BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS053D08

Length=588
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP09103.1|  unnamed protein product                                246   5e-73   Coffea canephora [robusta coffee]
gb|EPS58613.1|  hypothetical protein M569_16199                         237   2e-72   Genlisea aurea
ref|XP_009612859.1|  PREDICTED: serine/arginine repetitive matrix...    243   3e-71   Nicotiana tomentosiformis
ref|XP_006362050.1|  PREDICTED: serine/arginine repetitive matrix...    242   5e-71   Solanum tuberosum [potatoes]
ref|XP_010256833.1|  PREDICTED: serine/arginine repetitive matrix...    241   9e-71   
gb|AAP06864.1|  SR-rich pre-mRNA splicing activator                     225   9e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010256831.1|  PREDICTED: serine/arginine repetitive matrix...    241   1e-70   Nelumbo nucifera [Indian lotus]
gb|EEC74941.1|  hypothetical protein OsI_10913                          225   1e-70   Oryza sativa Indica Group [Indian rice]
ref|NP_001049684.1|  Os03g0270200                                       223   2e-70   
ref|XP_010326175.1|  PREDICTED: serine/arginine repetitive matrix...    236   2e-70   
ref|XP_009789294.1|  PREDICTED: serine/arginine repetitive matrix...    239   6e-70   Nicotiana sylvestris
gb|KHF99787.1|  Serine/arginine repetitive matrix 1                     238   1e-69   Gossypium arboreum [tree cotton]
ref|XP_011080704.1|  PREDICTED: serine/arginine repetitive matrix...    238   2e-69   Sesamum indicum [beniseed]
ref|XP_011080705.1|  PREDICTED: serine/arginine repetitive matrix...    238   2e-69   Sesamum indicum [beniseed]
ref|XP_011080697.1|  PREDICTED: serine/arginine repetitive matrix...    238   2e-69   Sesamum indicum [beniseed]
ref|XP_011080706.1|  PREDICTED: serine/arginine repetitive matrix...    237   2e-69   Sesamum indicum [beniseed]
ref|XP_010106541.1|  Serine/arginine repetitive matrix protein 1        236   3e-69   
ref|XP_006651246.1|  PREDICTED: serine/arginine repetitive matrix...    226   4e-69   
emb|CBI16084.3|  unnamed protein product                                236   5e-69   Vitis vinifera
ref|XP_008222060.1|  PREDICTED: serine/arginine repetitive matrix...    236   5e-69   
ref|XP_009375945.1|  PREDICTED: serine/arginine repetitive matrix...    236   6e-69   Pyrus x bretschneideri [bai li]
ref|XP_009375946.1|  PREDICTED: serine/arginine repetitive matrix...    236   6e-69   
ref|XP_002280607.2|  PREDICTED: serine/arginine repetitive matrix...    236   7e-69   Vitis vinifera
ref|XP_009375943.1|  PREDICTED: serine/arginine repetitive matrix...    236   7e-69   Pyrus x bretschneideri [bai li]
gb|KDP42210.1|  hypothetical protein JCGZ_02940                         236   8e-69   Jatropha curcas
gb|KEH30183.1|  SR-rich pre-mRNA splicing activator                     236   9e-69   Medicago truncatula
gb|KEH30184.1|  SR-rich pre-mRNA splicing activator                     235   9e-69   Medicago truncatula
gb|AES88912.2|  SR-rich pre-mRNA splicing activator                     236   9e-69   Medicago truncatula
ref|XP_003606715.1|  Serine/arginine repetitive matrix protein          235   1e-68   
ref|XP_008385098.1|  PREDICTED: serine/arginine repetitive matrix...    235   1e-68   
ref|XP_007208179.1|  hypothetical protein PRUPE_ppa001408mg             234   2e-68   
ref|XP_002520517.1|  copper ion binding protein, putative               234   2e-68   
ref|XP_009364350.1|  PREDICTED: serine/arginine repetitive matrix...    234   3e-68   
gb|EEE58772.1|  hypothetical protein OsJ_10288                          230   3e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008356772.1|  PREDICTED: serine/arginine repetitive matrix...    234   3e-68   Malus domestica [apple tree]
ref|XP_008356765.1|  PREDICTED: serine/arginine repetitive matrix...    234   3e-68   Malus domestica [apple tree]
ref|XP_008801619.1|  PREDICTED: serine/arginine repetitive matrix...    234   4e-68   Phoenix dactylifera
ref|XP_008801616.1|  PREDICTED: serine/arginine repetitive matrix...    234   5e-68   Phoenix dactylifera
ref|XP_004507160.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    233   6e-68   
tpg|DAA44607.1|  TPA: hypothetical protein ZEAMMB73_474732              216   1e-67   
ref|XP_002314154.2|  hypothetical protein POPTR_0009s04160g             233   1e-67   Populus trichocarpa [western balsam poplar]
ref|XP_007132039.1|  hypothetical protein PHAVU_011G061700g             233   1e-67   Phaseolus vulgaris [French bean]
gb|KDO66636.1|  hypothetical protein CISIN_1g003124mg                   231   2e-67   Citrus sinensis [apfelsine]
ref|XP_006424900.1|  hypothetical protein CICLE_v10030390mg             231   2e-67   
gb|KDO66635.1|  hypothetical protein CISIN_1g003124mg                   231   2e-67   Citrus sinensis [apfelsine]
ref|XP_006488382.1|  PREDICTED: serine/arginine repetitive matrix...    231   2e-67   
ref|XP_006488383.1|  PREDICTED: serine/arginine repetitive matrix...    231   2e-67   Citrus sinensis [apfelsine]
gb|KDO66634.1|  hypothetical protein CISIN_1g003124mg                   231   2e-67   Citrus sinensis [apfelsine]
gb|KDO66630.1|  hypothetical protein CISIN_1g003124mg                   231   2e-67   Citrus sinensis [apfelsine]
gb|ABF95203.1|  retrotransposon protein, putative, unclassified, ...    231   3e-67   Oryza sativa Japonica Group [Japonica rice]
gb|ABW81062.1|  proline-rich-protein                                    231   5e-67   Arabidopsis lyrata subsp. lyrata
ref|XP_002879206.1|  hypothetical protein ARALYDRAFT_901882             231   6e-67   Arabidopsis lyrata subsp. lyrata
ref|XP_006409968.1|  hypothetical protein EUTSA_v10016250mg             230   6e-67   Eutrema salsugineum [saltwater cress]
ref|XP_006846337.1|  hypothetical protein AMTR_s00012p00256890          231   6e-67   Amborella trichopoda
ref|XP_011461331.1|  PREDICTED: serine/arginine repetitive matrix...    230   6e-67   Fragaria vesca subsp. vesca
ref|XP_011461330.1|  PREDICTED: serine/arginine repetitive matrix...    230   7e-67   Fragaria vesca subsp. vesca
gb|ABW81113.1|  proline-rich protein                                    230   7e-67   Boechera divaricarpa
ref|XP_011032244.1|  PREDICTED: serine/arginine repetitive matrix...    230   9e-67   Populus euphratica
gb|KHN21923.1|  Serine/arginine repetitive matrix protein 1             230   9e-67   Glycine soja [wild soybean]
ref|XP_011032245.1|  PREDICTED: serine/arginine repetitive matrix...    230   1e-66   Populus euphratica
ref|XP_003539073.1|  PREDICTED: serine/arginine repetitive matrix...    230   1e-66   Glycine max [soybeans]
ref|XP_011032246.1|  PREDICTED: serine/arginine repetitive matrix...    229   1e-66   Populus euphratica
ref|XP_010262597.1|  PREDICTED: serine/arginine repetitive matrix...    226   1e-66   
ref|XP_010920517.1|  PREDICTED: serine/arginine repetitive matrix...    228   2e-66   
ref|XP_010920514.1|  PREDICTED: serine/arginine repetitive matrix...    229   2e-66   Elaeis guineensis
ref|XP_004984929.1|  PREDICTED: serine/arginine repetitive matrix...    228   3e-66   Setaria italica
tpg|DAA44610.1|  TPA: hypothetical protein ZEAMMB73_474732              224   3e-66   
ref|XP_002299851.2|  hypothetical protein POPTR_0001s25140g             228   3e-66   Populus trichocarpa [western balsam poplar]
gb|KJB83751.1|  hypothetical protein B456_013G262700                    226   4e-66   Gossypium raimondii
