSPTEQRTMLGENLYPLVEQLEPETAAKVTGMLLEMDQTEVLHLLES  289

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV  QQ+ +PADQLASLSLND LV+
Sbjct  290  PEALKAKVAEAMEVLRNVSQQQSSNPADQLASLSLNDGLVS  330



>gb|KDO84108.1| hypothetical protein CISIN_1g006282mg [Citrus sinensis]
Length=593

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITAL++ALANA PEQQRT+LGE+LYPLV+QLE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  493  PMPITALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLES  552

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R+V  QQA +PADQLASLSLN+NLV+
Sbjct  553  PEALKAKVAEAMEVLRSVAQQQANNPADQLASLSLNENLVS  593



>gb|EMT14398.1| Polyadenylate-binding protein 2 [Aegilops tauschii]
Length=573

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 89/101 (88%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALASALAN+PPE QR MLGENLYPLVDQLEH+ AAKVTGMLLEMDQTEVLHLLES
Sbjct  472  PVPIGALASALANSPPETQRMMLGENLYPLVDQLEHDQAAKVTGMLLEMDQTEVLHLLES  531

Query  252  PealkakvaealevXRNVQQ--AKSPADQLASLSLNDNLVA  136
            P+ALKAKVAEA+EV R+ QQ   +SP  QLASLSLND L++
Sbjct  532  PDALKAKVAEAMEVLRSAQQHTNQSPEQQLASLSLNDGLIS  572



>gb|KDO84110.1| hypothetical protein CISIN_1g006282mg [Citrus sinensis]
Length=472

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITAL++ALANA PEQQRT+LGE+LYPLV+QLE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  372  PMPITALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLES  431

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R+V  QQA +PADQLASLSLN+NLV+
Sbjct  432  PEALKAKVAEAMEVLRSVAQQQANNPADQLASLSLNENLVS  472



>gb|EPS71660.1| hypothetical protein M569_03099, partial [Genlisea aurea]
Length=150

 Score =   125 bits (314),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -3

Query  438  AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLL  259
            A PVPI ALASALANA P +QRT+LGE+LYPLV+Q+E E AAKVTGMLLEMDQTEVLHLL
Sbjct  54   AQPVPIGALASALANATPAEQRTLLGESLYPLVEQVEAEMAAKVTGMLLEMDQTEVLHLL  113

Query  258  ESPealkakvaealevXRNVQQAKSPADQLASLSLND  148
            ESPEALKAKVAEA++V RNV Q  +PADQLA+LSLND
Sbjct  114  ESPEALKAKVAEAMDVLRNVSQPPNPADQLAALSLND  150



>gb|KDO84109.1| hypothetical protein CISIN_1g006282mg [Citrus sinensis]
Length=575

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITAL++ALANA PEQQRT+LGE+LYPLV+QLE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  475  PMPITALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLES  534

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R+V  QQA +PADQLASLSLN+NLV+
Sbjct  535  PEALKAKVAEAMEVLRSVAQQQANNPADQLASLSLNENLVS  575



>gb|EMS55649.1| Polyadenylate-binding protein 2 [Triticum urartu]
Length=625

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 89/101 (88%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALASALAN+PPE QR MLGENLYPLVDQLEH+ AAKVTGMLLEMDQTEVLHLLES
Sbjct  524  PVPIGALASALANSPPETQRMMLGENLYPLVDQLEHDQAAKVTGMLLEMDQTEVLHLLES  583

Query  252  PealkakvaealevXRNVQQ--AKSPADQLASLSLNDNLVA  136
            P+ALKAKVAEA+EV R+ QQ   +SP  QLASLSLND L++
Sbjct  584  PDALKAKVAEAMEVLRSAQQHTNQSPEQQLASLSLNDGLIS  624



>gb|AAB38974.1| poly(A)-binding protein [Triticum aestivum]
Length=651

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 89/101 (88%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALASALAN+PPE QR MLGENLYPLVDQLEH+ AAKVTGMLLEMDQTEVLHLLES
Sbjct  550  PVPIGALASALANSPPETQRMMLGENLYPLVDQLEHDQAAKVTGMLLEMDQTEVLHLLES  609

Query  252  PealkakvaealevXRNVQQ--AKSPADQLASLSLNDNLVA  136
            P+ALKAKVAEA+EV R+ QQ   +SP  QLASLSLND L++
Sbjct  610  PDALKAKVAEAMEVLRSAQQHTNQSPEQQLASLSLNDGLIS  650



>gb|KHN05826.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=648

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 91/100 (91%), Gaps = 2/100 (2%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +P+ ALA+ALANA PEQQRTMLGENLYPLV+QLE ++AAKVTGMLLEMDQTEVLHLLESP
Sbjct  549  IPVGALATALANASPEQQRTMLGENLYPLVEQLEPDNAAKVTGMLLEMDQTEVLHLLESP  608

Query  249  ealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            EALKAKVAEA++V RNV  QQA   ADQLASLSLNDNLV+
Sbjct  609  EALKAKVAEAMDVLRNVAQQQAGGTADQLASLSLNDNLVS  648



>ref|XP_006574897.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
Length=648

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 91/100 (91%), Gaps = 2/100 (2%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +P+ ALA+ALANA PEQQRTMLGENLYPLV+QLE ++AAKVTGMLLEMDQTEVLHLLESP
Sbjct  549  IPVGALATALANASPEQQRTMLGENLYPLVEQLEPDNAAKVTGMLLEMDQTEVLHLLESP  608

Query  249  ealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            EALKAKVAEA++V RNV  QQA   ADQLASLSLNDNLV+
Sbjct  609  EALKAKVAEAMDVLRNVAQQQAGGTADQLASLSLNDNLVS  648



>gb|EEE68458.1| hypothetical protein OsJ_26852 [Oryza sativa Japonica Group]
Length=252

 Score =   127 bits (320),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI ALASALAN+PP+QQR MLGE+LYPLVDQLEH+ AAKVTGMLLEMDQTEVLHL+ESP
Sbjct  153  VPIGALASALANSPPDQQRLMLGESLYPLVDQLEHDQAAKVTGMLLEMDQTEVLHLIESP  212

Query  249  ealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            +ALKAKVAEA+EV RN   QQA +P DQLA+L+L+D +V+
Sbjct  213  DALKAKVAEAMEVLRNAQQQQANTPTDQLAALTLSDGVVS  252



>gb|EEC83349.1| hypothetical protein OsI_28748 [Oryza sativa Indica Group]
Length=252

 Score =   127 bits (320),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI ALASALAN+PP+QQR MLGE+LYPLVDQLEH+ AAKVTGMLLEMDQTEVLHL+ESP
Sbjct  153  VPIGALASALANSPPDQQRLMLGESLYPLVDQLEHDQAAKVTGMLLEMDQTEVLHLIESP  212

Query  249  ealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            +ALKAKVAEA+EV RN   QQA +P DQLA+L+L+D +V+
Sbjct  213  DALKAKVAEAMEVLRNAQQQQANTPTDQLAALTLSDGVVS  252



>ref|XP_006434727.1| hypothetical protein CICLE_v10000537mg [Citrus clementina]
 gb|ESR47967.1| hypothetical protein CICLE_v10000537mg [Citrus clementina]
Length=651

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITAL++ALANA PEQQRT+LGE+LYPLV+QLE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  551  PMPITALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLES  610

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R+V  QQA +PADQLASLSLN+NLV+
Sbjct  611  PEALKAKVAEAMEVLRSVAQQQANNPADQLASLSLNENLVS  651



>ref|XP_003529405.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
 gb|KHN43051.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=651

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 91/100 (91%), Gaps = 2/100 (2%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +P+ ALA+ALANA PEQQRTMLGENLYPLV+QLE ++AAKVTGMLLEMDQTEVLHLLESP
Sbjct  552  IPVGALATALANASPEQQRTMLGENLYPLVEQLEPDNAAKVTGMLLEMDQTEVLHLLESP  611

Query  249  ealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            EALKAKVAEA++V RNV  QQA   ADQLASLSLNDNLV+
Sbjct  612  EALKAKVAEAMDVLRNVAQQQAGGTADQLASLSLNDNLVS  651



>ref|XP_006473293.1| PREDICTED: polyadenylate-binding protein 8-like [Citrus sinensis]
Length=652

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITAL++ALANA PEQQRT+LGE+LYPLV+QLE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  552  PMPITALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLES  611

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R+V  QQA +PADQLASLSLN+NLV+
Sbjct  612  PEALKAKVAEAMEVLRSVAQQQANNPADQLASLSLNENLVS  652



>dbj|BAJ96406.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 89/101 (88%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALASALAN+PPE QR MLGENLYPLVDQLEH+ AAKVTGMLLEMDQTEVLHLLES
Sbjct  643  PVPIGALASALANSPPETQRMMLGENLYPLVDQLEHDQAAKVTGMLLEMDQTEVLHLLES  702

Query  252  PealkakvaealevXRNVQQ--AKSPADQLASLSLNDNLVA  136
            P+ALKAKVAEA+EV R+ QQ   +SP  QLASLSLND L++
Sbjct  703  PDALKAKVAEAMEVFRSAQQHTNQSPEQQLASLSLNDGLIS  743



>gb|AAQ56324.1| putative poly(A)-binding protein [Oryza sativa Japonica Group]
Length=266

 Score =   127 bits (320),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI ALASALAN+PP+QQR MLGE+LYPLVDQLEH+ AAKVTGMLLEMDQTEVLHL+ESP
Sbjct  167  VPIGALASALANSPPDQQRLMLGESLYPLVDQLEHDQAAKVTGMLLEMDQTEVLHLIESP  226

Query  249  ealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            +ALKAKVAEA+EV RN   QQA +P DQLA+L+L+D +V+
Sbjct  227  DALKAKVAEAMEVLRNAQQQQANTPTDQLAALTLSDGVVS  266



>gb|KDO84107.1| hypothetical protein CISIN_1g006282mg [Citrus sinensis]
Length=652

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITAL++ALANA PEQQRT+LGE+LYPLV+QLE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  552  PMPITALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLES  611

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R+V  QQA +PADQLASLSLN+NLV+
Sbjct  612  PEALKAKVAEAMEVLRSVAQQQANNPADQLASLSLNENLVS  652



>gb|AFP74112.1| poly-A binding protein, partial [Nicotiana benthamiana]
Length=643

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 91/101 (90%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+P+ ALA+ALANA P +QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  543  PIPVGALATALANASPTEQRTMLGENLYPLVEQLEPETAAKVTGMLLEMDQTEVLHLLES  602

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV  QQ+ +PADQLASLSLND LV+
Sbjct  603  PEALKAKVAEAMEVLRNVSQQQSSNPADQLASLSLNDGLVS  643



>gb|KCW66377.1| hypothetical protein EUGRSUZ_F00193 [Eucalyptus grandis]
Length=441

 Score =   130 bits (327),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 92/103 (89%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITALA+ALAN+ PEQQRT+LGE+LYPLVDQLEH++AAKVTGMLLEMDQTEVLHLLES
Sbjct  339  PLPITALATALANSSPEQQRTLLGESLYPLVDQLEHDNAAKVTGMLLEMDQTEVLHLLES  398

Query  252  PealkakvaealevXRNV----QQAKSPADQLASLSLNDNLVA  136
            P+ALKAKV EA++V R+     QQA +P DQLA LSL+DNLV+
Sbjct  399  PDALKAKVEEAMDVLRSSAPQQQQANNPVDQLAGLSLSDNLVS  441



>gb|KJB29450.1| hypothetical protein B456_005G101600 [Gossypium raimondii]
Length=648

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 94/102 (92%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+P+TALA++LANA PEQQRTMLGE+LYPLV++LE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  547  PIPVTALATSLANATPEQQRTMLGESLYPLVERLERDAAAKVTGMLLEMDQTEVLHLLES  606

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R+V   QQ+ +PADQL+SLSLNDNLV+
Sbjct  607  PEALKAKVAEAMEVLRSVAAQQQSNNPADQLSSLSLNDNLVS  648



>ref|XP_009600995.1| PREDICTED: polyadenylate-binding protein 8-like [Nicotiana tomentosiformis]
 gb|AAF66823.1|AF190655_1 poly(A)-binding protein [Nicotiana tabacum]
Length=649

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 91/101 (90%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+P+ ALA+ALAN+ P +QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  549  PIPVGALATALANSSPTEQRTMLGENLYPLVEQLEPETAAKVTGMLLEMDQTEVLHLLES  608

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV  QQ+ +PADQLASLSLND LV+
Sbjct  609  PEALKAKVAEAMEVLRNVSQQQSSNPADQLASLSLNDGLVS  649



>gb|KCW66375.1| hypothetical protein EUGRSUZ_F00193 [Eucalyptus grandis]
Length=627

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 92/103 (89%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITALA+ALAN+ PEQQRT+LGE+LYPLVDQLEH++AAKVTGMLLEMDQTEVLHLLES
Sbjct  525  PLPITALATALANSSPEQQRTLLGESLYPLVDQLEHDNAAKVTGMLLEMDQTEVLHLLES  584

Query  252  PealkakvaealevXRNV----QQAKSPADQLASLSLNDNLVA  136
            P+ALKAKV EA++V R+     QQA +P DQLA LSL+DNLV+
Sbjct  585  PDALKAKVEEAMDVLRSSAPQQQQANNPVDQLAGLSLSDNLVS  627



>ref|XP_004230758.1| PREDICTED: polyadenylate-binding protein 8-like [Solanum lycopersicum]
Length=643

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 91/103 (88%), Gaps = 2/103 (2%)
 Frame = -3

Query  438  AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLL  259
            A P+P+ ALA+ALANA P +QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLL
Sbjct  541  AQPIPVGALATALANASPTEQRTMLGENLYPLVEQLEPETAAKVTGMLLEMDQTEVLHLL  600

Query  258  ESPealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            ESPEALKAKVAEA++V RNV  QQA + ADQLASLSLND LV+
Sbjct  601  ESPEALKAKVAEAMDVLRNVPQQQASNAADQLASLSLNDGLVS  643



>ref|XP_006346392.1| PREDICTED: polyadenylate-binding protein 8-like [Solanum tuberosum]
Length=643

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 91/103 (88%), Gaps = 2/103 (2%)
 Frame = -3

Query  438  AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLL  259
            A P+P+ ALA+ALANA P +QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLL
Sbjct  541  AQPIPVGALATALANASPTEQRTMLGENLYPLVEQLEPETAAKVTGMLLEMDQTEVLHLL  600

Query  258  ESPealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            ESPEALKAKVAEA++V RNV  QQA + ADQLASLSLND LV+
Sbjct  601  ESPEALKAKVAEAMDVLRNVPQQQASNAADQLASLSLNDGLVS  643



>ref|XP_010059905.1| PREDICTED: polyadenylate-binding protein 2-like [Eucalyptus grandis]
 gb|KCW66374.1| hypothetical protein EUGRSUZ_F00193 [Eucalyptus grandis]
Length=657

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 92/103 (89%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITALA+ALAN+ PEQQRT+LGE+LYPLVDQLEH++AAKVTGMLLEMDQTEVLHLLES
Sbjct  555  PLPITALATALANSSPEQQRTLLGESLYPLVDQLEHDNAAKVTGMLLEMDQTEVLHLLES  614

Query  252  PealkakvaealevXRNV----QQAKSPADQLASLSLNDNLVA  136
            P+ALKAKV EA++V R+     QQA +P DQLA LSL+DNLV+
Sbjct  615  PDALKAKVEEAMDVLRSSAPQQQQANNPVDQLAGLSLSDNLVS  657



>gb|KHN22334.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=592

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 87/99 (88%), Gaps = 2/99 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+P  ALASALANA PEQQRTMLGE LYPLVD+LEHE AAKVTGMLLEMDQ EVLHL+ES
Sbjct  492  PMPTQALASALANATPEQQRTMLGEALYPLVDKLEHETAAKVTGMLLEMDQPEVLHLIES  551

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNL  142
            P+ALKAKV EA++V R V  QQ+ SPADQLASLSLNDN+
Sbjct  552  PDALKAKVVEAMDVLRKVTQQQSNSPADQLASLSLNDNV  590



>ref|XP_009395913.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 90/102 (88%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALAN+ PEQQR MLGE+LYPLV+QLE +HAAKVTGMLLEMDQTEVLHLLES
Sbjct  551  PIPIGALASALANSTPEQQRMMLGESLYPLVEQLERDHAAKVTGMLLEMDQTEVLHLLES  610

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            P+ALKAKVAEALEV R V   QQA  PADQLA+LSLND LV+
Sbjct  611  PDALKAKVAEALEVLRTVAQQQQANVPADQLAALSLNDGLVS  652



>ref|XP_009768210.1| PREDICTED: polyadenylate-binding protein 8-like [Nicotiana sylvestris]
Length=649

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 90/101 (89%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+P+ ALA+ALANA P +QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  549  PIPVGALATALANASPTEQRTMLGENLYPLVEQLEPETAAKVTGMLLEMDQTEVLHLLES  608

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV  QQ+ +P DQLASLSLND LV+
Sbjct  609  PEALKAKVAEAMEVLRNVSQQQSSNPTDQLASLSLNDGLVS  649



>ref|XP_003525892.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
Length=630

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 87/99 (88%), Gaps = 2/99 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+P  ALASALANA PEQQRTMLGE LYPLVD+LEHE AAKVTGMLLEMDQ EVLHL+ES
Sbjct  530  PMPTQALASALANATPEQQRTMLGEALYPLVDKLEHETAAKVTGMLLEMDQPEVLHLIES  589

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNL  142
            P+ALKAKV EA++V R V  QQ+ SPADQLASLSLNDN+
Sbjct  590  PDALKAKVVEAMDVLRKVTQQQSNSPADQLASLSLNDNV  628



>dbj|BAJ53195.1| JHL03K20.4 [Jatropha curcas]
Length=642

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 1/100 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PV   ALA+ALANA PEQQRT+LGENLYPLVDQLEHE+AAKVTGMLLEMDQTEVLHLLES
Sbjct  543  PVQTGALATALANAMPEQQRTLLGENLYPLVDQLEHENAAKVTGMLLEMDQTEVLHLLES  602

Query  252  PealkakvaealevXRNV-QQAKSPADQLASLSLNDNLVA  136
            PE+LKAKVAEA+EV R V QQ  SP D++A+LSLND+LV+
Sbjct  603  PESLKAKVAEAMEVLRTVQQQVNSPTDRMATLSLNDSLVS  642



>ref|XP_010093503.1| Polyadenylate-binding protein 2 [Morus notabilis]
 gb|EXB54169.1| Polyadenylate-binding protein 2 [Morus notabilis]
Length=647

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 91/103 (88%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+   ALAS+LANA P+QQRT+LGENLYPLVDQLEHE+AAKVTGMLLEMDQTEVLHLLES
Sbjct  545  PMSTGALASSLANATPDQQRTLLGENLYPLVDQLEHENAAKVTGMLLEMDQTEVLHLLES  604

Query  252  PealkakvaealevXRNVQ----QAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV     QA SP D++A+LSLNDN+V+
Sbjct  605  PEALKAKVAEAMEVLRNVAQQTPQANSPTDRMATLSLNDNIVS  647



>ref|NP_564554.1| poly(A) binding protein 8 [Arabidopsis thaliana]
 ref|NP_001185184.1| poly(A) binding protein 8 [Arabidopsis thaliana]
 sp|Q9FXA2.1|PABP8_ARATH RecName: Full=Polyadenylate-binding protein 8; Short=PABP-8; 
Short=Poly(A)-binding protein 8 [Arabidopsis thaliana]
 gb|AAG13056.1|AC011807_15 Putative Poly-A Binding Protein [Arabidopsis thaliana]
 gb|AAK43894.1|AF370517_1 Putative Poly-A Binding Protein [Arabidopsis thaliana]
 gb|AAL47336.1| putative Poly-A Binding Protein [Arabidopsis thaliana]
 gb|AEE32472.1| poly(A) binding protein 8 [Arabidopsis thaliana]
 gb|AEE32473.1| poly(A) binding protein 8 [Arabidopsis thaliana]
Length=671

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 2/100 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALA+ LANA PEQQRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  571  PVPIVALATRLANAAPEQQRTMLGENLYPLVEQLEPESAAKVTGMLLEMDQTEVLHLLES  630

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLV  139
            PEALKAKV EA++V R+V  QQA   ADQLASLSL DN+V
Sbjct  631  PEALKAKVTEAMDVLRSVAQQQAGGAADQLASLSLGDNIV  670



>ref|XP_004956317.1| PREDICTED: polyadenylate-binding protein 2-like [Setaria italica]
Length=664

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 89/103 (86%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALA+ALANAPP+QQR MLGENLYPLVDQLEHE AAKVTGMLLEMDQTEVLHLLES
Sbjct  561  PVPIGALATALANAPPDQQRLMLGENLYPLVDQLEHEQAAKVTGMLLEMDQTEVLHLLES  620

Query  252  PealkakvaealevXRNVQQAK----SPADQLASLSLNDNLVA  136
            P+ALKAKVAEA+EV R+ Q  +    SP  QLA+LSLND +V+
Sbjct  621  PDALKAKVAEAMEVLRSAQHLQQTNASPEQQLANLSLNDGVVS  663



>ref|XP_003576878.1| PREDICTED: polyadenylate-binding protein 2-like [Brachypodium 
distachyon]
Length=653

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 87/99 (88%), Gaps = 1/99 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALA+ALANAPP+QQR MLGENLYPLVDQLEH+ AAKVTGMLLEMDQTEVLHLLES
Sbjct  552  PVPIGALATALANAPPDQQRMMLGENLYPLVDQLEHDQAAKVTGMLLEMDQTEVLHLLES  611

Query  252  PealkakvaealevXRNVQQAK-SPADQLASLSLNDNLV  139
            P+ALKAKVAEA+EV R+ Q    SP  QLASLSLND+ V
Sbjct  612  PDALKAKVAEAMEVLRSAQHTNPSPEQQLASLSLNDHGV  650



>ref|XP_004499044.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004499045.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Cicer 
arietinum]
Length=648

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 89/99 (90%), Gaps = 2/99 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALA+ALANAP EQQRTMLGE LYPLVDQLEH+ AAKVTGMLLEMDQ EVLHL+ES
Sbjct  552  PMPIQALATALANAPSEQQRTMLGEALYPLVDQLEHDAAAKVTGMLLEMDQPEVLHLIES  611

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            P+ALKAKVAEA++V RNV  A+ PADQLA+LSLND LV+
Sbjct  612  PDALKAKVAEAMDVLRNV--AQQPADQLATLSLNDTLVS  648



>ref|XP_008220252.1| PREDICTED: polyadenylate-binding protein 2-like [Prunus mume]
Length=651

 Score =   129 bits (324),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 88/98 (90%), Gaps = 2/98 (2%)
 Frame = -3

Query  423  ITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPea  244
            + ALA+ALANA  EQQRTMLGE LYPLVDQLEHE AAKVTGMLLEMDQTEVLHLLESPEA
Sbjct  554  VPALATALANASTEQQRTMLGEALYPLVDQLEHESAAKVTGMLLEMDQTEVLHLLESPEA  613

Query  243  lkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            LKAKVAEA+EV RNV  QQA S ADQL+SLSLNDNLV+
Sbjct  614  LKAKVAEAMEVLRNVAQQQANSSADQLSSLSLNDNLVS  651



>ref|XP_007226962.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
 ref|XP_007226963.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
 gb|EMJ28161.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
 gb|EMJ28162.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
Length=651

 Score =   129 bits (324),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 88/98 (90%), Gaps = 2/98 (2%)
 Frame = -3

Query  423  ITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPea  244
            + ALA+ALANA  EQQRTMLGE LYPLVDQLEHE AAKVTGMLLEMDQTEVLHLLESPEA
Sbjct  554  VPALATALANASTEQQRTMLGEALYPLVDQLEHESAAKVTGMLLEMDQTEVLHLLESPEA  613

Query  243  lkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            LKAKVAEA+EV RNV  QQA S ADQL+SLSLNDNLV+
Sbjct  614  LKAKVAEAMEVLRNVAQQQANSSADQLSSLSLNDNLVS  651



>ref|XP_009415843.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=651

 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 87/101 (86%), Gaps = 4/101 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+P   LASALANA PEQQRTMLGE+LYPLVDQLEH+H+AKVTGMLLEMDQTEVLHLLES
Sbjct  548  PIPTGTLASALANANPEQQRTMLGESLYPLVDQLEHDHSAKVTGMLLEMDQTEVLHLLES  607

Query  252  PealkakvaealevXRNV----QQAKSPADQLASLSLNDNL  142
            PEALKAKVAEA+EV RN     Q   +PADQLA+LSLND L
Sbjct  608  PEALKAKVAEAMEVLRNASQQHQHVNAPADQLAALSLNDGL  648



>ref|NP_001061515.1| Os08g0314800 [Oryza sativa Japonica Group]
 dbj|BAC92404.1| putative polyadenylate-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAC92537.1| putative polyadenylate-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAF23429.1| Os08g0314800 [Oryza sativa Japonica Group]
 dbj|BAG89395.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAI39945.1| putative poly(A)-binding protein [Oryza sativa Indica Group]
Length=660

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI ALASALAN+PP+QQR MLGE+LYPLVDQLEH+ AAKVTGMLLEMDQTEVLHL+ESP
Sbjct  561  VPIGALASALANSPPDQQRLMLGESLYPLVDQLEHDQAAKVTGMLLEMDQTEVLHLIESP  620

Query  249  ealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            +ALKAKVAEA+EV RN   QQA +P DQLA+L+L+D +V+
Sbjct  621  DALKAKVAEAMEVLRNAQQQQANTPTDQLAALTLSDGVVS  660



>gb|EMT11581.1| Polyadenylate-binding protein 2 [Aegilops tauschii]
Length=195

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 86/96 (90%), Gaps = 2/96 (2%)
 Frame = -3

Query  417  ALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealk  238
            ALASAL N+PPEQQR MLGE+LYPLVDQLEH+ AAKVTGMLLEMDQTEVLHL+ESP+ALK
Sbjct  99   ALASALVNSPPEQQRLMLGESLYPLVDQLEHDQAAKVTGMLLEMDQTEVLHLIESPDALK  158

Query  237  akvaealevXRNVQQAKS--PADQLASLSLNDNLVA  136
            +KVAEA+EV R+ QQ ++  PADQLA+LSL+D  VA
Sbjct  159  SKVAEAMEVLRSAQQQQTNVPADQLAALSLSDGFVA  194



>gb|EYU36333.1| hypothetical protein MIMGU_mgv1a002664mg [Erythranthe guttata]
Length=649

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 94/100 (94%), Gaps = 1/100 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITALA+ALANA PEQQR MLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES
Sbjct  550  PMPITALATALANATPEQQRIMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  609

Query  252  PealkakvaealevXRNV-QQAKSPADQLASLSLNDNLVA  136
            P+ALKAKV EA++V +NV QQA SP+DQLASLSLN+NLV+
Sbjct  610  PDALKAKVNEAMDVLKNVQQQASSPSDQLASLSLNENLVS  649



>gb|AAF63202.1|AF240679_1 poly(A)-binding protein [Cucumis sativus]
Length=649

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 90/98 (92%), Gaps = 1/98 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVP+ ALASALANA P+QQRTMLGENLYPLV+QLE ++AAKVTGMLLEMDQTEVLHLLES
Sbjct  550  PVPVGALASALANATPDQQRTMLGENLYPLVEQLEPDNAAKVTGMLLEMDQTEVLHLLES  609

Query  252  PealkakvaealevXRNV-QQAKSPADQLASLSLNDNL  142
            PEALKAKVAEA+EV R+V QQ+ + ADQLASLSL DNL
Sbjct  610  PEALKAKVAEAMEVLRSVAQQSGNAADQLASLSLTDNL  647



>ref|XP_004136969.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
 ref|XP_004159899.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
 gb|KGN43917.1| hypothetical protein Csa_7G073530 [Cucumis sativus]
Length=649

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 90/98 (92%), Gaps = 1/98 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVP+ ALASALANA P+QQRTMLGENLYPLV+QLE ++AAKVTGMLLEMDQTEVLHLLES
Sbjct  550  PVPVGALASALANATPDQQRTMLGENLYPLVEQLEPDNAAKVTGMLLEMDQTEVLHLLES  609

Query  252  PealkakvaealevXRNV-QQAKSPADQLASLSLNDNL  142
            PEALKAKVAEA+EV R+V QQ+ + ADQLASLSL DNL
Sbjct  610  PEALKAKVAEAMEVLRSVAQQSGNAADQLASLSLTDNL  647



>ref|XP_003603074.1| Poly(A)-binding protein [Medicago truncatula]
 gb|AES73325.1| polyadenylate-binding protein [Medicago truncatula]
Length=622

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 87/101 (86%), Gaps = 2/101 (2%)
 Frame = -3

Query  438  AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLL  259
            A   P+ ALA+ALANAPPEQQRTMLGE LYPLV+++EH  AAKVTGMLLEMDQ EVLHL+
Sbjct  520  AGGTPMQALATALANAPPEQQRTMLGEVLYPLVEKIEHAGAAKVTGMLLEMDQPEVLHLI  579

Query  258  ESPealkakvaealevXRNV--QQAKSPADQLASLSLNDNL  142
            ESPEALK KVAEA++V RNV  QQ+ SP DQLASLSLNDNL
Sbjct  580  ESPEALKTKVAEAVDVLRNVAQQQSNSPTDQLASLSLNDNL  620



>ref|XP_003573691.1| PREDICTED: polyadenylate-binding protein 2-like [Brachypodium 
distachyon]
Length=663

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 87/99 (88%), Gaps = 1/99 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VP   LASALAN+PPEQQR MLGE+LYPLVDQLEH+ AAKVTGMLLEMDQTEVLHL+ESP
Sbjct  564  VPSGTLASALANSPPEQQRLMLGESLYPLVDQLEHDQAAKVTGMLLEMDQTEVLHLIESP  623

Query  249  ealkakvaealevXRNVQQAKS-PADQLASLSLNDNLVA  136
            +ALK+KVAEA++V R+ QQ  S PADQLA+LSL+D  VA
Sbjct  624  DALKSKVAEAMDVLRSAQQQTSAPADQLAALSLSDGFVA  662



>ref|XP_008454965.1| PREDICTED: polyadenylate-binding protein 2 [Cucumis melo]
Length=649

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 89/98 (91%), Gaps = 1/98 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVP+ ALASALANA P+QQRTMLGENLYPLV+QLE ++AAKVTGMLLEMDQTEVLHLLES
Sbjct  550  PVPVGALASALANATPDQQRTMLGENLYPLVEQLEPDNAAKVTGMLLEMDQTEVLHLLES  609

Query  252  PealkakvaealevXRNV-QQAKSPADQLASLSLNDNL  142
            PEALKAKVAEA+EV R+V QQ  + ADQLASLSL DNL
Sbjct  610  PEALKAKVAEAMEVLRSVAQQTGNAADQLASLSLTDNL  647



>ref|XP_002891531.1| PAB8 binding protein 8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67790.1| PAB8 binding protein 8 [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 86/99 (87%), Gaps = 2/99 (2%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI ALA+ LANA PEQQRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  570  VPIGALATQLANAAPEQQRTMLGENLYPLVEQLEPESAAKVTGMLLEMDQTEVLHLLESP  629

Query  249  ealkakvaealevXRNV--QQAKSPADQLASLSLNDNLV  139
            EALKAKV EA++V R+V  QQA   ADQLASLSL DN+V
Sbjct  630  EALKAKVTEAMDVLRSVAQQQAGGAADQLASLSLGDNIV  668



>gb|EYU36334.1| hypothetical protein MIMGU_mgv1a002624mg [Erythranthe guttata]
Length=653

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 92/100 (92%), Gaps = 1/100 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITALA+ALANA  +QQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES
Sbjct  554  PMPITALATALANATSDQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  613

Query  252  PealkakvaealevXRNV-QQAKSPADQLASLSLNDNLVA  136
            P+ALKAKV EA++V RNV QQA  PADQLASLSLND LV+
Sbjct  614  PDALKAKVNEAMDVLRNVQQQANGPADQLASLSLNDTLVS  653



>gb|KHG12838.1| ELAV-like protein 2 [Gossypium arboreum]
Length=648

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 89/103 (86%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA P+QQRTMLGENLYPLV+QLE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  546  PIPIGALASALANATPDQQRTMLGENLYPLVEQLEPDAAAKVTGMLLEMDQTEVLHLLES  605

Query  252  PealkakvaealevXRNV----QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R V    Q   + ADQLASLSL+DNLV+
Sbjct  606  PEALKAKVAEAMEVLRTVAQQQQTGGAAADQLASLSLSDNLVS  648



>gb|KHN04485.1| Polyadenylate-binding protein 2, partial [Glycine soja]
Length=606

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 2/98 (2%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +P  ALASALANA PEQQRTMLGE LYPLVD+LEHE AAKVTGMLLEMDQ EVLHL+ESP
Sbjct  507  MPTQALASALANATPEQQRTMLGEALYPLVDKLEHEAAAKVTGMLLEMDQPEVLHLIESP  566

Query  249  ealkakvaealevXRNV--QQAKSPADQLASLSLNDNL  142
            +ALKAKV EA++V + V  QQ+ SPADQLASLSLNDN+
Sbjct  567  DALKAKVVEAMDVLKKVTQQQSNSPADQLASLSLNDNV  604



>gb|KJB79366.1| hypothetical protein B456_013G046000 [Gossypium raimondii]
Length=649

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 89/103 (86%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA P+QQRTMLGENLYPLV+QLE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  547  PIPIGALASALANATPDQQRTMLGENLYPLVEQLEPDAAAKVTGMLLEMDQTEVLHLLES  606

Query  252  PealkakvaealevXRNV----QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R V    Q   + ADQLASLSL+DNLV+
Sbjct  607  PEALKAKVAEAMEVLRTVAQQQQTGGAAADQLASLSLSDNLVS  649



>gb|KJB79363.1| hypothetical protein B456_013G046000 [Gossypium raimondii]
Length=648

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 89/103 (86%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA P+QQRTMLGENLYPLV+QLE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  546  PIPIGALASALANATPDQQRTMLGENLYPLVEQLEPDAAAKVTGMLLEMDQTEVLHLLES  605

Query  252  PealkakvaealevXRNV----QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R V    Q   + ADQLASLSL+DNLV+
Sbjct  606  PEALKAKVAEAMEVLRTVAQQQQTGGAAADQLASLSLSDNLVS  648



>ref|XP_003523956.1| PREDICTED: polyadenylate-binding protein 8 isoform X1 [Glycine 
max]
 gb|ABC47841.1| poly(A)-binding protein [Glycine max]
Length=630

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 2/98 (2%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +P  ALASALANA PEQQRTMLGE LYPLVD+LEHE AAKVTGMLLEMDQ EVLHL+ESP
Sbjct  531  MPTQALASALANATPEQQRTMLGEALYPLVDKLEHEAAAKVTGMLLEMDQPEVLHLIESP  590

Query  249  ealkakvaealevXRNV--QQAKSPADQLASLSLNDNL  142
            +ALKAKV EA++V + V  QQ+ SPADQLASLSLNDN+
Sbjct  591  DALKAKVVEAMDVLKKVTQQQSNSPADQLASLSLNDNV  628



>ref|XP_006578034.1| PREDICTED: polyadenylate-binding protein 8 isoform X3 [Glycine 
max]
Length=623

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 2/98 (2%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +P  ALASALANA PEQQRTMLGE LYPLVD+LEHE AAKVTGMLLEMDQ EVLHL+ESP
Sbjct  524  MPTQALASALANATPEQQRTMLGEALYPLVDKLEHEAAAKVTGMLLEMDQPEVLHLIESP  583

Query  249  ealkakvaealevXRNV--QQAKSPADQLASLSLNDNL  142
            +ALKAKV EA++V + V  QQ+ SPADQLASLSLNDN+
Sbjct  584  DALKAKVVEAMDVLKKVTQQQSNSPADQLASLSLNDNV  621



>ref|XP_006578033.1| PREDICTED: polyadenylate-binding protein 8 isoform X2 [Glycine 
max]
Length=624

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 2/98 (2%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +P  ALASALANA PEQQRTMLGE LYPLVD+LEHE AAKVTGMLLEMDQ EVLHL+ESP
Sbjct  525  MPTQALASALANATPEQQRTMLGEALYPLVDKLEHEAAAKVTGMLLEMDQPEVLHLIESP  584