gb|KJB83752.1|  hypothetical protein B456_013G262700                    224   4e-66   Gossypium raimondii
ref|XP_010228813.1|  PREDICTED: serine/arginine repetitive matrix...    221   9e-65   
ref|XP_010228812.1|  PREDICTED: serine/arginine repetitive matrix...    222   7e-64   Brachypodium distachyon [annual false brome]
ref|XP_001762564.1|  predicted protein                                  206   1e-63   
ref|XP_009419742.1|  PREDICTED: serine/arginine repetitive matrix...    221   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006592181.1|  PREDICTED: serine/arginine repetitive matrix...    220   3e-63   Glycine max [soybeans]
gb|KJB83748.1|  hypothetical protein B456_013G262700                    219   4e-63   Gossypium raimondii
gb|KJB83749.1|  hypothetical protein B456_013G262700                    219   5e-63   Gossypium raimondii
gb|KJB83755.1|  hypothetical protein B456_013G262700                    219   6e-63   Gossypium raimondii
ref|XP_010262596.1|  PREDICTED: serine/arginine repetitive matrix...    219   6e-63   
ref|XP_010262593.1|  PREDICTED: serine/arginine repetitive matrix...    219   9e-63   
ref|XP_007016333.1|  Splicing factor PWI domain-containing protei...    218   2e-62   
ref|XP_007016332.1|  Splicing factor PWI domain-containing protei...    218   3e-62   
emb|CAC03679.1|  SRM102                                                 217   5e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010043494.1|  PREDICTED: serine/arginine repetitive matrix...    217   5e-62   
ref|XP_010043495.1|  PREDICTED: serine/arginine repetitive matrix...    217   5e-62   
ref|XP_010510519.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    216   6e-62   
ref|XP_010521878.1|  PREDICTED: serine/arginine repetitive matrix...    216   7e-62   Tarenaya hassleriana [spider flower]
ref|XP_001774764.1|  predicted protein                                  201   9e-62   
ref|NP_180484.2|  splicing factor PWI domain-containing protein         215   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469978.1|  PREDICTED: serine/arginine repetitive matrix...    214   4e-61   Camelina sativa [gold-of-pleasure]
gb|KDO66637.1|  hypothetical protein CISIN_1g003124mg                   213   1e-60   Citrus sinensis [apfelsine]
ref|XP_009416220.1|  PREDICTED: serine/arginine repetitive matrix...    211   4e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416221.1|  PREDICTED: serine/arginine repetitive matrix...    211   4e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006293680.1|  hypothetical protein CARUB_v10022637mg             211   6e-60   Capsella rubella
ref|XP_009144394.1|  PREDICTED: serine/arginine repetitive matrix...    209   2e-59   Brassica rapa
ref|XP_008681507.1|  PREDICTED: uncharacterized protein LOC100304...    209   2e-59   
ref|XP_008681504.1|  PREDICTED: uncharacterized protein LOC100304...    209   2e-59   
gb|EMS59731.1|  Serine/arginine repetitive matrix protein 1             209   2e-59   Triticum urartu
ref|XP_008681486.1|  PREDICTED: uncharacterized protein LOC100304...    209   3e-59   Zea mays [maize]
ref|XP_008681498.1|  PREDICTED: uncharacterized protein LOC100304...    209   3e-59   Zea mays [maize]
emb|CDY65665.1|  BnaC04g54780D                                          209   3e-59   Brassica napus [oilseed rape]
gb|ABW81077.1|  Prp9                                                    209   5e-59   Tarenaya spinosa
ref|XP_004153149.1|  PREDICTED: uncharacterized protein LOC101206654    207   1e-58   
ref|XP_008457448.1|  PREDICTED: serine/arginine repetitive matrix...    207   2e-58   Cucumis melo [Oriental melon]
ref|XP_010685690.1|  PREDICTED: serine/arginine repetitive matrix...    207   2e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004145330.1|  PREDICTED: uncharacterized protein LOC101207842    207   2e-58   Cucumis sativus [cucumbers]
ref|XP_010685692.1|  PREDICTED: serine/arginine repetitive matrix...    206   2e-58   
gb|KHN32153.1|  Serine/arginine repetitive matrix protein 1             205   1e-57   Glycine soja [wild soybean]
ref|XP_002973816.1|  hypothetical protein SELMODRAFT_100233             192   2e-57   
ref|XP_008803113.1|  PREDICTED: serine/arginine repetitive matrix...    204   2e-57   Phoenix dactylifera
ref|XP_008803112.1|  PREDICTED: serine/arginine repetitive matrix...    204   2e-57   Phoenix dactylifera
ref|XP_010937571.1|  PREDICTED: serine/arginine repetitive matrix...    204   2e-57   Elaeis guineensis
ref|XP_010937572.1|  PREDICTED: serine/arginine repetitive matrix...    204   2e-57   
ref|XP_010326174.1|  PREDICTED: serine/arginine repetitive matrix...    202   8e-57   
gb|AAC95214.1|  putative proline-rich protein                           202   9e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004246955.1|  PREDICTED: serine/arginine repetitive matrix...    202   1e-56   Solanum lycopersicum
ref|XP_011035260.1|  PREDICTED: serine/arginine repetitive matrix...    199   1e-55   Populus euphratica
ref|XP_011035259.1|  PREDICTED: serine/arginine repetitive matrix...    199   1e-55   Populus euphratica
ref|XP_011035261.1|  PREDICTED: serine/arginine repetitive matrix...    199   1e-55   Populus euphratica
ref|XP_011035262.1|  PREDICTED: serine/arginine repetitive matrix...    198   2e-55   Populus euphratica
gb|EPB85601.1|  hypothetical protein HMPREF1544_07594                   157   2e-44   Mucor circinelloides f. circinelloides 1006PhL
emb|CDS13551.1|  hypothetical protein LRAMOSA05727                      159   2e-43   Lichtheimia ramosa
emb|CDH50351.1|  pwi domain-containing protein                          159   2e-43   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_006409967.1|  hypothetical protein EUTSA_v10016250mg             163   8e-43   Eutrema salsugineum [saltwater cress]
dbj|GAN09279.1|  PWI domain-containing protein                          154   2e-42   Mucor ambiguus
gb|KDO66638.1|  hypothetical protein CISIN_1g003124mg                   161   4e-42   Citrus sinensis [apfelsine]
emb|CEG73501.1|  Putative PWI domain-containing protein                 151   1e-41   Rhizopus microsporus
emb|CEP13732.1|  hypothetical protein                                   152   1e-41   Parasitella parasitica
gb|KDQ07409.1|  hypothetical protein BOTBODRAFT_120067                  149   2e-41   Botryobasidium botryosum FD-172 SS1
gb|KDD75666.1|  hypothetical protein H632_c561p1                        147   6e-41   Helicosporidium sp. ATCC 50920
emb|CDH50352.1|  pwi domain-containing protein                          148   3e-39   Lichtheimia corymbifera JMRC:FSU:9682
gb|AHH81768.1|  serine/arginine repetitive matrix protein 1-like ...    146   8e-39   Biomphalaria glabrata [bloodfluke planorb]
ref|XP_005988814.1|  PREDICTED: serine/arginine repetitive matrix...    151   2e-38   Latimeria chalumnae
ref|XP_005988815.1|  PREDICTED: serine/arginine repetitive matrix...    151   2e-38   
gb|EMS22473.1|  SR-rich pre-mRNA splicing activator                     146   4e-38   Rhodotorula toruloides NP11
gb|KJB83750.1|  hypothetical protein B456_013G262700                    149   7e-38   Gossypium raimondii
gb|KIM46751.1|  hypothetical protein M413DRAFT_40460                    137   4e-37   Hebeloma cylindrosporum h7
gb|KIJ61599.1|  hypothetical protein HYDPIDRAFT_137559                  140   5e-37   Hydnomerulius pinastri MD-312
gb|KDQ31993.1|  hypothetical protein PLEOSDRAFT_1025753                 136   7e-37   Pleurotus ostreatus PC15
gb|KIO25371.1|  hypothetical protein M407DRAFT_25274                    143   7e-37   Tulasnella calospora MUT 4182
ref|XP_007366678.1|  PWI domain-containing protein                      138   9e-37   Dichomitus squalens LYAD-421 SS1
ref|XP_002124610.1|  PREDICTED: serine/arginine repetitive matrix...    137   1e-36   
ref|XP_009549905.1|  hypothetical protein HETIRDRAFT_243565             135   1e-36   Heterobasidion irregulare TC 32-1
gb|KIM70671.1|  hypothetical protein SCLCIDRAFT_76017                   135   1e-36   Scleroderma citrinum Foug A
dbj|GAA99222.1|  hypothetical protein E5Q_05915                         143   2e-36   Mixia osmundae IAM 14324
gb|KII87767.1|  hypothetical protein PLICRDRAFT_112049                  140   2e-36   Plicaturopsis crispa FD-325 SS-3
emb|CCO26855.1|  PWI domain-containing protein C825,05c                 139   2e-36   Rhizoctonia solani AG-1 IB
ref|XP_002124674.1|  PREDICTED: serine/arginine repetitive matrix...    137   2e-36   
ref|XP_008041955.1|  PWI domain-containing protein                      139   3e-36   Trametes versicolor FP-101664 SS1
ref|XP_005988813.1|  PREDICTED: serine/arginine repetitive matrix...    145   3e-36   Latimeria chalumnae
dbj|BAB25575.1|  unnamed protein product                                138   4e-36   Mus musculus [mouse]
gb|KIP02407.1|  hypothetical protein PHLGIDRAFT_112065                  136   4e-36   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_005988816.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   Latimeria chalumnae
emb|CDO71127.1|  hypothetical protein BN946_scf184844.g131              139   1e-35   Trametes cinnabarina
ref|XP_004341588.1|  PWI domain containing protein                      140   1e-35   Acanthamoeba castellanii str. Neff
gb|KIO14306.1|  hypothetical protein M404DRAFT_992582                   140   1e-35   Pisolithus tinctorius Marx 270
gb|KIK98909.1|  hypothetical protein PAXRUDRAFT_618522                  135   1e-35   Paxillus rubicundulus Ve08.2h10
gb|KIK68799.1|  hypothetical protein GYMLUDRAFT_68631                   139   2e-35   Gymnopus luxurians FD-317 M1
gb|KIK21297.1|  hypothetical protein PISMIDRAFT_66449                   132   2e-35   Pisolithus microcarpus 441
ref|NP_998607.1|  serine/arginine repetitive matrix protein 1           142   2e-35   
ref|XP_006752139.1|  PREDICTED: serine/arginine repetitive matrix...    137   2e-35   Leptonychotes weddellii
gb|ETS63133.1|  hypothetical protein PaG_02911                          137   3e-35   Moesziomyces aphidis DSM 70725
ref|XP_005158559.1|  PREDICTED: serine/arginine repetitive matrix...    142   3e-35   
ref|XP_011060800.1|  PREDICTED: serine/arginine repetitive matrix...    132   3e-35   Acromyrmex echinatior
gb|EDL80753.1|  serine/arginine repetitive matrix 1 (predicted), ...    139   3e-35   Rattus norvegicus [brown rat]
ref|XP_007852080.1|  hypothetical protein Moror_3102                    139   4e-35   
gb|ELU41649.1|  SR-rich pre-mRNA splicing activator                     138   5e-35   Rhizoctonia solani AG-1 IA
dbj|BAK63562.1|  serine/arginine repetitive matrix protein 1            139   5e-35   Pan troglodytes
ref|XP_007424155.1|  PREDICTED: serine/arginine repetitive matrix...    140   7e-35   
dbj|GAC76886.1|  splicing coactivator SRm160/300, subunit SRm160        135   7e-35   Moesziomyces antarcticus T-34
ref|XP_005665165.1|  PREDICTED: serine/arginine repetitive matrix...    140   8e-35   
gb|EUC66839.1|  serine/arginine repetitive matrix-like protein, p...    138   9e-35   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_010824971.1|  PREDICTED: serine/arginine repetitive matrix...    140   9e-35   
ref|XP_007424151.1|  PREDICTED: serine/arginine repetitive matrix...    140   9e-35   Python bivittatus
ref|XP_007424152.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Python bivittatus
ref|XP_005665160.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_005665159.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_003482044.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_005665163.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_004850657.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Heterocephalus glaber [naked mole rat]
ref|XP_003127751.3|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_011282836.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_005665161.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_010343877.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Saimiri boliviensis boliviensis
gb|AAP97290.1|AF419855_1  Ser/Arg-related nuclear matrix protein        140   1e-34   Homo sapiens [man]
ref|XP_005665162.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_007424150.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Python bivittatus
ref|XP_011282833.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_011282835.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_004783474.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_011282834.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_006862351.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Chrysochloris asiatica
ref|XP_003227241.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Anolis carolinensis [Carolina anole]
ref|XP_004425801.1|  PREDICTED: uncharacterized protein LOC101387...    140   1e-34   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_011282832.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_006239247.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Rattus norvegicus [brown rat]
ref|NP_001101456.2|  serine/arginine repetitive matrix protein 1        140   1e-34   Rattus norvegicus [brown rat]
ref|XP_006196850.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Vicugna pacos
ref|XP_004741210.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Mustela putorius furo [black ferret]
ref|XP_003415444.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Loxodonta africana [African bush elephant]
ref|XP_004377162.1|  PREDICTED: uncharacterized protein LOC101351...    140   1e-34   
ref|XP_005665157.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_005665158.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_005353112.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_008531008.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Equus przewalskii [Przewalski horse]
ref|XP_006078051.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_004425800.1|  PREDICTED: uncharacterized protein LOC101387...    140   1e-34   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_005079657.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Mesocricetus auratus [Syrian golden hamster]
ref|XP_007491381.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_008531007.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Equus przewalskii [Przewalski horse]
ref|XP_006078050.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Bubalus bubalis [domestic water buffalo]
ref|XP_005245778.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_003799816.1|  PREDICTED: uncharacterized protein LOC100961...    140   1e-34   Otolemur garnettii
ref|XP_004394850.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_005665155.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_006862350.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Chrysochloris asiatica