Query  249  ealkakvaealevXRNV--QQAKSPADQLASLSLNDNL  142
            +ALKAKV EA++V + V  QQ+ SPADQLASLSLNDN+
Sbjct  585  DALKAKVVEAMDVLKKVTQQQSNSPADQLASLSLNDNV  622



>ref|XP_010263472.1| PREDICTED: polyadenylate-binding protein 2-like [Nelumbo nucifera]
Length=653

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 93/102 (91%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALA+ALANA PEQQRTMLGE+LYPLVDQLEH+ AAKVTGMLLEMDQTEVLHLLES
Sbjct  552  PIPIGALATALANATPEQQRTMLGESLYPLVDQLEHDMAAKVTGMLLEMDQTEVLHLLES  611

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV   QQA SP DQLASLSLNDNLV+
Sbjct  612  PEALKAKVAEAMEVLRNVAQQQQANSPTDQLASLSLNDNLVS  653



>ref|NP_001168063.1| uncharacterized protein LOC100381794 [Zea mays]
 gb|ACN26977.1| unknown [Zea mays]
Length=183

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 87/103 (84%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALA+ALANAPP+QQR MLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  80   PVPIGALATALANAPPDQQRLMLGENLYPLVEQLEREQAAKVTGMLLEMDQTEVLHLLES  139

Query  252  PealkakvaealevXRNVQQAK----SPADQLASLSLNDNLVA  136
            P+ALKAKVAEA+EV R+ Q  +    S   QLA+LSLND +V+
Sbjct  140  PDALKAKVAEAMEVLRSAQHLQQSNVSTEQQLANLSLNDGVVS  182



>ref|XP_006659302.1| PREDICTED: polyadenylate-binding protein 8-like [Oryza brachyantha]
Length=659

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 90/101 (89%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALAN+PP+QQR MLGE+LYPLVDQLEH+ AAKVTGMLLEMDQTEVLHL+ES
Sbjct  559  PLPIGALASALANSPPDQQRLMLGESLYPLVDQLEHDQAAKVTGMLLEMDQTEVLHLIES  618

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            P+ALKAKVAEA+EV  N   QQA +P D+LA+L+L+D +V+
Sbjct  619  PDALKAKVAEAMEVLHNAQQQQANTPTDRLAALTLSDGVVS  659



>gb|KHG19377.1| Polyadenylate-binding protein 1-like 2 [Gossypium arboreum]
Length=647

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 91/105 (87%), Gaps = 4/105 (4%)
 Frame = -3

Query  438  AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLL  259
            A P+PI ALASALANA PEQQRTMLGENLYPLV+QLE + AAKVTGMLLEMDQTEVLHLL
Sbjct  543  AQPIPIGALASALANATPEQQRTMLGENLYPLVEQLEPDAAAKVTGMLLEMDQTEVLHLL  602

Query  258  ESPealkakvaealevXRNV----QQAKSPADQLASLSLNDNLVA  136
            ESPEALKAKVAEA+EV R V    QQA   ADQLASLSLNDNLV+
Sbjct  603  ESPEALKAKVAEAMEVLRTVAQQQQQAGGAADQLASLSLNDNLVS  647



>dbj|BAJ90169.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87575.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=663

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 88/100 (88%), Gaps = 2/100 (2%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            V   ALASALAN+PPEQQR MLGE+LYPLVDQLEH+ AAKVTGMLLEMDQTEVLHL+ESP
Sbjct  563  VSSGALASALANSPPEQQRLMLGESLYPLVDQLEHDQAAKVTGMLLEMDQTEVLHLIESP  622

Query  249  ealkakvaealevXRNVQQAKS--PADQLASLSLNDNLVA  136
            +ALK+KVAEA+EV R+ QQ ++  PADQLA+LSL+D  VA
Sbjct  623  DALKSKVAEAMEVLRSAQQQQTNVPADQLAALSLSDGFVA  662



>dbj|BAJ97269.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=663

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 88/100 (88%), Gaps = 2/100 (2%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            V   ALASALAN+PPEQQR MLGE+LYPLVDQLEH+ AAKVTGMLLEMDQTEVLHL+ESP
Sbjct  563  VSSGALASALANSPPEQQRLMLGESLYPLVDQLEHDQAAKVTGMLLEMDQTEVLHLIESP  622

Query  249  ealkakvaealevXRNVQQAKS--PADQLASLSLNDNLVA  136
            +ALK+KVAEA+EV R+ QQ ++  PADQLA+LSL+D  VA
Sbjct  623  DALKSKVAEAMEVLRSAQQQQTNVPADQLAALSLSDGFVA  662



>gb|KHG25571.1| Polyadenylate-binding protein 1-like 2 [Gossypium arboreum]
Length=653

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 89/103 (86%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+   ALASALANA P QQRT+LGENLYPLV QLEH++AAKVTGMLLEMDQTEVLHLLES
Sbjct  551  PMATGALASALANATPVQQRTLLGENLYPLVGQLEHDNAAKVTGMLLEMDQTEVLHLLES  610

Query  252  PealkakvaealevXRNV----QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RN+    QQA S  D+LASLSLN+NLV+
Sbjct  611  PEALKAKVAEAMEVLRNIGPKPQQANSATDRLASLSLNENLVS  653



>ref|XP_006855143.1| hypothetical protein AMTR_s00051p00026490 [Amborella trichopoda]
 gb|ERN16610.1| hypothetical protein AMTR_s00051p00026490 [Amborella trichopoda]
Length=654

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 93/104 (89%), Gaps = 5/104 (5%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA PEQQRTMLGE+LYPLVDQLEH+HAAKVTGMLLEMDQTEVLHLLES
Sbjct  551  PIPIGALASALANATPEQQRTMLGESLYPLVDQLEHDHAAKVTGMLLEMDQTEVLHLLES  610

Query  252  PealkakvaealevXRNV-----QQAKSPADQLASLSLNDNLVA  136
            P+ALKAKVAEA++V RNV     QQ  +PADQLA+LSLND LV+
Sbjct  611  PDALKAKVAEAMDVLRNVAQQQQQQGAAPADQLAALSLNDALVS  654



>ref|XP_004304018.1| PREDICTED: polyadenylate-binding protein 8-like [Fragaria vesca 
subsp. vesca]
Length=651

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 91/102 (89%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI  LASALANA PEQQRTMLGE+LYPLVDQLE ++AAKVTGMLLEMDQTEVLHLLES
Sbjct  550  PLPIGTLASALANATPEQQRTMLGESLYPLVDQLEPDNAAKVTGMLLEMDQTEVLHLLES  609

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV   QQA   ADQLAS+SLNDNLV+
Sbjct  610  PEALKAKVAEAMEVLRNVAQQQQAGGAADQLASMSLNDNLVS  651



>gb|KJB32340.1| hypothetical protein B456_005G236500 [Gossypium raimondii]
Length=647

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 90/103 (87%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA PEQQRTMLGENLYPLV+QLE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  545  PIPIGALASALANATPEQQRTMLGENLYPLVEQLEPDAAAKVTGMLLEMDQTEVLHLLES  604

Query  252  PealkakvaealevXRNV----QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R V    QQA   ADQLASLSLNDNLV+
Sbjct  605  PEALKAKVAEAMEVLRTVAQQQQQAGGAADQLASLSLNDNLVS  647



>gb|KJB40266.1| hypothetical protein B456_007G054700 [Gossypium raimondii]
Length=607

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 88/103 (85%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+   ALASALANA   QQRT+LGENLYPLVDQLEH++AAKVTGMLLEMDQTEVLHLLES
Sbjct  505  PMATGALASALANATTVQQRTLLGENLYPLVDQLEHDNAAKVTGMLLEMDQTEVLHLLES  564

Query  252  PealkakvaealevXRNV----QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RN+    QQA S  D+L SLSLN+NLV+
Sbjct  565  PEALKAKVAEAMEVLRNIGPKPQQANSATDRLTSLSLNENLVS  607



>ref|XP_010530761.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
2 [Tarenaya hassleriana]
Length=649

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 2/100 (2%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI ALASALANA PEQQRTMLGENLYPLV+++E E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  550  VPIGALASALANATPEQQRTMLGENLYPLVERVEGEAAAKVTGMLLEMDQTEVLHLLESP  609

Query  249  ealkakvaealevXRNVQQAKSPADQLASLSLND--NLVA  136
            EALKAKVAEA+ V R+V  +   ADQLASLS+ND  N+V+
Sbjct  610  EALKAKVAEAMAVLRSVSSSIVAADQLASLSINDSNNIVS  649



>tpg|DAA39543.1| TPA: hypothetical protein ZEAMMB73_983793 [Zea mays]
Length=246

 Score =   119 bits (298),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 87/103 (84%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALA+ALANAPP+QQR MLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  143  PVPIGALATALANAPPDQQRLMLGENLYPLVEQLEREQAAKVTGMLLEMDQTEVLHLLES  202

Query  252  PealkakvaealevXRNVQQAK----SPADQLASLSLNDNLVA  136
            P+ALKAKVAEA+EV R+ Q  +    S   QLA+LSLND +V+
Sbjct  203  PDALKAKVAEAMEVLRSAQHLQQSNVSTEQQLANLSLNDGVVS  245



>ref|XP_010928350.1| PREDICTED: polyadenylate-binding protein 8-like isoform X2 [Elaeis 
guineensis]
Length=633

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 93/103 (90%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA PEQQRTMLGE+LYPLVDQLEHEHAAKVTGMLLEMDQ EVLHLLES
Sbjct  531  PIPIGALASALANASPEQQRTMLGESLYPLVDQLEHEHAAKVTGMLLEMDQPEVLHLLES  590

Query  252  PealkakvaealevXRNV----QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV    QQA +PADQLA+LSLND +++
Sbjct  591  PEALKAKVAEAMEVLRNVAQQQQQASTPADQLAALSLNDGIIS  633



>ref|XP_010928349.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Elaeis 
guineensis]
Length=658

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 93/103 (90%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA PEQQRTMLGE+LYPLVDQLEHEHAAKVTGMLLEMDQ EVLHLLES
Sbjct  556  PIPIGALASALANASPEQQRTMLGESLYPLVDQLEHEHAAKVTGMLLEMDQPEVLHLLES  615

Query  252  PealkakvaealevXRNV----QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV    QQA +PADQLA+LSLND +++
Sbjct  616  PEALKAKVAEAMEVLRNVAQQQQQASTPADQLAALSLNDGIIS  658



>ref|XP_010526963.1| PREDICTED: polyadenylate-binding protein 2-like [Tarenaya hassleriana]
Length=638

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALASALANA PEQQRTMLGENLYP+V+Q+E E AAKVTGMLLEMDQTEVLHLLES
Sbjct  539  PVPIGALASALANATPEQQRTMLGENLYPMVEQVEPEAAAKVTGMLLEMDQTEVLHLLES  598

Query  252  PealkakvaealevXRNVQQAKS-PADQLASLSLNDNLVA  136
            PEALKAKVAEA++V R+V    +  A+QLASLSL+DN+++
Sbjct  599  PEALKAKVAEAMDVLRSVSSGGAVAAEQLASLSLSDNILS  638



>gb|KJB40263.1| hypothetical protein B456_007G054700 [Gossypium raimondii]
Length=653

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 88/103 (85%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+   ALASALANA   QQRT+LGENLYPLVDQLEH++AAKVTGMLLEMDQTEVLHLLES
Sbjct  551  PMATGALASALANATTVQQRTLLGENLYPLVDQLEHDNAAKVTGMLLEMDQTEVLHLLES  610

Query  252  PealkakvaealevXRNV----QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RN+    QQA S  D+L SLSLN+NLV+
Sbjct  611  PEALKAKVAEAMEVLRNIGPKPQQANSATDRLTSLSLNENLVS  653



>gb|KJB40264.1| hypothetical protein B456_007G054700 [Gossypium raimondii]
Length=651

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 88/103 (85%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+   ALASALANA   QQRT+LGENLYPLVDQLEH++AAKVTGMLLEMDQTEVLHLLES
Sbjct  549  PMATGALASALANATTVQQRTLLGENLYPLVDQLEHDNAAKVTGMLLEMDQTEVLHLLES  608

Query  252  PealkakvaealevXRNV----QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RN+    QQA S  D+L SLSLN+NLV+
Sbjct  609  PEALKAKVAEAMEVLRNIGPKPQQANSATDRLTSLSLNENLVS  651



>ref|XP_010906557.1| PREDICTED: polyadenylate-binding protein 8-like isoform X2 [Elaeis 
guineensis]
Length=549

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA PE QRTMLGE+LYPLVDQLEH+HAAKVTGMLLEMDQTEVLHLLES
Sbjct  448  PIPIGALASALANASPEHQRTMLGESLYPLVDQLEHDHAAKVTGMLLEMDQTEVLHLLES  507

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV   QQA +P DQLA+LSLND +V+
Sbjct  508  PEALKAKVAEAMEVLRNVAQQQQASTPTDQLAALSLNDGVVS  549



>emb|CDX71223.1| BnaC07g05020D [Brassica napus]
Length=638

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI ALA++LANA PE QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  542  VPIGALATSLANASPEHQRTMLGENLYPLVEQLEAESAAKVTGMLLEMDQTEVLHLLESP  601

Query  249  ealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            EALKAKVAEA++V R+V  A   A+QLASL+LNDNLV+
Sbjct  602  EALKAKVAEAMDVLRSV-AAGGAAEQLASLNLNDNLVS  638



>ref|XP_006422975.1| hypothetical protein CICLE_v10027999mg [Citrus clementina]
 ref|XP_006487035.1| PREDICTED: polyadenylate-binding protein 2-like [Citrus sinensis]
 gb|ESR36215.1| hypothetical protein CICLE_v10027999mg [Citrus clementina]
Length=645

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 93/102 (91%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALASALANA PEQQRTMLGENLYPLV+QLE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  544  PVPIGALASALANASPEQQRTMLGENLYPLVEQLEPDAAAKVTGMLLEMDQTEVLHLLES  603

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV   QQA +PADQLASLSLNDNLV+
Sbjct  604  PEALKAKVAEAMEVLRNVAQQQQAGNPADQLASLSLNDNLVS  645



>emb|CDP01307.1| unnamed protein product [Coffea canephora]
Length=658

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+P TALASALANA PEQQRTMLGENLYPLVDQLE ++AAKVTGMLLEMDQTEVLHLLES
Sbjct  560  PMPTTALASALANASPEQQRTMLGENLYPLVDQLEPDYAAKVTGMLLEMDQTEVLHLLES  619

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            P+ALKAKVAEA+EV +NVQQ   PADQLASLSL+D++V+
Sbjct  620  PDALKAKVAEAMEVLQNVQQGSGPADQLASLSLSDSIVS  658



>ref|XP_008788846.1| PREDICTED: polyadenylate-binding protein 2-like [Phoenix dactylifera]
Length=665

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 93/103 (90%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA PEQQRTMLGE+LYPLVDQLEH+HAAKVTGMLLEMDQ EVLHLLES
Sbjct  563  PIPIGALASALANASPEQQRTMLGESLYPLVDQLEHDHAAKVTGMLLEMDQPEVLHLLES  622

Query  252  PealkakvaealevXRNV----QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV    QQA +PADQLA+LSLND +++
Sbjct  623  PEALKAKVAEAMEVLRNVAQQQQQASTPADQLAALSLNDGIIS  665



>gb|AAB61594.1| poly(A)-binding protein, partial [Mesembryanthemum crystallinum]
Length=176

 Score =   115 bits (288),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 86/104 (83%), Gaps = 8/104 (8%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VP+  LA+ LANA PEQQR +LGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  72   VPVGTLATLLANATPEQQRLLLGENLYPLVEQLEPEMAAKVTGMLLEMDQTEVLHLLESP  131

Query  249  ealkakvaealevXRNVQQ--------AKSPADQLASLSLNDNL  142
            EALK+KVAEA+EV RNV Q        + +PADQLA+LSLNDNL
Sbjct  132  EALKSKVAEAMEVLRNVAQQQQQQQQPSSNPADQLAALSLNDNL  175



>ref|XP_010906556.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Elaeis 
guineensis]
Length=654

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA PE QRTMLGE+LYPLVDQLEH+HAAKVTGMLLEMDQTEVLHLLES
Sbjct  553  PIPIGALASALANASPEHQRTMLGESLYPLVDQLEHDHAAKVTGMLLEMDQTEVLHLLES  612

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV   QQA +P DQLA+LSLND +V+
Sbjct  613  PEALKAKVAEAMEVLRNVAQQQQASTPTDQLAALSLNDGVVS  654



>tpg|DAA39541.1| TPA: hypothetical protein ZEAMMB73_983793 [Zea mays]
Length=654

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 87/103 (84%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALA+ALANAPP+QQR MLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  551  PVPIGALATALANAPPDQQRLMLGENLYPLVEQLEREQAAKVTGMLLEMDQTEVLHLLES  610

Query  252  PealkakvaealevXRNVQQAK----SPADQLASLSLNDNLVA  136
            P+ALKAKVAEA+EV R+ Q  +    S   QLA+LSLND +V+
Sbjct  611  PDALKAKVAEAMEVLRSAQHLQQSNVSTEQQLANLSLNDGVVS  653



>tpg|DAA39542.1| TPA: hypothetical protein ZEAMMB73_983793 [Zea mays]
Length=648

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 87/103 (84%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALA+ALANAPP+QQR MLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  545  PVPIGALATALANAPPDQQRLMLGENLYPLVEQLEREQAAKVTGMLLEMDQTEVLHLLES  604

Query  252  PealkakvaealevXRNVQQAK----SPADQLASLSLNDNLVA  136
            P+ALKAKVAEA+EV R+ Q  +    S   QLA+LSLND +V+
Sbjct  605  PDALKAKVAEAMEVLRSAQHLQQSNVSTEQQLANLSLNDGVVS  647



>ref|XP_010688794.1| PREDICTED: polyadenylate-binding protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=661

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 94/103 (91%), Gaps = 2/103 (2%)
 Frame = -3

Query  438  AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLL  259
            A PVPITALA+ALANA PEQQRTMLGE+LYPLVD +EH++AAKVTGMLLEMDQTEVLHLL
Sbjct  559  AQPVPITALATALANASPEQQRTMLGESLYPLVDAIEHDNAAKVTGMLLEMDQTEVLHLL  618

Query  258  ESPealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            ESP+ALKAKVAEA+EV RNV  QQ  + ADQLASLSLNDNLV+
Sbjct  619  ESPDALKAKVAEAMEVLRNVAAQQGSNAADQLASLSLNDNLVS  661