ref|XP_005875244.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_006539091.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_006539090.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
gb|AAC17422.1|  plenty-of-prolines-101                                  140   1e-34   Mus musculus [mouse]
ref|XP_010632010.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Fukomys damarensis [Damara mole rat]
ref|XP_011226923.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    140   1e-34   
ref|XP_006777593.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_004850656.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Heterocephalus glaber [naked mole rat]
ref|XP_852745.1|  PREDICTED: serine/arginine repetitive matrix pr...    140   1e-34   Canis lupus familiaris [dogs]
ref|XP_006777592.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Myotis davidii
ref|XP_004850655.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_001252332.2|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_004850654.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Heterocephalus glaber [naked mole rat]
ref|XP_006539092.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Mus musculus [mouse]
ref|XP_005353111.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Microtus ochrogaster [prairie voles]
gb|EXX63474.1|  hypothetical protein RirG_151940                        136   1e-34   Rhizophagus irregularis DAOM 197198w
ref|XP_008961404.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Pan paniscus [bonobo]
ref|XP_008998898.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Callithrix jacchus [common marmoset]
ref|XP_007121181.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_011355919.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Pteropus vampyrus
ref|XP_008573197.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Galeopterus variegatus [Malayan flying lemur]
gb|EDL29985.1|  serine/arginine repetitive matrix 1, isoform CRA_a      140   1e-34   Mus musculus [mouse]
ref|XP_006239246.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Rattus norvegicus [brown rat]
ref|XP_004425799.1|  PREDICTED: uncharacterized protein LOC101387...    140   1e-34   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_003810827.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Pan paniscus [bonobo]
ref|XP_005665156.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_010828369.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Bison bison bison
ref|XP_008146299.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Eptesicus fuscus
ref|XP_007978194.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Chlorocebus sabaeus
ref|XP_004465430.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_004465429.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Dasypus novemcinctus
ref|XP_005353110.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_006539093.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_008118563.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Anolis carolinensis [Carolina anole]
ref|XP_007522639.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Erinaceus europaeus [common hedgehog]
ref|XP_006975730.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Peromyscus maniculatus bairdii
ref|XP_005353108.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Microtus ochrogaster [prairie voles]
ref|XP_005353109.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_004377161.1|  PREDICTED: uncharacterized protein LOC101351...    140   1e-34   Trichechus manatus latirostris
ref|XP_007491380.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Monodelphis domestica
ref|XP_001106234.2|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_001362878.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Monodelphis domestica
ref|XP_010632001.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Fukomys damarensis [Damara mole rat]
ref|XP_007121180.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Physeter catodon
gb|AAH36187.1|  Serine/arginine repetitive matrix 1                     140   1e-34   Homo sapiens [man]
ref|XP_005079656.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_002716019.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Oryctolagus cuniculus [domestic rabbit]
ref|XP_008573198.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Galeopterus variegatus [Malayan flying lemur]
ref|XP_002750477.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Callithrix jacchus [common marmoset]
ref|XP_005317676.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Ictidomys tridecemlineatus
ref|XP_004603509.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Sorex araneus [Eurasian shrew]
ref|NP_005830.2|  serine/arginine repetitive matrix protein 1 iso...    140   1e-34   Homo sapiens [man]
ref|XP_006239245.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Rattus norvegicus [brown rat]
ref|XP_004741209.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_005544475.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Macaca fascicularis [crab eating macaque]
ref|XP_006239244.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Rattus norvegicus [brown rat]
ref|XP_005079655.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Mesocricetus auratus [Syrian golden hamster]
ref|XP_004741208.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Mustela putorius furo [black ferret]
ref|XP_009449174.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_008820511.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Nannospalax galili
ref|XP_004465431.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_006196849.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Vicugna pacos
ref|XP_005977453.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   Pantholops hodgsonii [Tibetan antelope]
ref|XP_004657568.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_010593393.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_006539094.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_005544474.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_004741207.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_008820509.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_008820508.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_005617847.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
ref|XP_004657567.1|  PREDICTED: serine/arginine repetitive matrix...    140   1e-34   
sp|Q52KI8.2|SRRM1_MOUSE  RecName: Full=Serine/arginine repetitive...    140   1e-34   
ref|XP_003799817.1|  PREDICTED: uncharacterized protein LOC100961...    140   1e-34   
ref|XP_010354028.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
gb|AAH94322.1|  Srrm1 protein                                           140   2e-34   
ref|XP_006862349.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_010354027.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005544473.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008263885.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005875243.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_006159462.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008820510.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_007121183.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008263884.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_007491376.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_006078049.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_007933924.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_009200129.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005617846.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
gb|EDL29987.1|  serine/arginine repetitive matrix 1, isoform CRA_c      140   2e-34   
ref|XP_008531006.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_007491377.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_007491375.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005394872.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_007522638.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|NP_001123949.1|  serine/arginine repetitive matrix protein 1 ...    140   2e-34   
ref|XP_010593392.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_001362791.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_006159461.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_010593390.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008998896.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008060364.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_007491378.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005197655.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_006539089.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_007491379.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|NP_058079.2|  serine/arginine repetitive matrix protein 1 iso...    140   2e-34   
ref|XP_010828370.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005617845.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_006104159.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    140   2e-34   
ref|XP_008573196.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_010593391.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008961403.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_011355920.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008961405.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008998899.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005617844.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_010631984.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_006196848.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_010631979.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005245779.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_006159459.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_010631995.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_011355917.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008146298.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_006777590.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005245777.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
dbj|BAH13726.1|  unnamed protein product                                140   2e-34   
ref|XP_006777594.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_011248603.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008998894.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_004678682.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_003891388.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_006777591.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005245775.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_004465432.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_007121179.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_003810828.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005394870.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008263883.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008531004.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008263882.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_011355915.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_006777589.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_004657565.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_011355916.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008998897.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005197653.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008060363.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|NP_001290377.1|  serine/arginine repetitive matrix protein 1 ...    140   2e-34   
ref|XP_004603508.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
gb|EAW95140.1|  serine/arginine repetitive matrix 1, isoform CRA_c      140   2e-34   
gb|EPT02135.1|  hypothetical protein FOMPIDRAFT_1048148                 135   2e-34   
ref|XP_008961402.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_010828368.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005317675.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008961401.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005317673.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005245774.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_006078047.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005875245.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005317674.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_007121182.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008531005.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_010354026.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008531003.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_004657566.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_010354024.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_004465428.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_010354025.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_003891389.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_004657564.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
gb|EHH49656.1|  hypothetical protein EGM_00354                          140   2e-34   
ref|XP_004678681.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_009200124.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_007121178.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|NP_001126712.1|  serine/arginine repetitive matrix protein 1        140   2e-34   
ref|XP_005197654.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005875242.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_006159460.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_004465427.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_009200134.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005544471.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
gb|EDL29988.1|  serine/arginine repetitive matrix 1, isoform CRA_d      140   2e-34   
ref|XP_010354022.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005544470.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_006078048.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005394871.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_010828366.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008146297.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_004465426.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_001106172.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005544476.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_004465425.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_004603507.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005544472.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_005394869.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_006975729.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_008060362.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