>ref|XP_008347611.1| PREDICTED: polyadenylate-binding protein 8-like [Malus domestica]
Length=213

 Score =   116 bits (290),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 82/92 (89%), Gaps = 2/92 (2%)
 Frame = -3

Query  423  ITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPea  244
            + ALA+ALANA  EQQRTMLGE LYPLVDQLEHE AAKVTGMLLEMDQTEVLHLLESPEA
Sbjct  121  VPALATALANASTEQQRTMLGEALYPLVDQLEHESAAKVTGMLLEMDQTEVLHLLESPEA  180

Query  243  lkakvaealevXRNV--QQAKSPADQLASLSL  154
            LKAKVAEA++V RNV  QQA S ADQLASL+L
Sbjct  181  LKAKVAEAMDVLRNVAQQQANSSADQLASLTL  212



>ref|XP_006404818.1| hypothetical protein EUTSA_v10000075mg [Eutrema salsugineum]
 gb|ESQ46271.1| hypothetical protein EUTSA_v10000075mg [Eutrema salsugineum]
Length=652

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 87/106 (82%), Gaps = 9/106 (8%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+P  ALAS+LA A P QQRT+LGENLYPLVDQ+EHE+AAKVTGMLLEMDQTEVLHLLES
Sbjct  547  PMPAGALASSLAQASPAQQRTLLGENLYPLVDQIEHENAAKVTGMLLEMDQTEVLHLLES  606

Query  252  PealkakvaealevXRNVQQ---------AKSPADQLASLSLNDNL  142
            PEAL AKV+EAL+V RNV Q         + SP+D LASL++ND+L
Sbjct  607  PEALNAKVSEALDVLRNVNQQQSQVSEGKSGSPSDLLASLTINDHL  652



>emb|CBI19489.3| unnamed protein product [Vitis vinifera]
Length=621

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 93/100 (93%), Gaps = 2/100 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI+ALASALANA P+QQRTMLGE+LYPLVDQLEHE AAKVTGMLLEMDQTEVLHLLES
Sbjct  521  PMPISALASALANATPDQQRTMLGESLYPLVDQLEHEMAAKVTGMLLEMDQTEVLHLLES  580

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLV  139
            PEALK+KVAEA++V RNV  QQA SP +QLASLSLND+LV
Sbjct  581  PEALKSKVAEAMDVLRNVAQQQANSPTEQLASLSLNDSLV  620



>ref|XP_008795896.1| PREDICTED: polyadenylate-binding protein 2-like [Phoenix dactylifera]
Length=660

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 93/105 (89%), Gaps = 6/105 (6%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA PEQQRTMLGE+LYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES
Sbjct  556  PIPIGALASALANASPEQQRTMLGESLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  615

Query  252  PealkakvaealevXRNV------QQAKSPADQLASLSLNDNLVA  136
            PE+LKAKVAEA+EV RNV      QQA +P DQLA+LSLND LV+
Sbjct  616  PESLKAKVAEAMEVLRNVAQQQQQQQASTPTDQLAALSLNDGLVS  660



>ref|XP_002284923.1| PREDICTED: polyadenylate-binding protein 8 isoform X1 [Vitis 
vinifera]
 ref|XP_010664560.1| PREDICTED: polyadenylate-binding protein 8 isoform X2 [Vitis 
vinifera]
 emb|CAN76464.1| hypothetical protein VITISV_017035 [Vitis vinifera]
Length=640

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 93/100 (93%), Gaps = 2/100 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI+ALASALANA P+QQRTMLGE+LYPLVDQLEHE AAKVTGMLLEMDQTEVLHLLES
Sbjct  540  PMPISALASALANATPDQQRTMLGESLYPLVDQLEHEMAAKVTGMLLEMDQTEVLHLLES  599

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLV  139
            PEALK+KVAEA++V RNV  QQA SP +QLASLSLND+LV
Sbjct  600  PEALKSKVAEAMDVLRNVAQQQANSPTEQLASLSLNDSLV  639



>gb|KFK40021.1| hypothetical protein AALP_AA3G319900 [Arabis alpina]
Length=651

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI ALA++LANA PE QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  555  VPIGALATSLANASPEHQRTMLGENLYPLVEQLEAESAAKVTGMLLEMDQTEVLHLLESP  614

Query  249  ealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            EALKAKVAEA++V R+V  A   A+QLASL+L DNLV+
Sbjct  615  EALKAKVAEAMDVLRSV-AAGGAAEQLASLNLGDNLVS  651



>emb|CDX79295.1| BnaC06g20080D [Brassica napus]
Length=100

 Score =   112 bits (279),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 81/92 (88%), Gaps = 1/92 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +PI ALAS LANA PEQQRTMLGENLYPLV++LE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  9    MPIGALASNLANASPEQQRTMLGENLYPLVEKLEAESAAKVTGMLLEMDQTEVLHLLESP  68

Query  249  ealkakvaealevXRNVQQAKSPADQLASLSL  154
            EAL+AKVAEA++V R+V  A   A+QLASL+L
Sbjct  69   EALEAKVAEAMDVLRSV-AAGGAAEQLASLNL  99



>ref|XP_006409548.1| hypothetical protein EUTSA_v10022589mg [Eutrema salsugineum]
 gb|ESQ51001.1| hypothetical protein EUTSA_v10022589mg [Eutrema salsugineum]
Length=649

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI ALA++LANA PE QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  553  VPIGALATSLANASPEHQRTMLGENLYPLVEQLEAESAAKVTGMLLEMDQTEVLHLLESP  612

Query  249  ealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            +ALKAKVAEA+EV R+V  A   A+QLASL+LN+NLV+
Sbjct  613  DALKAKVAEAMEVLRSV-AAGGAAEQLASLNLNENLVS  649



>emb|CDY36634.1| BnaA07g04230D [Brassica napus]
Length=649

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI ALA++LANA PE QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  538  VPIGALATSLANASPEHQRTMLGENLYPLVEQLEAESAAKVTGMLLEMDQTEVLHLLESP  597

Query  249  ealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            EALKAKVAEA++V R+V  A    +QLASL+LND+LV+
Sbjct  598  EALKAKVAEAMDVLRSV-AAGGAGEQLASLNLNDDLVS  634



>ref|XP_009147891.1| PREDICTED: polyadenylate-binding protein 8 [Brassica rapa]
 emb|CDY51045.1| BnaA06g03080D [Brassica napus]
Length=653

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 88/101 (87%), Gaps = 3/101 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALA++LANA PE QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  552  PVPIGALATSLANAAPEHQRTMLGENLYPLVEQLEPESAAKVTGMLLEMDQTEVLHLLES  611

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLV  139
            P+ALKAKVAEA++V R+V   QQA   ADQLASLSL DN+V
Sbjct  612  PDALKAKVAEAMDVLRSVAQQQQAGGAADQLASLSLGDNIV  652



>emb|CDY54068.1| BnaCnng26160D [Brassica napus]
Length=653

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 88/101 (87%), Gaps = 3/101 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALA++LANA PE QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  552  PVPIGALATSLANAAPEHQRTMLGENLYPLVEQLEPESAAKVTGMLLEMDQTEVLHLLES  611

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLV  139
            P+ALKAKVAEA++V R+V   QQA   ADQLASLSL DN+V
Sbjct  612  PDALKAKVAEAMDVLRSVAQQQQAGGAADQLASLSLGDNIV  652



>gb|KFK35979.1| hypothetical protein AALP_AA4G062600 [Arabis alpina]
Length=671

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 88/101 (87%), Gaps = 3/101 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALA++LANA PE QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  570  PVPIGALATSLANAAPEHQRTMLGENLYPLVEQLEPESAAKVTGMLLEMDQTEVLHLLES  629

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLV  139
            P+ALKAKVAEA++V R+V   QQA   ADQLASLSL DN+V
Sbjct  630  PDALKAKVAEAMDVLRSVAQQQQAGGAADQLASLSLGDNIV  670



>ref|XP_008378021.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
Length=648

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 85/105 (81%), Gaps = 11/105 (10%)
 Frame = -3

Query  435  APVPIT---------ALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMD  283
             P+PI          ALA+ALANA  EQQRTMLGE LYPLVDQLEHE AAKVTGMLLEMD
Sbjct  543  GPIPIRDAAGGQGVPALATALANASTEQQRTMLGEALYPLVDQLEHESAAKVTGMLLEMD  602

Query  282  QTEVLHLLESPealkakvaealevXRNV--QQAKSPADQLASLSL  154
            QTEVLHLLESPEALKAKVAEA++V RNV  QQA S ADQLASL+L
Sbjct  603  QTEVLHLLESPEALKAKVAEAMDVLRNVAQQQANSSADQLASLTL  647



>ref|XP_006421219.1| hypothetical protein CICLE_v10007158mg, partial [Citrus clementina]
 gb|ESR34459.1| hypothetical protein CICLE_v10007158mg, partial [Citrus clementina]
Length=437

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 87/101 (86%), Gaps = 3/101 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAA-KVTGMLLEMDQTEVLHLLE  256
            P PIT L++ALANA PEQ+RT+ GE+LYPL++QLE + AA KVTGMLLEM QTEVLHLLE
Sbjct  318  PTPITPLSTALANASPEQRRTLPGESLYPLIEQLERDAAAEKVTGMLLEMHQTEVLHLLE  377

Query  255  SPealkakvaealevXRNV--QQAKSPADQLASLSLNDNLV  139
            SPEA KAKVAEA+EV R+V  QQA +PADQLASLSLNDNL 
Sbjct  378  SPEAFKAKVAEAMEVLRSVAQQQANNPADQLASLSLNDNLF  418



>dbj|BAD94406.1| putative poly(A) binding protein [Arabidopsis thaliana]
Length=154

 Score =   112 bits (280),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 85/107 (79%), Gaps = 10/107 (9%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+    LA++LANA P QQRT+LGE+LYPLVDQ+E EHAAKVTGMLLEMDQTEVLHLLES
Sbjct  48   PMSAGQLATSLANATPAQQRTLLGESLYPLVDQIESEHAAKVTGMLLEMDQTEVLHLLES  107

Query  252  PealkakvaealevXRNVQQ----------AKSPADQLASLSLNDNL  142
            PEAL AKV+EAL+V RNV Q          + SP+D LASLS+ND+L
Sbjct  108  PEALNAKVSEALDVLRNVNQPSSQGSEGNKSGSPSDLLASLSINDHL  154



>ref|XP_002301171.2| hypothetical protein POPTR_0002s12570g [Populus trichocarpa]
 gb|EEE80444.2| hypothetical protein POPTR_0002s12570g [Populus trichocarpa]
Length=657

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 92/102 (90%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITALA+ALANA PEQQRTMLGE LYPLVDQLEH+ AAKVTGMLLEMDQTEVLHLLES
Sbjct  550  PMPITALATALANATPEQQRTMLGEGLYPLVDQLEHDSAAKVTGMLLEMDQTEVLHLLES  609

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R V   QQ  +PADQLASLSLN+NLV+
Sbjct  610  PEALKAKVAEAMEVLRTVAAQQQINNPADQLASLSLNENLVS  651



>ref|NP_001167831.1| uncharacterized protein LOC100381531 [Zea mays]
 gb|ACN26239.1| unknown [Zea mays]
Length=249

 Score =   114 bits (285),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 86/103 (83%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALA+ALANA P+QQR MLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  146  PVPIGALATALANASPDQQRLMLGENLYPLVEQLEREQAAKVTGMLLEMDQTEVLHLLES  205

Query  252  PealkakvaealevXRNVQQAK----SPADQLASLSLNDNLVA  136
            P+ALKAKVAEA+EV R+ Q  +    S   QLA+LSLND +++
Sbjct  206  PDALKAKVAEAMEVLRSAQHLQQSNASTEQQLANLSLNDGVLS  248



>ref|XP_008393785.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
 ref|XP_008351992.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
Length=649

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 82/92 (89%), Gaps = 2/92 (2%)
 Frame = -3

Query  423  ITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPea  244
            + ALA+ALANA  EQQRTMLGE LYPLVDQLEHE AAKVTGMLLEMDQTEVLHLLESPEA
Sbjct  557  VPALATALANASTEQQRTMLGEALYPLVDQLEHESAAKVTGMLLEMDQTEVLHLLESPEA  616

Query  243  lkakvaealevXRNV--QQAKSPADQLASLSL  154
            LKAKVAEA++V RNV  QQA S ADQL+SLSL
Sbjct  617  LKAKVAEAMDVLRNVAQQQANSSADQLSSLSL  648



>ref|XP_009398670.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=643

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVP+  L SALANA PEQQR MLGE+LYPLVDQLEH +AAKVTGMLLEMDQ EVLHLLES
Sbjct  547  PVPVGELTSALANATPEQQRLMLGESLYPLVDQLEHGYAAKVTGMLLEMDQNEVLHLLES  606

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLND  148
            PEAL+AKV EA+ V R+V Q +  A++LA LSLND
Sbjct  607  PEALQAKVVEAMGVLRSVVQQQQVANRLAGLSLND  641



>ref|XP_009359888.1| PREDICTED: polyadenylate-binding protein 2-like [Pyrus x bretschneideri]
 ref|XP_009359896.1| PREDICTED: polyadenylate-binding protein 2-like [Pyrus x bretschneideri]
Length=650

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 82/92 (89%), Gaps = 2/92 (2%)
 Frame = -3

Query  423  ITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPea  244
            + ALA+ALANA  EQQRTMLGE LYPLVDQLEHE AAKVTGMLLEMDQTEVLHLLESPEA
Sbjct  558  VPALATALANASTEQQRTMLGEALYPLVDQLEHESAAKVTGMLLEMDQTEVLHLLESPEA  617

Query  243  lkakvaealevXRNV--QQAKSPADQLASLSL  154
            LKAKVAEA++V RNV  QQA S ADQL+SLSL
Sbjct  618  LKAKVAEAMDVLRNVAQQQANSSADQLSSLSL  649



>gb|EEE61291.1| hypothetical protein OsJ_15377 [Oryza sativa Japonica Group]
Length=613

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 85/103 (83%), Gaps = 3/103 (3%)
 Frame = -3

Query  435  APVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLE  256
            +P PI  L SALANA PEQQRT+LGE+LYPLV+ LE  HAAKVTGMLLEMDQTEVLHLLE
Sbjct  511  SPAPIGTLTSALANANPEQQRTILGESLYPLVELLEQNHAAKVTGMLLEMDQTEVLHLLE  570

Query  255  SPealkakvaealevXRNVQQ---AKSPADQLASLSLNDNLVA  136
            SPEALK+KVAEA++V RNV Q   A +P  QLA+LSL D +++
Sbjct  571  SPEALKSKVAEAMDVLRNVAQQHNANTPTSQLAALSLGDAIIS  613



>ref|XP_011029544.1| PREDICTED: polyadenylate-binding protein 2-like [Populus euphratica]
Length=651

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 92/104 (88%), Gaps = 3/104 (3%)
 Frame = -3

Query  438  AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLL  259
            A P+PITALA+ALANA PEQQRTMLGE+LYP+VDQLEH+ AAKVTGMLLEMDQTEVLHLL
Sbjct  548  AQPMPITALATALANATPEQQRTMLGESLYPIVDQLEHDSAAKVTGMLLEMDQTEVLHLL  607

Query  258  ESPealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            ESP+ALKAKVAEA++V R V   QQ  S ADQL SLSLNDNLV+
Sbjct  608  ESPDALKAKVAEAMDVLRTVAAQQQINSQADQLGSLSLNDNLVS  651



>ref|XP_006393217.1| hypothetical protein EUTSA_v10011289mg [Eutrema salsugineum]
 gb|ESQ30503.1| hypothetical protein EUTSA_v10011289mg [Eutrema salsugineum]
Length=669

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 88/101 (87%), Gaps = 3/101 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALA++LANA PE QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  568  PVPIGALATSLANAAPEHQRTMLGENLYPLVEQLEPESAAKVTGMLLEMDQTEVLHLLES  627

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLV  139
            P+ALKAKVAEA++V R+V   QQA   ADQL+SLSL DN+V
Sbjct  628  PDALKAKVAEAMDVLRSVAQQQQAGGAADQLSSLSLGDNIV  668



>pdb|2DYD|A Chain A, Solution Structure Of The Pabc Domain From Triticum 
Aevestium Poly(A)-Binding Protein
Length=85

 Score =   109 bits (272),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = -3

Query  426  PITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPe  247
            PI ALASALAN+PPE QR MLGENLYPLVDQLEH+ AAKVTGMLLEMDQTEVLHLLESP+
Sbjct  6    PIGALASALANSPPETQRMMLGENLYPLVDQLEHDQAAKVTGMLLEMDQTEVLHLLESPD  65

Query  246  alkakvaealevXRNVQQ  193
            ALKAKVAEA+EV R+ QQ
Sbjct  66   ALKAKVAEAMEVLRSAQQ  83



>emb|CAE02947.3| OSJNBa0014K14.19 [Oryza sativa Japonica Group]
Length=657

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 85/103 (83%), Gaps = 3/103 (3%)
 Frame = -3

Query  435  APVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLE  256
            +P PI  L SALANA PEQQRT+LGE+LYPLV+ LE  HAAKVTGMLLEMDQTEVLHLLE
Sbjct  555  SPAPIGTLTSALANANPEQQRTILGESLYPLVELLEQNHAAKVTGMLLEMDQTEVLHLLE  614

Query  255  SPealkakvaealevXRNVQQ---AKSPADQLASLSLNDNLVA  136
            SPEALK+KVAEA++V RNV Q   A +P  QLA+LSL D +++
Sbjct  615  SPEALKSKVAEAMDVLRNVAQQHNANTPTSQLAALSLGDAIIS  657



>ref|NP_001053248.1| Os04g0504800 [Oryza sativa Japonica Group]
 emb|CAE05558.1| OSJNBb0116K07.11 [Oryza sativa Japonica Group]
 dbj|BAF15162.1| Os04g0504800 [Oryza sativa Japonica Group]
 dbj|BAG90316.1| unnamed protein product [Oryza sativa Japonica Group]
Length=659

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 85/103 (83%), Gaps = 3/103 (3%)
 Frame = -3

Query  435  APVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLE  256
            +P PI  L SALANA PEQQRT+LGE+LYPLV+ LE  HAAKVTGMLLEMDQTEVLHLLE
Sbjct  557  SPAPIGTLTSALANANPEQQRTILGESLYPLVELLEQNHAAKVTGMLLEMDQTEVLHLLE  616