ref|XP_007978191.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
gb|KFO37728.1|  Serine/arginine repetitive matrix protein 1             140   2e-34   
ref|XP_008998895.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-34   
gb|KDE06621.1|  hypothetical protein MVLG_03117                         136   2e-34   
ref|XP_005761923.1|  hypothetical protein EMIHUDRAFT_58282              130   2e-34   
gb|EPQ13299.1|  Serine/arginine repetitive matrix protein 1             140   2e-34   
ref|XP_004678680.1|  PREDICTED: serine/arginine repetitive matrix...    139   2e-34   
ref|XP_004678679.1|  PREDICTED: serine/arginine repetitive matrix...    139   2e-34   
ref|XP_007257645.1|  PREDICTED: serine/arginine repetitive matrix...    139   3e-34   
ref|XP_007257644.1|  PREDICTED: serine/arginine repetitive matrix...    139   3e-34   
emb|CBQ72148.1|  conserved hypothetical protein                         135   3e-34   
ref|XP_007869448.1|  PWI domain-containing protein                      134   3e-34   
ref|XP_003704587.1|  PREDICTED: serine/arginine repetitive matrix...    136   3e-34   
ref|XP_007771072.1|  PWI domain-containing protein                      129   4e-34   
emb|CEL57689.1|  protein phosphatase 2 (formerly 2A), regulatory ...    139   4e-34   
gb|KIY47475.1|  PWI domain-containing protein                           129   4e-34   
gb|EIE88227.1|  hypothetical protein RO3G_12938                         139   5e-34   
ref|XP_009046201.1|  hypothetical protein LOTGIDRAFT_137917             129   5e-34   
gb|KDR80213.1|  hypothetical protein GALMADRAFT_242506                  136   5e-34   
ref|XP_007301834.1|  hypothetical protein STEHIDRAFT_154602             136   5e-34   
gb|EMD35594.1|  hypothetical protein CERSUDRAFT_85538                   135   6e-34   
dbj|GAK63772.1|  PWI domain-containing protein                          133   6e-34   
ref|XP_003492729.1|  PREDICTED: hypothetical protein LOC100741990       139   6e-34   
ref|XP_003697315.1|  PREDICTED: uncharacterized protein LOC100871392    139   6e-34   
ref|XP_006620717.1|  PREDICTED: serine/arginine repetitive matrix...    139   6e-34   
ref|XP_006620714.1|  PREDICTED: serine/arginine repetitive matrix...    139   6e-34   
ref|XP_006620715.1|  PREDICTED: serine/arginine repetitive matrix...    139   6e-34   
ref|XP_011161388.1|  PREDICTED: serine/arginine repetitive matrix...    139   7e-34   
ref|XP_007392708.1|  hypothetical protein PHACADRAFT_26227              135   7e-34   
ref|XP_004592301.1|  PREDICTED: serine/arginine repetitive matrix...    138   8e-34   
ref|XP_011161387.1|  PREDICTED: serine/arginine repetitive matrix...    139   8e-34   
ref|XP_004592300.1|  PREDICTED: serine/arginine repetitive matrix...    138   8e-34   
ref|XP_004592298.1|  PREDICTED: serine/arginine repetitive matrix...    138   8e-34   
gb|KJA25476.1|  hypothetical protein HYPSUDRAFT_64668                   135   9e-34   
emb|CDQ74671.1|  unnamed protein product                                137   1e-33   
ref|XP_005922372.1|  PREDICTED: serine/arginine repetitive matrix...    137   1e-33   
ref|XP_004566623.1|  PREDICTED: serine/arginine repetitive matrix...    137   1e-33   
ref|XP_006463501.1|  hypothetical protein AGABI2DRAFT_194307            135   1e-33   
ref|XP_005739009.1|  PREDICTED: serine/arginine repetitive matrix...    137   1e-33   
ref|XP_007270525.1|  hypothetical protein FOMMEDRAFT_136573             135   1e-33   
ref|XP_005922371.1|  PREDICTED: serine/arginine repetitive matrix...    137   1e-33   
ref|XP_006800709.1|  PREDICTED: serine/arginine repetitive matrix...    137   1e-33   
ref|XP_003446232.2|  PREDICTED: serine/arginine repetitive matrix...    137   1e-33   
gb|KIJ11168.1|  hypothetical protein PAXINDRAFT_15897                   135   1e-33   
gb|ERZ98846.1|  hypothetical protein GLOINDRAFT_70246                   127   1e-33   
ref|XP_007334057.1|  hypothetical protein AGABI1DRAFT_116472            134   1e-33   
gb|KIM86657.1|  hypothetical protein PILCRDRAFT_311079                  134   2e-33   
ref|XP_005101380.1|  PREDICTED: serine/arginine repetitive matrix...    137   2e-33   
gb|AAL89660.1|AF411956_1  SRm160/300 splicing coactivator               127   2e-33   
ref|XP_007459367.1|  PREDICTED: serine/arginine repetitive matrix...    136   2e-33   
ref|XP_008480950.1|  PREDICTED: serine/arginine repetitive matrix...    135   2e-33   
ref|XP_005651911.1|  hypothetical protein COCSUDRAFT_64195              133   2e-33   
ref|XP_011285989.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    134   2e-33   
gb|KIK37574.1|  hypothetical protein CY34DRAFT_451867                   130   3e-33   
ref|XP_007346622.1|  PWI domain-containing protein                      129   3e-33   
gb|ADX97057.1|  serine/arginine repetitive matrix protein 1             126   4e-33   
ref|XP_001624661.1|  predicted protein                                  126   4e-33   
emb|CCM00237.1|  predicted protein                                      133   7e-33   
ref|XP_010787172.1|  PREDICTED: serine/arginine repetitive matrix...    132   8e-33   
ref|XP_007415598.1|  hypothetical protein MELLADRAFT_79059              132   9e-33   
gb|KIJ98811.1|  hypothetical protein K443DRAFT_195324                   132   9e-33   
gb|EJU02382.1|  hypothetical protein DACRYDRAFT_94712                   132   1e-32   
ref|XP_003764995.1|  PREDICTED: uncharacterized protein LOC100914811    135   1e-32   
ref|XP_004893857.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    135   1e-32   
ref|XP_010787170.1|  PREDICTED: serine/arginine repetitive matrix...    132   1e-32   
ref|XP_010787171.1|  PREDICTED: serine/arginine repetitive matrix...    132   1e-32   
emb|CAJ83937.1|  serine/arginine repetitive matrix 1                    134   1e-32   
emb|CCA73480.1|  hypothetical protein PIIN_11874                        130   1e-32   
gb|ERE82312.1|  Splicing factor PWI containing protein                  134   2e-32   
gb|ERE82311.1|  Splicing factor PWI containing protein                  134   2e-32   
ref|NP_001005645.1|  serine/arginine repetitive matrix 1                134   2e-32   
ref|XP_006800707.1|  PREDICTED: serine/arginine repetitive matrix...    134   2e-32   
gb|ERE82314.1|  Splicing factor PWI containing protein                  134   2e-32   
gb|ERE82313.1|  Splicing factor PWI containing protein                  134   2e-32   
gb|AAH97656.1|  LOC494754 protein                                       134   2e-32   
gb|ERE82315.1|  Splicing factor PWI containing protein                  134   2e-32   
ref|XP_011312449.1|  PREDICTED: serine/arginine repetitive matrix...    134   2e-32   
emb|CCJ29094.1|  unnamed protein product                                130   2e-32   
gb|ACN10942.1|  Serine/arginine repetitive matrix protein 1             132   2e-32   
gb|AAI30177.1|  LOC494754 protein                                       133   2e-32   
ref|NP_001131046.1|  serine/arginine repetitive matrix 1                133   2e-32   
gb|AAI08753.1|  LOC494754 protein                                       133   3e-32   
ref|XP_005008554.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    134   3e-32   
ref|XP_008169224.1|  PREDICTED: serine/arginine repetitive matrix...    134   3e-32   



>emb|CDP09103.1| unnamed protein product [Coffea canephora]
Length=767

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVMRPWIATRVTELI  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGKEVQI LTGFMERNTGKFMKELWSLLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQISLTGFMERNTGKFMKELWSLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>gb|EPS58613.1| hypothetical protein M569_16199, partial [Genlisea aurea]
Length=445

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELE+LVDM KVKMDVMRPWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELENLVDMTKVKMDVMRPWIAKRVTELI  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY+LLEGK+VNGKE+QI LTGFMERNTGKFMKELW +LLSAQ N  GVPQ
Sbjct  61   GFEDEVLINFIYTLLEGKEVNGKEIQISLTGFMERNTGKFMKELWVMLLSAQKNVSGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_009612859.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Nicotiana 
tomentosiformis]
Length=873

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVMKPWIAKRVTELI  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLE K VNGKEVQI LTGFMERNTGKFMKELW+LLLSAQNNA GVPQ
Sbjct  61   GFEDEVLINFIYGLLERKVVNGKEVQISLTGFMERNTGKFMKELWALLLSAQNNASGVPQ  120

Query  425  QFLDAK  442
            QFL+AK
Sbjct  121  QFLEAK  126



>ref|XP_006362050.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Solanum tuberosum]
Length=882

 Score =   242 bits (617),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVMKPWIAKRVTELI  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIYSLLE K  NGKE+QI LTGFMERNTGKFMKELW+LLLSAQNNA GVPQ
Sbjct  61   GFEDEVLINFIYSLLERKVANGKELQISLTGFMERNTGKFMKELWALLLSAQNNASGVPQ  120

Query  425  QFLDAK  442
            QFL+AK
Sbjct  121  QFLEAK  126



>ref|XP_010256833.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Nelumbo nucifera]
Length=919

 Score =   241 bits (616),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKF+PEL+HLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFSPELDHLVDMTKVKMDVIRPWIANRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GKDVNGKEVQIQLTGFME+NTGKFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKDVNGKEVQIQLTGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>gb|AAP06864.1| SR-rich pre-mRNA splicing activator [Oryza sativa Japonica Group]
 gb|AAP06930.1| SR-rich pre-mRNA splicing activator [Oryza sativa Japonica Group]
Length=199

 Score =   225 bits (573),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEHLVDMTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLE K+ +GK++QIQLTGFME+NT KFMKELWSLLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_010256831.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Nelumbo nucifera]
Length=925

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKF+PEL+HLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFSPELDHLVDMTKVKMDVIRPWIANRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GKDVNGKEVQIQLTGFME+NTGKFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKDVNGKEVQIQLTGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>gb|EEC74941.1| hypothetical protein OsI_10913 [Oryza sativa Indica Group]
Length=201

 Score =   225 bits (573),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEHLVDMTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLE K+ +GK++QIQLTGFME+NT KFMKELWSLLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|NP_001049684.1| Os03g0270200 [Oryza sativa Japonica Group]
 dbj|BAF11598.1| Os03g0270200 [Oryza sativa Japonica Group]
Length=186

 Score =   223 bits (569),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEHLVDMTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLE K+ +GK++QIQLTGFME+NT KFMKELWSLLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_010326175.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Solanum lycopersicum]
Length=621

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 120/136 (88%), Gaps = 3/136 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV++PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIKPWIAKRVTELI  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIYSLLE K  NGKE+QI LTGFMERNT KFMKELW+LLLSAQNNA GVPQ
Sbjct  61   GFEDEVLINFIYSLLERKVANGKELQISLTGFMERNTAKFMKELWALLLSAQNNASGVPQ  120

Query  425  QFLDAKG---RGNKEE  463
            QFL+AK    R NK E
Sbjct  121  QFLEAKEEEMRNNKAE  136



>ref|XP_009789294.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Nicotiana 
sylvestris]
Length=873

 Score =   239 bits (609),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVMKPWIAKRVTELI  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLE K VNGKEVQI LTGFMERNTGKFMKELW+LLLSAQNNA GVPQ
Sbjct  61   GFEDEVLINFIYGLLERKVVNGKEVQISLTGFMERNTGKFMKELWALLLSAQNNASGVPQ  120

Query  425  QFLDAK  442
             FL+AK
Sbjct  121  LFLEAK  126



>gb|KHF99787.1| Serine/arginine repetitive matrix 1 [Gossypium arboreum]
Length=863

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELWSLLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWSLLLSAQRNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_011080704.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Sesamum indicum]
Length=878

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELE+LVDM KVKMDVMRPWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELENLVDMTKVKMDVMRPWIAKRVTELI  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIYSLLEGK+VNGK+V I LTGFMERNTGKFMKELW+LLLSAQ N  GVPQ
Sbjct  61   GFEDEVLINFIYSLLEGKEVNGKQVHISLTGFMERNTGKFMKELWALLLSAQQNVSGVPQ  120

Query  425  QFLD  436
            QFLD
Sbjct  121  QFLD  124



>ref|XP_011080705.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Sesamum indicum]
Length=877