Query  255  SPealkakvaealevXRNVQQ---AKSPADQLASLSLNDNLVA  136
            SPEALK+KVAEA++V RNV Q   A +P  QLA+LSL D +++
Sbjct  617  SPEALKSKVAEAMDVLRNVAQQHNANTPTSQLAALSLGDAIIS  659



>ref|XP_007017178.1| Poly(A) binding protein 8 isoform 1 [Theobroma cacao]
 gb|EOY14403.1| Poly(A) binding protein 8 isoform 1 [Theobroma cacao]
Length=648

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 93/102 (91%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALA+ALANA PEQQRTMLGE+LYPLV++LE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  547  PMPIPALATALANATPEQQRTMLGESLYPLVERLERDSAAKVTGMLLEMDQTEVLHLLES  606

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEALEV R+V   QQA SPADQLASLSLNDNLV+
Sbjct  607  PEALKAKVAEALEVLRSVAAQQQANSPADQLASLSLNDNLVS  648



>gb|EEC77593.1| hypothetical protein OsI_16552 [Oryza sativa Indica Group]
Length=659

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 85/103 (83%), Gaps = 3/103 (3%)
 Frame = -3

Query  435  APVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLE  256
            +P PI  L SALANA PEQQRT+LGE+LYPLV+ LE  HAAKVTGMLLEMDQTEVLHLLE
Sbjct  557  SPAPIGTLTSALANANPEQQRTILGESLYPLVELLEQNHAAKVTGMLLEMDQTEVLHLLE  616

Query  255  SPealkakvaealevXRNVQQ---AKSPADQLASLSLNDNLVA  136
            SPEALK+KVAEA++V RNV Q   A +P  QLA+LSL D +++
Sbjct  617  SPEALKSKVAEAMDVLRNVAQQHNANTPTSQLAALSLGDAIIS  659



>emb|CBI19492.3| unnamed protein product [Vitis vinifera]
Length=153

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 79/90 (88%), Gaps = 2/90 (2%)
 Frame = -3

Query  435  APVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLE  256
            +P+PI+ LASALANA P+QQRTML E+LYPLVDQLEHE AAK+TGMLLEM QTE LHLLE
Sbjct  52   SPMPISTLASALANATPDQQRTMLSESLYPLVDQLEHEMAAKLTGMLLEMGQTEFLHLLE  111

Query  255  SPealkakvaealevXRNV--QQAKSPADQ  172
            SPEALK+KVAEA++V RNV  QQA SP +Q
Sbjct  112  SPEALKSKVAEAMDVLRNVAQQQANSPTEQ  141



>ref|XP_008651618.1| PREDICTED: uncharacterized protein LOC100381531 isoform X1 [Zea 
mays]
Length=656

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 86/103 (83%), Gaps = 4/103 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALA+ALANA P+QQR MLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  553  PVPIGALATALANASPDQQRLMLGENLYPLVEQLEREQAAKVTGMLLEMDQTEVLHLLES  612

Query  252  PealkakvaealevXRNVQQAK----SPADQLASLSLNDNLVA  136
            P+ALKAKVAEA+EV R+ Q  +    S   QLA+LSLND +++
Sbjct  613  PDALKAKVAEAMEVLRSAQHLQQSNASTEQQLANLSLNDGVLS  655



>ref|XP_008456143.1| PREDICTED: polyadenylate-binding protein 8-like isoform X2 [Cucumis 
melo]
Length=552

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 92/105 (88%), Gaps = 6/105 (6%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA P+QQRTMLGENLYPLV+QLE ++AAKVTGMLLEMDQTEVLHLLES
Sbjct  448  PIPIGALASALANATPDQQRTMLGENLYPLVEQLEPDNAAKVTGMLLEMDQTEVLHLLES  507

Query  252  PealkakvaealevXRNV------QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV      QQA + ADQLASLSL +NLV+
Sbjct  508  PEALKAKVAEAMEVLRNVAAAQQQQQAGNAADQLASLSLTENLVS  552



>ref|XP_002518733.1| polyadenylate-binding protein, putative [Ricinus communis]
 gb|EEF43658.1| polyadenylate-binding protein, putative [Ricinus communis]
Length=644

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 91/101 (90%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA PEQQRTMLGENLYPLV+QLE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  544  PIPIGALASALANASPEQQRTMLGENLYPLVEQLEPDAAAKVTGMLLEMDQTEVLHLLES  603

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R+V  QQA   ADQLASLSLNDNLV+
Sbjct  604  PEALKAKVAEAMEVLRSVQQQQAGGAADQLASLSLNDNLVS  644



>emb|CDX89562.1| BnaC04g35810D [Brassica napus]
Length=645

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 86/105 (82%), Gaps = 8/105 (8%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+P  ALAS+LA A P QQRT+LGE LYPLV+++EHE+AAKVTGMLLEMDQTEVLHL+ES
Sbjct  541  PMPAGALASSLAQASPAQQRTILGETLYPLVNKIEHENAAKVTGMLLEMDQTEVLHLIES  600

Query  252  PealkakvaealevXRNVQQ--------AKSPADQLASLSLNDNL  142
            PEAL AKV+EAL+V RNV Q        + SP+D LASLS+ND+L
Sbjct  601  PEALNAKVSEALDVLRNVNQPAQGSEGKSGSPSDMLASLSINDHL  645



>ref|XP_009408013.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=645

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 84/98 (86%), Gaps = 4/98 (4%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI  L SALANA  EQQRTMLGE+LYPLVDQLEH+++AKVTGMLLEMDQTEVLHLLESP
Sbjct  545  VPIGELTSALANATLEQQRTMLGESLYPLVDQLEHDYSAKVTGMLLEMDQTEVLHLLESP  604

Query  249  ealkakvaealevXRNV----QQAKSPADQLASLSLND  148
            EALKAKVAEA+EV R+V     Q  SP D+LA+L+LND
Sbjct  605  EALKAKVAEAMEVLRSVAQQHHQVVSPTDRLAALTLND  642



>gb|KJB63886.1| hypothetical protein B456_010G021800 [Gossypium raimondii]
Length=620

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 88/102 (86%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+P+  LA+ALAN+ PEQQRTMLGE+LYPLV+ LE + AAKVTGMLLEMDQTEVLHL+ES
Sbjct  519  PMPLQPLATALANSTPEQQRTMLGESLYPLVEHLECDAAAKVTGMLLEMDQTEVLHLIES  578

Query  252  PealkakvaealevXRNVQ---QAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEALEV ++V    Q  +PADQLASLSLNDN V+
Sbjct  579  PEALKAKVAEALEVLKSVAAKPQVNNPADQLASLSLNDNHVS  620



>ref|XP_004161443.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
2-like [Cucumis sativus]
Length=576

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 92/105 (88%), Gaps = 6/105 (6%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA P+QQRTMLGENLYPLV+QLE ++AAKVTGMLLEMDQTEVLHLLES
Sbjct  472  PIPIGALASALANATPDQQRTMLGENLYPLVEQLEPDNAAKVTGMLLEMDQTEVLHLLES  531

Query  252  PealkakvaealevXRNV------QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV      QQA + ADQLASLSL +NLV+
Sbjct  532  PEALKAKVAEAMEVLRNVAAAQQQQQAGNAADQLASLSLTENLVS  576



>gb|KJB63885.1| hypothetical protein B456_010G021800 [Gossypium raimondii]
Length=579

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 88/102 (86%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+P+  LA+ALAN+ PEQQRTMLGE+LYPLV+ LE + AAKVTGMLLEMDQTEVLHL+ES
Sbjct  478  PMPLQPLATALANSTPEQQRTMLGESLYPLVEHLECDAAAKVTGMLLEMDQTEVLHLIES  537

Query  252  PealkakvaealevXRNVQ---QAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEALEV ++V    Q  +PADQLASLSLNDN V+
Sbjct  538  PEALKAKVAEALEVLKSVAAKPQVNNPADQLASLSLNDNHVS  579



>emb|CDO97198.1| unnamed protein product [Coffea canephora]
Length=653

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 90/102 (88%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALASALANA P  QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  552  PVPIGALASALANASPADQRTMLGENLYPLVEQLEPETAAKVTGMLLEMDQTEVLHLLES  611

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            PEALK+KVAEA+EV RNV   QQA +PADQLASLSLND LV+
Sbjct  612  PEALKSKVAEAMEVLRNVSQQQQATNPADQLASLSLNDGLVS  653



>gb|KFK32750.1| poly binding protein [Arabis alpina]
Length=646

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 87/105 (83%), Gaps = 8/105 (8%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+P  ALAS+LA+A P QQRT+LGE+LYPLVDQ+EHE+AAKVTGMLLEMD+TEVLHLLES
Sbjct  542  PMPTGALASSLASATPAQQRTILGESLYPLVDQIEHENAAKVTGMLLEMDKTEVLHLLES  601

Query  252  PealkakvaealevXRNVQQ--------AKSPADQLASLSLNDNL  142
            PEAL AKV+EAL+V R V Q        + SP+D LASLS+ND+L
Sbjct  602  PEALNAKVSEALDVLRKVNQPTQVSEGKSGSPSDLLASLSINDHL  646



>ref|XP_009119410.1| PREDICTED: polyadenylate-binding protein 2 [Brassica rapa]
Length=634

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI ALA++LANA PE QRTMLGENLY LV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  538  VPIGALATSLANASPEHQRTMLGENLYQLVEQLEAESAAKVTGMLLEMDQTEVLHLLESP  597

Query  249  ealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            EALKAKVAEA++V R+V  A   A+QLASL+LND+LV+
Sbjct  598  EALKAKVAEAMDVLRSV-AAGGAAEQLASLNLNDDLVS  634



>emb|CDO97200.1| unnamed protein product [Coffea canephora]
Length=654

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 90/102 (88%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALASALANA P  QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  553  PVPIGALASALANASPADQRTMLGENLYPLVEQLEPETAAKVTGMLLEMDQTEVLHLLES  612

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            PEALK+KVAEA+EV RNV   QQA +PADQLASLSLND LV+
Sbjct  613  PEALKSKVAEAMEVLRNVSQQQQAANPADQLASLSLNDGLVS  654



>ref|XP_006374904.1| hypothetical protein POPTR_0014s02550g [Populus trichocarpa]
 gb|ERP52701.1| hypothetical protein POPTR_0014s02550g [Populus trichocarpa]
Length=651

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 92/104 (88%), Gaps = 3/104 (3%)
 Frame = -3

Query  438  AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLL  259
            A P+PITALA+ALANA PEQQRTMLGE+LYP+VDQLEH+ AAKVTGMLLEMDQTEVLHLL
Sbjct  548  AQPMPITALATALANATPEQQRTMLGESLYPIVDQLEHDSAAKVTGMLLEMDQTEVLHLL  607

Query  258  ESPealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            ESPEALKAKVAEA+EV R V   QQ  + ADQL SLSLNDNLV+
Sbjct  608  ESPEALKAKVAEAMEVLRTVAAQQQINNQADQLGSLSLNDNLVS  651



>dbj|BAJ86310.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=746

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%), Gaps = 3/100 (3%)
 Frame = -3

Query  426  PITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPe  247
            PI  L SALANA PEQQRT+LGE+LYPLV++LEH+ AAKVTGMLLEMDQTEVLHLLESPE
Sbjct  647  PIGTLTSALANATPEQQRTILGESLYPLVEKLEHQQAAKVTGMLLEMDQTEVLHLLESPE  706

Query  246  alkakvaealevXRNVQQAK---SPADQLASLSLNDNLVA  136
            ALK+KVAEA++V RNV Q +   +P  QLA LSL+D +++
Sbjct  707  ALKSKVAEAMDVLRNVAQQQNPNAPTSQLAGLSLSDGIIS  746



>ref|XP_007047341.1| Poly(A) binding protein 8 [Theobroma cacao]
 gb|EOX91498.1| Poly(A) binding protein 8 [Theobroma cacao]
Length=659

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 79/87 (91%), Gaps = 4/87 (5%)
 Frame = -3

Query  387  PEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevX  208
            PEQQRT+LGENLYPLVDQLEHE+AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EV 
Sbjct  573  PEQQRTLLGENLYPLVDQLEHENAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVL  632

Query  207  RNV----QQAKSPADQLASLSLNDNLV  139
            RNV    Q+A S  D++ASLSLNDNLV
Sbjct  633  RNVGPPQQKANSTTDRMASLSLNDNLV  659



>ref|XP_011017176.1| PREDICTED: polyadenylate-binding protein 8-like [Populus euphratica]
Length=651

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 91/102 (89%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITALA+ALANA PEQQR MLGE+LYPLVDQLEH+ AAKVTGMLLEMDQTEVLHLLES
Sbjct  550  PMPITALATALANATPEQQRMMLGESLYPLVDQLEHDSAAKVTGMLLEMDQTEVLHLLES  609

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            PEALK KVAEA+EV R V   QQ  +PADQLASLSLN+NLV+
Sbjct  610  PEALKEKVAEAMEVLRTVAAQQQINNPADQLASLSLNENLVS  651



>ref|XP_004140705.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
 gb|KGN57514.1| hypothetical protein Csa_3G202720 [Cucumis sativus]
Length=654

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 92/105 (88%), Gaps = 6/105 (6%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA P+QQRTMLGENLYPLV+QLE ++AAKVTGMLLEMDQTEVLHLLES
Sbjct  550  PIPIGALASALANATPDQQRTMLGENLYPLVEQLEPDNAAKVTGMLLEMDQTEVLHLLES  609

Query  252  PealkakvaealevXRNV------QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV      QQA + ADQLASLSL +NLV+
Sbjct  610  PEALKAKVAEAMEVLRNVAAAQQQQQAGNAADQLASLSLTENLVS  654



>ref|XP_008456142.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Cucumis 
melo]
Length=654

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 92/105 (88%), Gaps = 6/105 (6%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA P+QQRTMLGENLYPLV+QLE ++AAKVTGMLLEMDQTEVLHLLES
Sbjct  550  PIPIGALASALANATPDQQRTMLGENLYPLVEQLEPDNAAKVTGMLLEMDQTEVLHLLES  609

Query  252  PealkakvaealevXRNV------QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV      QQA + ADQLASLSL +NLV+
Sbjct  610  PEALKAKVAEAMEVLRNVAAAQQQQQAGNAADQLASLSLTENLVS  654



>gb|EMT03423.1| Polyadenylate-binding protein 2 [Aegilops tauschii]
Length=566

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 85/100 (85%), Gaps = 3/100 (3%)
 Frame = -3

Query  426  PITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPe  247
            PI  L SALANA PEQQRT+LGE+LYPLV++LEH+ AAKVTGMLLEMDQTEVLHLLESPE
Sbjct  467  PIGTLTSALANATPEQQRTILGESLYPLVEKLEHQQAAKVTGMLLEMDQTEVLHLLESPE  526

Query  246  alkakvaealevXRNVQQAK---SPADQLASLSLNDNLVA  136
            ALK+KVAEA++V RNV Q +   +P  QLA L+L+D +++
Sbjct  527  ALKSKVAEAMDVLRNVAQQQNPNAPTSQLAGLTLSDGIIS  566



>gb|ABK94932.1| unknown [Populus trichocarpa]
Length=408

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALA+ALANA P+QQRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  309  PIPIGALATALANATPDQQRTMLGENLYPLVEQLEPEAAAKVTGMLLEMDQTEVLHLLES  368

Query  252  PealkakvaealevXRNV-QQAKSPADQLASLSLNDNL  142
            PEALK+KV EA+EV R V QQA   ADQLASLSLNDNL
Sbjct  369  PEALKSKVNEAMEVLRTVQQQATGTADQLASLSLNDNL  406



>emb|CDY08990.1| BnaC01g31010D [Brassica napus]
Length=99

 Score =   107 bits (268),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALAS LAN  PEQQRTMLG+NLYPLV++LE E AAKVTGMLLEMDQTEVLHLL S
Sbjct  7    PLPIGALASNLANTSPEQQRTMLGDNLYPLVEKLEVESAAKVTGMLLEMDQTEVLHLLAS  66

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLN  151
            PEAL+AKV EA++V R+V  A   A+QLASL+L+
Sbjct  67   PEALEAKVVEAMDVLRSV-AAGGAAEQLASLNLS  99



>ref|XP_010519297.1| PREDICTED: polyadenylate-binding protein 8-like [Tarenaya hassleriana]
Length=649

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 89/99 (90%), Gaps = 1/99 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALASALANA PEQQRTMLGENLYPLV+QLE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  550  PVPIGALASALANASPEQQRTMLGENLYPLVEQLEPDSAAKVTGMLLEMDQTEVLHLLES  609

Query  252  PealkakvaealevXRNV-QQAKSPADQLASLSLNDNLV  139
            PEALKAKVAEA+EV R+V QQA   ADQLASLSL DNLV
Sbjct  610  PEALKAKVAEAMEVLRSVQQQAGGAADQLASLSLKDNLV  648



>ref|XP_006295403.1| hypothetical protein CARUB_v10024499mg [Capsella rubella]
 gb|EOA28301.1| hypothetical protein CARUB_v10024499mg [Capsella rubella]
Length=658

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 87/108 (81%), Gaps = 11/108 (10%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+  + LAS+LAN+ P QQRT+LGE+LYPLVDQ+EHE+AAKVTGMLLEMDQTEVLHLLES
Sbjct  551  PLSASQLASSLANSSPAQQRTLLGESLYPLVDQIEHENAAKVTGMLLEMDQTEVLHLLES  610

Query  252  PealkakvaealevXRNVQQ-----------AKSPADQLASLSLNDNL  142
            PEAL AKV+EAL+V RNV Q           + SP+D LASLS+ND+L
Sbjct  611  PEALNAKVSEALDVLRNVNQPPSTQVSEGSKSGSPSDLLASLSINDHL  658



>ref|XP_010107907.1| Polyadenylate-binding protein 2 [Morus notabilis]
 gb|EXC17307.1| Polyadenylate-binding protein 2 [Morus notabilis]
Length=651

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI A+A+ALANA PEQQRTMLGENLYPLV+QLE ++AAKVTGMLLEMDQTEVLHLLES
Sbjct  550  PIPIGAMATALANATPEQQRTMLGENLYPLVEQLEPDNAAKVTGMLLEMDQTEVLHLLES  609

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R V   QQA + ADQLASLSL DN+V+
Sbjct  610  PEALKAKVAEAMEVLRTVAQQQQAGNAADQLASLSLTDNIVS  651



>emb|CDX89664.1| BnaC03g45780D [Brassica napus]
Length=614

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI ALA++LANA PE QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  523  VPIGALATSLANASPEHQRTMLGENLYPLVEQLEAESAAKVTGMLLEMDQTEVLHLLESP  582

Query  249  ealkakvaealevXRNVQQAKSPADQLASLSLN  151
            EALKAKVAEA++V RNV  A   A+QL+SL+LN
Sbjct  583  EALKAKVAEAMDVLRNV-AAGGAAEQLSSLNLN  614



>ref|XP_010555994.1| PREDICTED: polyadenylate-binding protein 8 [Tarenaya hassleriana]
Length=646

 Score =   115 bits (288),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALASALANA PEQQRTMLGENLYPLV+QLE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  548  PVPIGALASALANASPEQQRTMLGENLYPLVEQLEPDSAAKVTGMLLEMDQTEVLHLLES  607

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R+V Q    ADQLASLSLN N+V+
Sbjct  608  PEALKAKVAEAMEVLRSVHQPAGAADQLASLSLNGNIVS  646



>ref|XP_010417088.1| PREDICTED: polyadenylate-binding protein 4-like [Camelina sativa]
Length=660

 Score =   115 bits (288),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 87/110 (79%), Gaps = 11/110 (10%)
 Frame = -3

Query  438  AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLL  259
            A P+    LA++LANA P QQRT+LGE+LYPLVDQ+EHE+AAKVTGMLLEMDQTEVLHLL
Sbjct  551  AQPMSAGQLATSLANATPAQQRTLLGESLYPLVDQIEHENAAKVTGMLLEMDQTEVLHLL  610

Query  258  ESPealkakvaealevXRNVQQ-----------AKSPADQLASLSLNDNL  142
            ESPEAL AKV+EAL+V RNV Q           + SP+D LASLS+ND+L
Sbjct  611  ESPEALNAKVSEALDVLRNVNQPPSTQGSDGNKSGSPSDLLASLSINDHL  660



>ref|XP_010432464.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=632

 Score =   115 bits (288),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALAS LANA PEQQRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  540  PLPIGALASNLANASPEQQRTMLGENLYPLVEQLETESAAKVTGMLLEMDQTEVLHLLES  599

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLN  151
            PEALKAKVAEA++V R+V  A   A+QLASL+L+
Sbjct  600  PEALKAKVAEAMDVLRSV-AAGGAAEQLASLNLS  632



>ref|XP_010447142.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=632

 Score =   115 bits (287),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALAS LANA PEQQRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  540  PLPIGALASNLANASPEQQRTMLGENLYPLVEQLEAESAAKVTGMLLEMDQTEVLHLLES  599

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLN  151
            PEALKAKVAEA++V R+V  A   A+QLASL+L+
Sbjct  600  PEALKAKVAEAMDVLRSV-AAGGAAEQLASLNLS  632



>ref|XP_006425948.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
 gb|ESR39188.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
Length=652

 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 4/88 (5%)
 Frame = -3

Query  387  PEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevX  208
            PEQQRT+LGENLYPLVDQLEH++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EV 
Sbjct  565  PEQQRTLLGENLYPLVDQLEHDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVL  624

Query  207  RNVQQAK----SPADQLASLSLNDNLVA  136
            RNV Q +    SP D++ASLSLNDN+V+
Sbjct  625  RNVAQQQATGPSPTDRVASLSLNDNIVS  652



>ref|XP_010437669.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=633

 Score =   115 bits (287),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALAS LANA PEQQRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  541  PLPIGALASNLANATPEQQRTMLGENLYPLVEQLEAESAAKVTGMLLEMDQTEVLHLLES  600

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLN  151
            PEALKAKVAEA++V R+V  A   A+QLASL+L+
Sbjct  601  PEALKAKVAEAMDVLRSV-AAGGAAEQLASLNLS  633



>ref|XP_006425947.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
 gb|ESR39187.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
Length=650

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 4/88 (5%)
 Frame = -3

Query  387  PEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevX  208
            PEQQRT+LGENLYPLVDQLEH++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EV 
Sbjct  563  PEQQRTLLGENLYPLVDQLEHDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVL  622

Query  207  RNVQQAK----SPADQLASLSLNDNLVA  136
            RNV Q +    SP D++ASLSLNDN+V+
Sbjct  623  RNVAQQQATGPSPTDRVASLSLNDNIVS  650



>ref|XP_010432462.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010432463.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Camelina 
sativa]
Length=632

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALAS LANA PEQQRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  540  PLPIGALASNLANASPEQQRTMLGENLYPLVEQLEAESAAKVTGMLLEMDQTEVLHLLES  599

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSL  154
            PEALK KVAEA++V R+V  A   A+QLASL+L
Sbjct  600  PEALKTKVAEAMDVLRSV-AAGGAAEQLASLNL  631



>gb|KDO79129.1| hypothetical protein CISIN_1g006290mg [Citrus sinensis]
Length=650

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 4/88 (5%)
 Frame = -3

Query  387  PEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevX  208
            PEQQRT+LGENLYPLVDQLEH++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EV 
Sbjct  563  PEQQRTLLGENLYPLVDQLEHDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVL  622

Query  207  RNVQQAK----SPADQLASLSLNDNLVA  136
            RNV Q +    SP D++ASLSLNDN+V+
Sbjct  623  RNVAQQQATGPSPTDRVASLSLNDNIVS  650



>ref|XP_006842170.1| hypothetical protein AMTR_s00078p00149860 [Amborella trichopoda]
 gb|ERN03845.1| hypothetical protein AMTR_s00078p00149860 [Amborella trichopoda]
Length=645

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 83/98 (85%), Gaps = 4/98 (4%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI  LASALA+A PEQQR MLGE L+PLVD++EH+HA KVTGMLLEMDQTEVLHL+ES
Sbjct  549  PVPIGTLASALASATPEQQRVMLGEQLFPLVDRMEHDHAGKVTGMLLEMDQTEVLHLIES  608

Query  252  PealkakvaealevXRNVQQAKSPA---DQLASLSLND  148
            P+ALK KV EALEV R + QA +P+   DQLASLSLN+
Sbjct  609  PDALKTKVGEALEVLR-MAQAAAPSDHTDQLASLSLNE  645



>ref|NP_001275799.1| poly A-binding protein 2 [Citrus sinensis]
 gb|AEV43365.1| poly A-binding protein 2 [Citrus sinensis]
 gb|KDO79128.1| hypothetical protein CISIN_1g006290mg [Citrus sinensis]
Length=652

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 4/88 (5%)
 Frame = -3

Query  387  PEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevX  208
            PEQQRT+LGENLYPLVDQLEH++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EV 
Sbjct  565  PEQQRTLLGENLYPLVDQLEHDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVL  624

Query  207  RNVQQAK----SPADQLASLSLNDNLVA  136
            RNV Q +    SP D++ASLSLNDN+V+
Sbjct  625  RNVAQQQATGPSPTDRVASLSLNDNIVS  652



>ref|NP_179916.1| poly(A) binding protein 4 [Arabidopsis thaliana]
 sp|O22173.1|PABP4_ARATH RecName: Full=Polyadenylate-binding protein 4; Short=PABP-4; 
Short=Poly(A)-binding protein 4 [Arabidopsis thaliana]
 gb|AAB87097.1| putative poly(A) binding protein [Arabidopsis thaliana]
 gb|AAK92796.1| putative poly(A) binding protein [Arabidopsis thaliana]
 gb|AAL85120.1| putative poly(A) binding protein [Arabidopsis thaliana]
 gb|AEC07446.1| poly(A) binding protein 4 [Arabidopsis thaliana]
Length=662

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 85/107 (79%), Gaps = 10/107 (9%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+    LA++LANA P QQRT+LGE+LYPLVDQ+E EHAAKVTGMLLEMDQTEVLHLLES
Sbjct  556  PMSAGQLATSLANATPAQQRTLLGESLYPLVDQIESEHAAKVTGMLLEMDQTEVLHLLES  615

Query  252  PealkakvaealevXRNVQQ----------AKSPADQLASLSLNDNL  142
            PEAL AKV+EAL+V RNV Q          + SP+D LASLS+ND+L
Sbjct  616  PEALNAKVSEALDVLRNVNQPSSQGSEGNKSGSPSDLLASLSINDHL  662



>ref|XP_006494495.1| PREDICTED: polyadenylate-binding protein 4 [Citrus sinensis]
Length=663

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 4/88 (5%)
 Frame = -3

Query  387  PEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevX  208
            PEQQRT+LGENLYPLVDQLEH++AAKVTGMLLEMDQTEVLHLLESPEALKAKVAEA+EV 
Sbjct  576  PEQQRTLLGENLYPLVDQLEHDNAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVL  635

Query  207  RNVQQAK----SPADQLASLSLNDNLVA  136
            RNV Q +    SP D++ASLSLNDN+V+
Sbjct  636  RNVAQQQATGPSPTDRVASLSLNDNIVS  663



>dbj|BAJ53194.1| JHL03K20.3 [Jatropha curcas]
Length=642

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 80/85 (94%), Gaps = 1/85 (1%)
 Frame = -3

Query  387  PEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevX  208
            PEQQRT+LGENLYPLVDQLEHE+AAKVTGMLLEMDQTEVLHLLESPE+L+AKVAEA+EV 
Sbjct  558  PEQQRTLLGENLYPLVDQLEHENAAKVTGMLLEMDQTEVLHLLESPESLEAKVAEAMEVL  617

Query  207  RNV-QQAKSPADQLASLSLNDNLVA  136
            R V QQA SP +++A+LSLN+NLV+
Sbjct  618  RTVQQQANSPTNRMATLSLNENLVS  642



>gb|AAK25927.1|AF360217_1 putative poly(A) binding protein [Arabidopsis thaliana]
Length=662

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 85/107 (79%), Gaps = 10/107 (9%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+    LA++LANA P QQRT+LGE+LYPLVDQ+E EHAAKVTGMLLEMDQTEVLHLLES
Sbjct  556  PMSAGQLATSLANATPAQQRTLLGESLYPLVDQIESEHAAKVTGMLLEMDQTEVLHLLES  615

Query  252  PealkakvaealevXRNVQQ----------AKSPADQLASLSLNDNL  142
            PEAL AKV+EAL+V RNV Q          + SP+D LASLS+ND+L
Sbjct  616  PEALNAKVSEALDVLRNVNQPSSQGSDGNKSGSPSDLLASLSINDHL  662



>ref|XP_006412276.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
 gb|ESQ53729.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
Length=599

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALAS LANA PEQQRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  508  PLPIGALASNLANASPEQQRTMLGENLYPLVEQLEAESAAKVTGMLLEMDQTEVLHLLES  567

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSL  154
            PEALKAKVAEA++V R+V  A   A+QLASL+L
Sbjct  568  PEALKAKVAEAMDVLRSV-AAGGAAEQLASLNL  599



>ref|XP_002878680.1| PAB4 binding protein 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54939.1| PAB4 binding protein 4 [Arabidopsis lyrata subsp. lyrata]
Length=655

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 86/109 (79%), Gaps = 10/109 (9%)
 Frame = -3

Query  438  AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLL  259
            A P+    LA++LANA P QQRT+LGE+LYPLVDQ+EHE+AAKVTGMLLEMDQTEVLHLL
Sbjct  547  AQPMSAGQLATSLANATPAQQRTLLGESLYPLVDQIEHENAAKVTGMLLEMDQTEVLHLL  606

Query  258  ESPealkakvaealevXRNVQQ----------AKSPADQLASLSLNDNL  142
            ESPEAL AKV+EAL+V RNV Q          + SP+D +ASLS+ND+ 
Sbjct  607  ESPEALNAKVSEALDVLRNVNQPSTQVSEGNKSGSPSDLMASLSINDHF  655



>ref|XP_006412275.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
 gb|ESQ53728.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
Length=624

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALAS LANA PEQQRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  533  PLPIGALASNLANASPEQQRTMLGENLYPLVEQLEAESAAKVTGMLLEMDQTEVLHLLES  592

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSL  154
            PEALKAKVAEA++V R+V  A   A+QLASL+L
Sbjct  593  PEALKAKVAEAMDVLRSV-AAGGAAEQLASLNL  624



>ref|XP_010110808.1| Polyadenylate-binding protein 2 [Morus notabilis]
 gb|EXC28180.1| Polyadenylate-binding protein 2 [Morus notabilis]
Length=639

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +PITALA+ALANAPPEQQRTMLGE LYPLVDQLEHE AAKVTGMLLEMDQTEVLHLLESP
Sbjct  546  MPITALATALANAPPEQQRTMLGEALYPLVDQLEHESAAKVTGMLLEMDQTEVLHLLESP  605

Query  249  ealkakvaealevXRNV-QQAKSPADQLASLSL  154
            EALKAKVAEA+EV RNV QQA S ADQLASLSL
Sbjct  606  EALKAKVAEAMEVLRNVAQQANSSADQLASLSL  638



>gb|EMS47633.1| Polyadenylate-binding protein 2 [Triticum urartu]
Length=567

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 85/100 (85%), Gaps = 3/100 (3%)
 Frame = -3

Query  426  PITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPe  247
            PI  L SALANA PEQQRT+LGE+LYPLV++LEH+ AAKVTGMLLEMDQTEVLHLLESPE
Sbjct  468  PIGTLTSALANATPEQQRTILGESLYPLVEKLEHQQAAKVTGMLLEMDQTEVLHLLESPE  527

Query  246  alkakvaealevXRNVQQAK---SPADQLASLSLNDNLVA  136
            ALK+KVAEA++V RNV Q +   +P  QLA L+L+D +++
Sbjct  528  ALKSKVAEAMDVLRNVAQQQNPNAPTSQLAGLTLSDVIIS  567



>ref|XP_002313862.1| polyadenylate-binding family protein [Populus trichocarpa]
 gb|EEE87817.1| polyadenylate-binding family protein [Populus trichocarpa]
Length=642

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALA+ALANA P+QQRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  543  PIPIGALATALANATPDQQRTMLGENLYPLVEQLEPEAAAKVTGMLLEMDQTEVLHLLES  602

Query  252  PealkakvaealevXRNV-QQAKSPADQLASLSLNDNL  142
            PEALK+KV EA+EV R V QQA   ADQLASLSLNDNL
Sbjct  603  PEALKSKVNEAMEVLRTVQQQATGTADQLASLSLNDNL  640



>ref|XP_006283328.1| hypothetical protein CARUB_v10004368mg [Capsella rubella]
 gb|EOA16226.1| hypothetical protein CARUB_v10004368mg [Capsella rubella]
Length=629

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALAS LANA PEQQRTMLGENLYPLV+Q+E E AAKVTGMLLEMDQTEVLHLLES
Sbjct  537  PLPIGALASNLANASPEQQRTMLGENLYPLVEQIEAESAAKVTGMLLEMDQTEVLHLLES  596

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLN  151
            PEALKAKVAEA++V R+V  A   A+QLASL+L+
Sbjct  597  PEALKAKVAEAMDVLRSV-AAGGAAEQLASLNLS  629



>ref|XP_011092554.1| PREDICTED: polyadenylate-binding protein 2-like [Sesamum indicum]
Length=634

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 83/98 (85%), Gaps = 2/98 (2%)
 Frame = -3

Query  435  APVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLE  256
             PVP+  LASALANA P +QRTMLGE+LYPLV+QLEHE AAKVTGMLLEMDQTEVLHLLE
Sbjct  537  GPVPVGTLASALANALPSEQRTMLGESLYPLVEQLEHEMAAKVTGMLLEMDQTEVLHLLE  596

Query  255  SPealkakvaealevXRNVQQ--AKSPADQLASLSLND  148
            SPE+L+AKV EA+EV +N  Q  A S A+QLASL L++
Sbjct  597  SPESLRAKVGEAMEVLKNAPQRHASSTANQLASLVLSE  634



>ref|XP_010447143.1| PREDICTED: polyadenylate-binding protein 2 [Camelina sativa]
Length=632

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALAS LANA PEQQRTMLGENLYPLV+Q+E E AAKVTGMLLEMDQTEVLHLLES
Sbjct  540  PLPIGALASNLANASPEQQRTMLGENLYPLVEQVEAESAAKVTGMLLEMDQTEVLHLLES  599

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLN  151
            PEALKAKVAEA++V R+V  A   A+QLASL+L+
Sbjct  600  PEALKAKVAEAMDVLRSV-AAGGAAEQLASLNLS  632



>gb|KHG04776.1| Polyadenylate-binding 2 -like protein [Gossypium arboreum]
Length=622

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 93/102 (91%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+P+ ALA+ALANA PEQQRTMLGE+LYPLV++LE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  521  PMPVPALATALANATPEQQRTMLGESLYPLVERLERDSAAKVTGMLLEMDQTEVLHLLES  580

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R+V   QQA +PAD+LASLSLNDNLV+
Sbjct  581  PEALKAKVAEAMEVLRSVAAQQQANNPADRLASLSLNDNLVS  622



>ref|NP_001062583.1| Os09g0115400 [Oryza sativa Japonica Group]
 dbj|BAD16229.1| putative poly(A)-binding protein [Oryza sativa Japonica Group]
 dbj|BAF24497.1| Os09g0115400 [Oryza sativa Japonica Group]
 gb|EAZ08133.1| hypothetical protein OsI_30396 [Oryza sativa Indica Group]
 gb|EAZ43770.1| hypothetical protein OsJ_28392 [Oryza sativa Japonica Group]
 gb|ACA50516.1| poly(A)-binding protein [Oryza sativa Japonica Group]
 dbj|BAG90618.1| unnamed protein product [Oryza sativa Japonica Group]
Length=662

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 88/102 (86%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPI ALA+ALANA P+QQR MLGENLYPLVDQLEHE AAKVTGMLLEMDQTEVLHLLES
Sbjct  560  PVPIGALATALANAAPDQQRMMLGENLYPLVDQLEHEQAAKVTGMLLEMDQTEVLHLLES  619

Query  252  PealkakvaealevXRNVQQAK---SPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R  QQ +   +P  QLASLSLND +V+
Sbjct  620  PEALKAKVAEAMEVLRTAQQIQTNATPEQQLASLSLNDGVVS  661



>gb|KHG16756.1| Polyadenylate-binding 2 -like protein [Gossypium arboreum]
Length=514

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 84/92 (91%), Gaps = 3/92 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+P+TALA++LANA PEQQRTMLGE+LYPLV++LE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  418  PMPVTALATSLANAAPEQQRTMLGESLYPLVERLERDAAAKVTGMLLEMDQTEVLHLLES  477

Query  252  PealkakvaealevXRNV---QQAKSPADQLA  166
            PEALKAKVAEA+EV R+V   QQ+ +PADQL+
Sbjct  478  PEALKAKVAEAMEVLRSVDAQQQSNNPADQLS  509



>ref|XP_010531254.1| PREDICTED: polyadenylate-binding protein 4 [Tarenaya hassleriana]
Length=644

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 85/106 (80%), Gaps = 7/106 (7%)
 Frame = -3

Query  438  AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLL  259
            A P+   ALASALAN  P QQRT+LGE+LYPLVDQ+E E+AAKVTGMLLEMDQTEVLHL+
Sbjct  539  AQPLSTGALASALANGTPAQQRTLLGEHLYPLVDQMESENAAKVTGMLLEMDQTEVLHLI  598

Query  258  ESPealkakvaealevXRNV-------QQAKSPADQLASLSLNDNL  142
            ESP+ALKAKVAEA++V RNV         + SP D+LASLS++D L
Sbjct  599  ESPDALKAKVAEAMDVLRNVGPPLVSSSGSNSPIDKLASLSMDDKL  644



>emb|CDY67364.1| BnaA03g57630D [Brassica napus]
Length=293

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI ALA++LANA PE QR MLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  202  VPIGALATSLANASPEHQRAMLGENLYPLVEQLEAESAAKVTGMLLEMDQTEVLHLLESP  261

Query  249  ealkakvaealevXRNVQQAKSPADQLASLSLN  151
            EALKAKVAEA++V R+V    + A+QLASL+LN
Sbjct  262  EALKAKVAEAMDVLRSVAGGGA-AEQLASLNLN  293



>gb|KCW55175.1| hypothetical protein EUGRSUZ_I01129 [Eucalyptus grandis]
Length=471

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITALASALANA P+QQRTMLGE+LYPLV+QLE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  371  PLPITALASALANASPDQQRTMLGESLYPLVEQLEPDAAAKVTGMLLEMDQTEVLHLLES  430

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLV  139
            P+ALKAKVAEA+EV R+V  QQA    DQLASLSLNDNLV
Sbjct  431  PDALKAKVAEAMEVLRSVAQQQASGAVDQLASLSLNDNLV  470



>ref|XP_002300227.1| polyadenylate-binding family protein [Populus trichocarpa]
 gb|EEE85032.1| polyadenylate-binding family protein [Populus trichocarpa]
Length=644

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +P+ ALA+ALANA P+QQRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  546  IPVGALATALANATPDQQRTMLGENLYPLVEQLEPEAAAKVTGMLLEMDQTEVLHLLESP  605

Query  249  ealkakvaealevXRNV-QQAKSPADQLASLSLNDNLV  139
            EALKAKV EA+EV R V QQA   ADQLASLSLNDNLV
Sbjct  606  EALKAKVNEAMEVLRTVQQQATGTADQLASLSLNDNLV  643



>ref|XP_002510185.1| polyadenylate-binding protein, putative [Ricinus communis]
 gb|EEF52372.1| polyadenylate-binding protein, putative [Ricinus communis]
Length=658

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 90/102 (88%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            PVPITALA+ALANA PE QRT+LGE+LYPLVDQLEHE AAKVTGMLLEMDQTEVLHLLES
Sbjct  557  PVPITALATALANASPEHQRTLLGESLYPLVDQLEHESAAKVTGMLLEMDQTEVLHLLES  616

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R+V   Q A + ADQL SLSLND LV+
Sbjct  617  PEALKAKVAEAMEVLRSVAAQQHANNTADQLTSLSLNDGLVS  658



>ref|XP_009136273.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Brassica 
rapa]
Length=614

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI ALA++LANA PE QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  523  VPIGALATSLANASPEHQRTMLGENLYPLVEQLEAESAAKVTGMLLEMDQTEVLHLLESP  582

Query  249  ealkakvaealevXRNVQQAKSPADQLASLSLN  151
            EALKAKVAEA++V R+V  A   A+QL+SL+LN
Sbjct  583  EALKAKVAEAMDVLRSV-AAGGAAEQLSSLNLN  614



>ref|XP_009136272.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Brassica 
rapa]
Length=616

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI ALA++LANA PE QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  525  VPIGALATSLANASPEHQRTMLGENLYPLVEQLEAESAAKVTGMLLEMDQTEVLHLLESP  584

Query  249  ealkakvaealevXRNVQQAKSPADQLASLSLN  151
            EALKAKVAEA++V R+V  A   A+QL+SL+LN
Sbjct  585  EALKAKVAEAMDVLRSV-AAGGAAEQLSSLNLN  616



>ref|XP_011000130.1| PREDICTED: polyadenylate-binding protein 8-like [Populus euphratica]
Length=644

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +P+ ALA+ALANA P+QQRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  546  IPVGALATALANATPDQQRTMLGENLYPLVEQLEPEAAAKVTGMLLEMDQTEVLHLLESP  605

Query  249  ealkakvaealevXRNV-QQAKSPADQLASLSLNDNLV  139
            EALK+KV EA++V R V QQA   ADQLASLSLNDNLV
Sbjct  606  EALKSKVNEAMDVLRTVQQQATGTADQLASLSLNDNLV  643



>ref|XP_007042478.1| Poly(A) binding protein 8 [Theobroma cacao]
 gb|EOX98309.1| Poly(A) binding protein 8 [Theobroma cacao]
Length=645

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA P+QQRTMLGENLYPLV+QLE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  547  PIPIGALASALANASPDQQRTMLGENLYPLVEQLEPDAAAKVTGMLLEMDQTEVLHLLES  606

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R+V Q +   +QLASLSLNDNLV+
Sbjct  607  PEALKAKVAEAMEVLRSVAQQQQTGEQLASLSLNDNLVS  645



>gb|AID60122.1| poly(A) binding protein 8 [Brassica napus]
 gb|AID60165.1| polyA binding protein 8 [Brassica napus]
Length=606

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +PI ALAS LANA PEQQRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  515  MPIGALASNLANASPEQQRTMLGENLYPLVEQLEAESAAKVTGMLLEMDQTEVLHLLESP  574

Query  249  ealkakvaealevXRNVQQAKSPADQLASLSLN  151
            EALK KVAEA++V R+V  A   A+QLASL+L+
Sbjct  575  EALKDKVAEAMDVLRSV-AAGGAAEQLASLNLS  606



>emb|CDX75397.1| BnaA01g03050D [Brassica napus]
Length=616

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +PI ALAS LANA PEQQRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  525  MPIGALASNLANASPEQQRTMLGENLYPLVEQLEAESAAKVTGMLLEMDQTEVLHLLESP  584

Query  249  ealkakvaealevXRNVQQAKSPADQLASLSLN  151
            EALK KVAEA++V R+V  A   A+QLASL+L+
Sbjct  585  EALKDKVAEAMDVLRSV-AAGGAAEQLASLNLS  616



>ref|XP_002869174.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45433.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=625

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALAS LANA PEQQRTMLGE+LYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  533  PLPIGALASHLANASPEQQRTMLGESLYPLVEQLEAESAAKVTGMLLEMDQTEVLHLLES  592

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLN  151
            PEALKAKVAEA++V R+V  A   A+QLASL+L+
Sbjct  593  PEALKAKVAEAMDVLRSV-AAGGAAEQLASLNLS  625



>ref|XP_006661030.1| PREDICTED: polyadenylate-binding protein 8-like, partial [Oryza 
brachyantha]
Length=627

 Score =   112 bits (280),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 88/102 (86%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALA+ALANA P+QQR MLGENLYPLVDQLEHE AAKVTGMLLEMDQTEVLHLLES
Sbjct  525  PIPIGALATALANAAPDQQRMMLGENLYPLVDQLEHEQAAKVTGMLLEMDQTEVLHLLES  584

Query  252  PealkakvaealevXRNVQQAK---SPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R  QQ +   +P  QLASL+LND +V+
Sbjct  585  PEALKAKVAEAMEVLRTAQQIQTNATPEQQLASLTLNDGVVS  626



>ref|XP_003580095.1| PREDICTED: polyadenylate-binding protein 2-like [Brachypodium 
distachyon]
Length=661

 Score =   112 bits (280),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 83/100 (83%), Gaps = 3/100 (3%)
 Frame = -3

Query  426  PITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPe  247
            PI  L SALANA P+QQRT+LGE+LYPLV+ LEH  AAKVTGMLLEMDQTEVLHLLESPE
Sbjct  562  PIGTLTSALANATPDQQRTLLGESLYPLVELLEHNQAAKVTGMLLEMDQTEVLHLLESPE  621

Query  246  alkakvaealevXRNVQQAK---SPADQLASLSLNDNLVA  136
            ALK+KVAEA++V RNV Q +   +P  QLA LS+ D++++
Sbjct  622  ALKSKVAEAMDVLRNVAQQQNPNAPTSQLAGLSMTDSIIS  661



>ref|XP_010028424.1| PREDICTED: polyadenylate-binding protein 2 [Eucalyptus grandis]
 gb|KCW55174.1| hypothetical protein EUGRSUZ_I01129 [Eucalyptus grandis]
Length=646

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PITALASALANA P+QQRTMLGE+LYPLV+QLE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  546  PLPITALASALANASPDQQRTMLGESLYPLVEQLEPDAAAKVTGMLLEMDQTEVLHLLES  605

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLV  139
            P+ALKAKVAEA+EV R+V  QQA    DQLASLSLNDNLV
Sbjct  606  PDALKAKVAEAMEVLRSVAQQQASGAVDQLASLSLNDNLV  645



>ref|XP_008364810.1| PREDICTED: polyadenylate-binding protein 8-like [Malus domestica]
Length=652

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 89/101 (88%), Gaps = 3/101 (3%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI ALA+ALANA PEQQRTMLGENLYPLV+QLE ++AAKVTGMLLEMDQTEVLHLLESP
Sbjct  552  VPIGALATALANATPEQQRTMLGENLYPLVEQLEPDNAAKVTGMLLEMDQTEVLHLLESP  611

Query  249  ealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            EALKAKVAEA++V RNV   QQ  + ADQL SLSLN NLV+
Sbjct  612  EALKAKVAEAMDVLRNVAQQQQVGNAADQLGSLSLNGNLVS  652



>emb|CDY62723.1| BnaC03g77220D [Brassica napus]
Length=617

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 82/94 (87%), Gaps = 1/94 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI  LAS LANA PEQQRTMLGENLYPLV++LE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  525  PLPIGTLASNLANASPEQQRTMLGENLYPLVEKLEAESAAKVTGMLLEMDQTEVLHLLES  584

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLN  151
            PEAL+AKVAEA++V R+V  A   A+QLASL+L+
Sbjct  585  PEALEAKVAEAMDVLRSV-AAGGAAEQLASLNLS  617



>ref|XP_010691731.1| PREDICTED: polyadenylate-binding protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=667

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 85/107 (79%), Gaps = 11/107 (10%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VP+  LA+ LANA PE QR +LGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  560  VPVGTLATLLANATPEHQRLLLGENLYPLVEQLEPEMAAKVTGMLLEMDQTEVLHLLESP  619

Query  249  ealkakvaealevXRNVQQ-----------AKSPADQLASLSLNDNL  142
            +ALKAKV+EA+EV RNV Q           + +PADQL++LSLNDNL
Sbjct  620  DALKAKVSEAMEVLRNVAQQQQQQQQQQQPSSNPADQLSALSLNDNL  666



>emb|CDY51957.1| BnaA08g11610D [Brassica napus]
Length=619

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 82/94 (87%), Gaps = 1/94 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI  LAS LANA PEQQRTMLGENLYPLV++LE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  527  PLPIGTLASNLANASPEQQRTMLGENLYPLVEKLEAESAAKVTGMLLEMDQTEVLHLLES  586

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLN  151
            PEAL+AKVAEA++V R+V  A   A+QLASL+L+
Sbjct  587  PEALEAKVAEAMDVLRSV-AAGGAAEQLASLNLS  619



>ref|XP_003607922.1| Poly(A)-binding protein [Medicago truncatula]
 gb|AES90119.1| polyadenylate-binding protein [Medicago truncatula]
Length=654

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 78/88 (89%), Gaps = 2/88 (2%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +PI ALAS LANA PEQQRTMLGENLYPLV+QLE ++AAKVTGMLLEMDQTEVLHLLESP
Sbjct  555  IPIGALASHLANASPEQQRTMLGENLYPLVEQLEPDNAAKVTGMLLEMDQTEVLHLLESP  614

Query  249  ealkakvaealevXRNV--QQAKSPADQ  172
            EALKAKVAEA++V RNV  QQA   ADQ
Sbjct  615  EALKAKVAEAMDVLRNVAQQQAGGAADQ  642



>ref|XP_009108756.1| PREDICTED: polyadenylate-binding protein 2 [Brassica rapa]
Length=619

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 82/94 (87%), Gaps = 1/94 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI  LAS LANA PEQQRTMLGENLYPLV++LE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  527  PLPIGTLASNLANASPEQQRTMLGENLYPLVEKLEAESAAKVTGMLLEMDQTEVLHLLES  586

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLN  151
            PEAL+AKVAEA++V R+V  A   A+QLASL+L+
Sbjct  587  PEALEAKVAEAMDVLRSV-AAGGAAEQLASLNLS  619



>ref|XP_010429282.1| PREDICTED: polyadenylate-binding protein 4 [Camelina sativa]
Length=662

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 85/108 (79%), Gaps = 11/108 (10%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+    LA++LANA P QQRT+LGE+LYPLVD +EHE+AAKVTGMLLEMDQTEVLHLLES
Sbjct  555  PMSAGQLATSLANATPAQQRTLLGESLYPLVDLIEHENAAKVTGMLLEMDQTEVLHLLES  614

Query  252  PealkakvaealevXRNVQQ-----------AKSPADQLASLSLNDNL  142
            PEAL AKV+EAL+V RNV Q           + SP+D LASLS+ND+L
Sbjct  615  PEALNAKVSEALDVLRNVNQPPSTQGSEGNKSGSPSDLLASLSINDHL  662



>emb|CDX69025.1| BnaC01g04280D [Brassica napus]
Length=611

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +PI ALAS LANA PEQQRTMLGENLYPLV+QLE + AAKVTGMLLEMDQTEVLHLLESP
Sbjct  520  MPIGALASNLANASPEQQRTMLGENLYPLVEQLEADSAAKVTGMLLEMDQTEVLHLLESP  579

Query  249  ealkakvaealevXRNVQQAKSPADQLASLSLN  151
            EALK KVAEA++V R+V  A   A+QLASL+L+
Sbjct  580  EALKDKVAEAMDVLRSV-AAGGAAEQLASLNLS  611



>ref|XP_010261307.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
2 [Nelumbo nucifera]
Length=829

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  435  APVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLE  256
             PVPIT LASALA+A PE QR MLGE L+PLV+++EH+ A KVTGMLLEMDQTEVLHL+E
Sbjct  734  GPVPITTLASALASASPEHQRLMLGEQLFPLVERIEHDLAGKVTGMLLEMDQTEVLHLIE  793

Query  255  SPealkakvaealevXRNVQQAKSPADQLASLSLND  148
            SP+ALK KVAEAL+V R        +DQL SLSLND
Sbjct  794  SPDALKKKVAEALDVLRLAATGSDASDQLGSLSLND  829



>ref|XP_002448132.1| hypothetical protein SORBIDRAFT_06g021850 [Sorghum bicolor]
 gb|EES12460.1| hypothetical protein SORBIDRAFT_06g021850 [Sorghum bicolor]
Length=664

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 3/99 (3%)
 Frame = -3

Query  423  ITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPea  244
            I  L SALANA PEQQRT+LGENLYPLV+QLE   AAKVTGMLLEMDQTEVLHLLESP+A
Sbjct  566  IGTLTSALANANPEQQRTILGENLYPLVEQLEPNQAAKVTGMLLEMDQTEVLHLLESPDA  625

Query  243  lkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            LK+KVAEA++V RNV   Q   +P +QLA+LSL + +++
Sbjct  626  LKSKVAEAMDVLRNVAHQQNPNTPTNQLAALSLTEGIIS  664



>gb|AFW58788.1| hypothetical protein ZEAMMB73_448418 [Zea mays]
Length=212

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 80/99 (81%), Gaps = 3/99 (3%)
 Frame = -3

Query  423  ITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPea  244
            I  L SALANA PEQQRT+LGENLYPLV+QLE   AAKVTGMLLEMDQTEVLHLLESP+A
Sbjct  114  IGTLTSALANANPEQQRTILGENLYPLVEQLEPNQAAKVTGMLLEMDQTEVLHLLESPDA  173

Query  243  lkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            LK+KVAEA++V RNV   Q    P  QLA+LSL + +++
Sbjct  174  LKSKVAEAMDVLRNVAHQQNPNLPTSQLAALSLTEGIMS  212



>dbj|BAD94856.1| poly(A)-binding protein [Arabidopsis thaliana]
Length=126

 Score =   103 bits (257),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+ I ALAS L+NA PEQQRTMLGE LYPLV+Q+E E AAKVTGMLLEMDQTEVLHLLES
Sbjct  34   PLTIGALASNLSNATPEQQRTMLGEVLYPLVEQVEAESAAKVTGMLLEMDQTEVLHLLES  93

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLN  151
            PEALKAKVAEA++V R+V  A    +QLASL+L+
Sbjct  94   PEALKAKVAEAMDVLRSV-AAGGATEQLASLNLS  126



>gb|EYU37653.1| hypothetical protein MIMGU_mgv1a002809mg [Erythranthe guttata]
Length=635

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = -3

Query  438  AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLL  259
            + P PI AL SALAN+ P +QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLL
Sbjct  540  SRPTPIGALTSALANSSPTEQRTMLGENLYPLVEQLEPETAAKVTGMLLEMDQTEVLHLL  599

Query  258  ESPealkakvaealevXRNVQQAKSPADQLASLSLND  148
            ESPEALKAKV EA+EV RNV   ++   QLASLSL +
Sbjct  600  ESPEALKAKVVEAMEVLRNVSNDQA-TKQLASLSLKE  635



>ref|XP_011092553.1| PREDICTED: polyadenylate-binding protein 2-like [Sesamum indicum]
Length=644

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 88/97 (91%), Gaps = 2/97 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA P +QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  548  PIPIGALASALANASPSEQRTMLGENLYPLVEQLEPETAAKVTGMLLEMDQTEVLHLLES  607

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLND  148
            PEALKAKVAEA++V RNV  QQA +PA+QLASLSLN+
Sbjct  608  PEALKAKVAEAMDVLRNVSQQQASNPAEQLASLSLNE  644



>ref|XP_009117148.1| PREDICTED: polyadenylate-binding protein 2 [Brassica rapa]
Length=613

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 80/93 (86%), Gaps = 1/93 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +PI ALAS LANA PEQQR MLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  522  MPIGALASNLANASPEQQRMMLGENLYPLVEQLEAESAAKVTGMLLEMDQTEVLHLLESP  581

Query  249  ealkakvaealevXRNVQQAKSPADQLASLSLN  151
            EALK KVAEA++V R+V  A   A+QLASL+L+
Sbjct  582  EALKDKVAEAMDVLRSV-AAGGAAEQLASLNLS  613



>gb|KDP31970.1| hypothetical protein JCGZ_12431 [Jatropha curcas]
Length=642

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 79/85 (93%), Gaps = 1/85 (1%)
 Frame = -3

Query  387  PEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPealkakvaealevX  208
            PEQQRT+LGENLYPLVDQL HE+AAKVTGMLLE+DQTEVLHLLESPE+L+AKVAEA+EV 
Sbjct  558  PEQQRTLLGENLYPLVDQLVHENAAKVTGMLLEVDQTEVLHLLESPESLEAKVAEAMEVL  617

Query  207  RNV-QQAKSPADQLASLSLNDNLVA  136
            R V QQA SP +++A+LSLN+NLV+
Sbjct  618  RTVQQQANSPTNRMATLSLNENLVS  642



>ref|XP_004291087.1| PREDICTED: polyadenylate-binding protein 2-like [Fragaria vesca 
subsp. vesca]
Length=631

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +P+ ALAS+LANA PE+QRTMLGE LYP V+ LE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  534  MPVPALASSLANASPEEQRTMLGEALYPQVNALEPESAAKVTGMLLEMDQTEVLHLLESP  593

Query  249  ealkakvaealevXRNV--QQAKSPADQLASLSLNDNL  142
            EALKAKVAEA+EV RNV   Q  +  DQLAS+SL+D L
Sbjct  594  EALKAKVAEAIEVLRNVTQHQVNNSGDQLASISLSDEL  631



>ref|NP_001151785.1| LOC100285420 [Zea mays]
 gb|ACG44303.1| polyadenylate-binding protein 2 [Zea mays]
 tpg|DAA37055.1| TPA: polyadenylate-binding protein 2 [Zea mays]
Length=660

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 81/99 (82%), Gaps = 3/99 (3%)
 Frame = -3

Query  423  ITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPea  244
            I  L SALANA PEQQRT+LGENLYPLV+QLE   AAKVTGMLLEMDQTEVLHLLESP+A
Sbjct  562  IGTLTSALANANPEQQRTILGENLYPLVEQLEPNQAAKVTGMLLEMDQTEVLHLLESPDA  621

Query  243  lkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            LK+KVAEA++V  NV   Q A +P  QLA+LSL + +++
Sbjct  622  LKSKVAEAMDVLHNVAHQQNANTPTSQLAALSLTEGIIS  660



>gb|KFK30042.1| hypothetical protein AALP_AA7G209600 [Arabis alpina]
Length=632

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALAS LA+A PEQQRTMLGE+LYPLV+QLE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  540  PLPIGALASNLAHASPEQQRTMLGESLYPLVEQLEADSAAKVTGMLLEMDQTEVLHLLES  599

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLN  151
            PEALKAKV+EA++V R+V  A   A+QLASL+L+
Sbjct  600  PEALKAKVSEAMDVLRSV-AAGGAAEQLASLNLS  632



>gb|KJB58541.1| hypothetical protein B456_009G214100 [Gossypium raimondii]
Length=650

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 90/101 (89%), Gaps = 2/101 (2%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+P+ ALA+ALANA PEQQRTMLGE+LYPLV++LE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  550  PMPVPALATALANATPEQQRTMLGESLYPLVERLERDSAAKVTGMLLEMDQTEVLHLLES  609

Query  252  PealkakvaealevXRNV--QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV      QQA +PAD+LASLSLNDNLV+
Sbjct  610  PEALKAKVAEAMEVLSVAAQQQANNPADRLASLSLNDNLVS  650



>emb|CDY38939.1| BnaA04g13600D [Brassica napus]
Length=644

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 84/105 (80%), Gaps = 8/105 (8%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+   ALAS+L+ A P QQRT+LGE LYPLV+++EHE+AAKVTGMLLEMDQTEVLHL+ES
Sbjct  540  PMSAGALASSLSQASPAQQRTILGETLYPLVNKIEHENAAKVTGMLLEMDQTEVLHLIES  599

Query  252  PealkakvaealevXRNVQQ--------AKSPADQLASLSLNDNL  142
            PEAL AKV+EAL+V RNV Q        + SP+  +A+LS+ND+L
Sbjct  600  PEALNAKVSEALDVLRNVNQPTQGSEGKSGSPSGMMAALSINDHL  644



>ref|XP_009140459.1| PREDICTED: polyadenylate-binding protein 4-like [Brassica rapa]
Length=644

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 84/105 (80%), Gaps = 8/105 (8%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+   ALAS+L+ A P QQRT+LGE LYPLV+++EHE+AAKVTGMLLEMDQTEVLHL+ES
Sbjct  540  PMSAGALASSLSQASPAQQRTILGETLYPLVNKIEHENAAKVTGMLLEMDQTEVLHLIES  599

Query  252  PealkakvaealevXRNVQQ--------AKSPADQLASLSLNDNL  142
            PEAL AKV+EAL+V RNV Q        + SP+  +A+LS+ND+L
Sbjct  600  PEALNAKVSEALDVLRNVNQPTQGSEGKSGSPSGMMAALSINDHL  644



>ref|XP_008663371.1| PREDICTED: polyadenylate-binding protein 2-like [Zea mays]
Length=652

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 80/99 (81%), Gaps = 3/99 (3%)
 Frame = -3

Query  423  ITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPea  244
            I  L SALANA PEQQRT+LGENLYPLV+QLE   AAKVTGMLLEMDQTEVLHLLESP+A
Sbjct  554  IGTLTSALANANPEQQRTILGENLYPLVEQLEPNQAAKVTGMLLEMDQTEVLHLLESPDA  613

Query  243  lkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            LK+KVAEA++V RNV   Q    P  QLA+LSL + +++
Sbjct  614  LKSKVAEAMDVLRNVAHQQNPNLPTSQLAALSLTEGIMS  652



>ref|XP_002285190.1| PREDICTED: polyadenylate-binding protein 2 [Vitis vinifera]
 emb|CAN65906.1| hypothetical protein VITISV_004873 [Vitis vinifera]
Length=648

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +P+ ALA+ALANAPP +QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  553  IPVGALATALANAPPAEQRTMLGENLYPLVEQLEPEMAAKVTGMLLEMDQTEVLHLLESP  612

Query  249  ealkakvaealevXRNV  199
            +ALKAKVAEA+EV RNV
Sbjct  613  DALKAKVAEAMEVLRNV  629



>emb|CBI32381.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +P+ ALA+ALANAPP +QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  671  IPVGALATALANAPPAEQRTMLGENLYPLVEQLEPEMAAKVTGMLLEMDQTEVLHLLESP  730

Query  249  ealkakvaealevXRNV  199
            +ALKAKVAEA+EV RNV
Sbjct  731  DALKAKVAEAMEVLRNV  747



>ref|XP_002307526.2| hypothetical protein POPTR_0005s22040g [Populus trichocarpa]
 gb|EEE94522.2| hypothetical protein POPTR_0005s22040g [Populus trichocarpa]
Length=649

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = -3

Query  435  APVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLE  256
            APVPI+AL +ALA+A PE++  MLGE LYPLV++LE +H AKVTGMLLEMDQTEVLHL+E
Sbjct  555  APVPISALTTALASATPEKRMVMLGEQLYPLVERLEPDHVAKVTGMLLEMDQTEVLHLIE  614

Query  255  SPealkakvaealevXRNVQQAKSPADQLASLSLND  148
            SP+ALK KVAEA++V + V  A S  DQL SL+LND
Sbjct  615  SPDALKKKVAEAMQVLQEV-GASSVGDQLGSLALND  649



>ref|XP_001761821.1| predicted protein [Physcomitrella patens]
 gb|EDQ73262.1| predicted protein [Physcomitrella patens]
Length=153

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI+ALASALA+APP+QQR MLGE LYPLVDQLEH+ A KVTGMLLEMDQTEVLHL+ES
Sbjct  56   PLPISALASALASAPPDQQRAMLGEQLYPLVDQLEHDFAGKVTGMLLEMDQTEVLHLIES  115

Query  252  PealkakvaealevXRNVQQAKS-PADQLASLSLNDN  145
            P+ALKAKVAEA+EV R  Q   S P DQL +LS++D+
Sbjct  116  PDALKAKVAEAMEVLRMAQAVPSAPTDQLGNLSISDS  152



>ref|XP_002863435.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39694.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=341

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI ALA+ LANA PEQQRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  254  VPIGALATQLANAAPEQQRTMLGENLYPLVEQLEPESAAKVTGMLLEMDQTEVLHLLESP  313



>ref|XP_011000826.1| PREDICTED: polyadenylate-binding protein 8-like [Populus euphratica]
Length=643

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +P+ ALA+ALANA P+QQRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVL LLESP
Sbjct  545  IPVGALATALANATPDQQRTMLGENLYPLVEQLEPEAAAKVTGMLLEMDQTEVLLLLESP  604

Query  249  ealkakvaealevXRNV-QQAKSPADQLASLSLNDNL  142
            EALK KV EA+EV R V QQA   ADQLASLSLNDNL
Sbjct  605  EALKLKVNEAMEVLRTVQQQATGTADQLASLSLNDNL  641



>ref|XP_002987288.1| hypothetical protein SELMODRAFT_269256 [Selaginella moellendorffii]
 ref|XP_002989195.1| hypothetical protein SELMODRAFT_269487 [Selaginella moellendorffii]
 gb|EFJ09789.1| hypothetical protein SELMODRAFT_269487 [Selaginella moellendorffii]
 gb|EFJ11603.1| hypothetical protein SELMODRAFT_269256 [Selaginella moellendorffii]
Length=567

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 77/96 (80%), Gaps = 1/96 (1%)
 Frame = -3

Query  423  ITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESPea  244
            +  LAS LA+A PEQQR MLGE LYPLVD +EH HA K+TGMLLEMDQTEVLHLLESPEA
Sbjct  473  LAVLASHLASATPEQQRIMLGEQLYPLVDCIEHNHAGKITGMLLEMDQTEVLHLLESPEA  532

Query  243  lkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            L  KV+EA+EV R+ QQ   P D LASLSL+D L++
Sbjct  533  LNLKVSEAMEVLRDSQQRLIPPD-LASLSLDDPLMS  567



>gb|EYU42687.1| hypothetical protein MIMGU_mgv1a002746mg [Erythranthe guttata]
Length=642

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 86/96 (90%), Gaps = 1/96 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALASALANA P +QRTMLGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLES
Sbjct  547  PIPIGALASALANASPTEQRTMLGENLYPLVEQLEPETAAKVTGMLLEMDQTEVLHLLES  606

Query  252  PealkakvaealevXRNV-QQAKSPADQLASLSLND  148
            PEALKAKVAEA+EV RNV Q + + ADQLASLSLN+
Sbjct  607  PEALKAKVAEAMEVLRNVSQNSAATADQLASLSLNE  642



>ref|XP_007201196.1| hypothetical protein PRUPE_ppa002584mg [Prunus persica]
 gb|EMJ02395.1| hypothetical protein PRUPE_ppa002584mg [Prunus persica]
Length=655

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -3

Query  438  AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLL  259
            + P+P++ LASALA+A PE QR MLGE LYPLV+++E EH AKVTGMLLEMDQTEVLHL+
Sbjct  559  SGPLPMSTLASALASATPENQRLMLGEQLYPLVERIEPEHTAKVTGMLLEMDQTEVLHLI  618

Query  258  ESPealkakvaealevXRNVQQAKSPADQLASLSLND  148
            ESP+ALK KVAEA++V R        ADQL SL LN+
Sbjct  619  ESPDALKDKVAEAMDVLRKAATKSEVADQLNSLDLNE  655



>ref|XP_008236485.1| PREDICTED: polyadenylate-binding protein 8 [Prunus mume]
Length=653

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 93/102 (91%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALA+ALANA PEQQRTMLGENLYPLV+QLE E+AAKVTGMLLEMDQTEVLHLLES
Sbjct  552  PIPIGALATALANATPEQQRTMLGENLYPLVEQLEPENAAKVTGMLLEMDQTEVLHLLES  611

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV   QQA + ADQLASLSLN+NLV+
Sbjct  612  PEALKAKVAEAMEVLRNVAQQQQAGNAADQLASLSLNENLVS  653



>ref|XP_007201197.1| hypothetical protein PRUPE_ppa002607mg [Prunus persica]
 gb|EMJ02396.1| hypothetical protein PRUPE_ppa002607mg [Prunus persica]
Length=653

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 93/102 (91%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALA+ALANA PEQQRTMLGENLYPLV+QLE E+AAKVTGMLLEMDQTEVLHLLES
Sbjct  552  PIPIGALATALANATPEQQRTMLGENLYPLVEQLEPENAAKVTGMLLEMDQTEVLHLLES  611

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV RNV   QQA + ADQLASLSLN+NLV+
Sbjct  612  PEALKAKVAEAMEVLRNVAQQQQAGNAADQLASLSLNENLVS  653



>ref|XP_010527159.1| PREDICTED: polyadenylate-binding protein 4-like, partial [Tarenaya 
hassleriana]
Length=636

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+   ALASALANA P QQRT+LGE+LYPLVDQLE ++AAKVTGMLLEMDQTEVLHLLES
Sbjct  542  PLSTGALASALANATPAQQRTLLGEHLYPLVDQLERDNAAKVTGMLLEMDQTEVLHLLES  601

Query  252  PealkakvaealevXRNVQQAKSPADQLASL  160
            PEAL AKVAEA++V RNV Q    +D  + L
Sbjct  602  PEALTAKVAEAMDVLRNVGQQPEASDSGSGL  632



>ref|XP_007153579.1| hypothetical protein PHAVU_003G0475001g, partial [Phaseolus vulgaris]
 gb|ESW25573.1| hypothetical protein PHAVU_003G0475001g, partial [Phaseolus vulgaris]
Length=561

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 88/98 (90%), Gaps = 3/98 (3%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            +PI ALASALANA PEQQRTMLGENLYPLV+QLE ++AAKVTGMLLEMDQTEVLHLLESP
Sbjct  463  IPIGALASALANASPEQQRTMLGENLYPLVEQLEPDNAAKVTGMLLEMDQTEVLHLLESP  522

Query  249  ealkakvaealevXRNV---QQAKSPADQLASLSLNDN  145
            EALKAKVAEA++V RNV   QQA   ADQLASLSLNDN
Sbjct  523  EALKAKVAEAMDVLRNVAQQQQAGGAADQLASLSLNDN  560



>ref|XP_002883899.1| hypothetical protein ARALYDRAFT_899764 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60158.1| hypothetical protein ARALYDRAFT_899764 [Arabidopsis lyrata subsp. 
lyrata]
Length=655

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = -3

Query  429  VPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLESP  250
            VPI ALAS+LANA PE QRT+LGENLYPLV+QLE E AAKVTGMLLEMDQTEVLHLLESP
Sbjct  559  VPIGALASSLANAAPELQRTLLGENLYPLVEQLEAESAAKVTGMLLEMDQTEVLHLLESP  618

Query  249  ealkakvaealevXRNVQQAKSPADQLASLSLNDNLVA  136
            EALKAKVAEA++V R+V    S A+QLASL+LNDNLV+
Sbjct  619  EALKAKVAEAMDVLRSVAAGGS-AEQLASLNLNDNLVS  655



>gb|KJB14629.1| hypothetical protein B456_002G134900 [Gossypium raimondii]
Length=651

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALA+ALANA PEQQRTMLGE+LYPLV++LE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  550  PMPIPALATALANATPEQQRTMLGESLYPLVERLERDAAAKVTGMLLEMDQTEVLHLLES  609

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R+V   QQA + ADQLASLSLNDNLV+
Sbjct  610  PEALKAKVAEAMEVLRSVAAQQQANNQADQLASLSLNDNLVS  651



>gb|AAL86321.1| putative poly(A)-binding protein [Arabidopsis thaliana]
Length=613

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+ I ALAS L+NA PEQQRTMLGE LYPLV+Q+E E AAKVTGMLLEMDQTEVLHLLES
Sbjct  521  PLTIGALASNLSNATPEQQRTMLGEVLYPLVEQVEAESAAKVTGMLLEMDQTEVLHLLES  580

Query  252  PealkakvaealevXRNVQQAKSPADQLASLSLN  151
            PEALKAKVAEA++V R+V  A    +QLASL+L+
Sbjct  581  PEALKAKVAEAMDVLRSV-AAGGATEQLASLNLS  613



>gb|KJB14633.1| hypothetical protein B456_002G134900 [Gossypium raimondii]
Length=645

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 3/102 (3%)
 Frame = -3

Query  432  PVPITALASALANAPPEQQRTMLGENLYPLVDQLEHEHAAKVTGMLLEMDQTEVLHLLES  253
            P+PI ALA+ALANA PEQQRTMLGE+LYPLV++LE + AAKVTGMLLEMDQTEVLHLLES
Sbjct  544  PMPIPALATALANATPEQQRTMLGESLYPLVERLERDAAAKVTGMLLEMDQTEVLHLLES  603

Query  252  PealkakvaealevXRNV---QQAKSPADQLASLSLNDNLVA  136
            PEALKAKVAEA+EV R+V   QQA + ADQLASLSLNDNLV+
Sbjct  604  PEALKAKVAEAMEVLRSVAAQQQANNQADQLASLSLNDNLVS  645



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562388334840