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELE+LVDM KVKMDVMRPWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELENLVDMTKVKMDVMRPWIAKRVTELI  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIYSLLEGK+VNGK+V I LTGFMERNTGKFMKELW+LLLSAQ N  GVPQ
Sbjct  61   GFEDEVLINFIYSLLEGKEVNGKQVHISLTGFMERNTGKFMKELWALLLSAQQNVSGVPQ  120

Query  425  QFLD  436
            QFLD
Sbjct  121  QFLD  124



>ref|XP_011080697.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Sesamum indicum]
 ref|XP_011080699.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Sesamum indicum]
 ref|XP_011080700.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Sesamum indicum]
 ref|XP_011080701.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Sesamum indicum]
 ref|XP_011080702.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Sesamum indicum]
 ref|XP_011080703.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Sesamum indicum]
Length=879

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELE+LVDM KVKMDVMRPWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELENLVDMTKVKMDVMRPWIAKRVTELI  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIYSLLEGK+VNGK+V I LTGFMERNTGKFMKELW+LLLSAQ N  GVPQ
Sbjct  61   GFEDEVLINFIYSLLEGKEVNGKQVHISLTGFMERNTGKFMKELWALLLSAQQNVSGVPQ  120

Query  425  QFLD  436
            QFLD
Sbjct  121  QFLD  124



>ref|XP_011080706.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Sesamum indicum]
Length=873

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELE+LVDM KVKMDVMRPWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELENLVDMTKVKMDVMRPWIAKRVTELI  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIYSLLEGK+VNGK+V I LTGFMERNTGKFMKELW+LLLSAQ N  GVPQ
Sbjct  61   GFEDEVLINFIYSLLEGKEVNGKQVHISLTGFMERNTGKFMKELWALLLSAQQNVSGVPQ  120

Query  425  QFLD  436
            QFLD
Sbjct  121  QFLD  124



>ref|XP_010106541.1| Serine/arginine repetitive matrix protein 1 [Morus notabilis]
 gb|EXC10717.1| Serine/arginine repetitive matrix protein 1 [Morus notabilis]
Length=775

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 120/136 (88%), Gaps = 3/136 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV M+V+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVSMNVVRPWIANRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAK---GRGNKEE  463
            QFLDAK    R  KEE
Sbjct  121  QFLDAKQEETRKKKEE  136



>ref|XP_006651246.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Oryza 
brachyantha]
Length=364

 Score =   226 bits (577),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEHLVDMTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLE K+ +GK++QIQLTGFME+NT KFMKELWSLLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>emb|CBI16084.3| unnamed protein product [Vitis vinifera]
Length=866

 Score =   236 bits (603),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPEL+HLVD+ KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDVTKVKMDVIRPWIANRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+ KDVNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDRKDVNGKEVQISLTGFMEKNTGKFMKELWALLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_008222060.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Prunus 
mume]
 ref|XP_008222067.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Prunus 
mume]
 ref|XP_008222071.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Prunus 
mume]
 ref|XP_008222078.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Prunus 
mume]
 ref|XP_008222085.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Prunus 
mume]
Length=859

 Score =   236 bits (603),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 119/136 (88%), Gaps = 3/136 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELEHLVD  KV M+VMRPWIAKRVT+L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDTSKVNMEVMRPWIAKRVTDLL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLEGK VNGKEVQI LTGFME+NT KFMKELW+LL+SAQNNA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKVVNGKEVQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  120

Query  425  QFLDAK---GRGNKEE  463
            QFLDAK    R  KEE
Sbjct  121  QFLDAKQEEARTKKEE  136



>ref|XP_009375945.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=850

 Score =   236 bits (602),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 119/136 (88%), Gaps = 3/136 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKL+KSQKFAPELEHLVD+ KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDITKVSMDVMRPWIANRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKVVNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  120

Query  425  QFLDAK---GRGNKEE  463
            QFLDAK    R  KEE
Sbjct  121  QFLDAKQEEARKKKEE  136



>ref|XP_009375946.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Pyrus x bretschneideri]
Length=849

 Score =   236 bits (602),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 119/136 (88%), Gaps = 3/136 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKL+KSQKFAPELEHLVD+ KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDITKVSMDVMRPWIANRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKVVNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  120

Query  425  QFLDAK---GRGNKEE  463
            QFLDAK    R  KEE
Sbjct  121  QFLDAKQEEARKKKEE  136



>ref|XP_002280607.2| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Vitis vinifera]
Length=922

 Score =   236 bits (603),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPEL+HLVD+ KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDVTKVKMDVIRPWIANRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+ KDVNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDRKDVNGKEVQISLTGFMEKNTGKFMKELWALLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_009375943.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009375944.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=851

 Score =   236 bits (601),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 119/136 (88%), Gaps = 3/136 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKL+KSQKFAPELEHLVD+ KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDITKVSMDVMRPWIANRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKVVNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  120

Query  425  QFLDAK---GRGNKEE  463
            QFLDAK    R  KEE
Sbjct  121  QFLDAKQEEARKKKEE  136



>gb|KDP42210.1| hypothetical protein JCGZ_02940 [Jatropha curcas]
Length=870

 Score =   236 bits (601),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMRKVKMDVIRPWIANRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+ K+VNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ N  GVPQ
Sbjct  61   GFEDEVLINFIYGLLDAKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAQKNESGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>gb|KEH30183.1| SR-rich pre-mRNA splicing activator [Medicago truncatula]
Length=897

 Score =   236 bits (601),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV MDVMRPWI ++VTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVNMDVMRPWITRKVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FI+ LLE K VNGKE+QIQ+TGFME+NTGKFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIHGLLEAKKVNGKEIQIQITGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>gb|KEH30184.1| SR-rich pre-mRNA splicing activator [Medicago truncatula]
Length=845

 Score =   235 bits (600),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV MDVMRPWI ++VTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVNMDVMRPWITRKVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FI+ LLE K VNGKE+QIQ+TGFME+NTGKFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIHGLLEAKKVNGKEIQIQITGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>gb|AES88912.2| SR-rich pre-mRNA splicing activator [Medicago truncatula]
Length=911

 Score =   236 bits (601),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV MDVMRPWI ++VTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVNMDVMRPWITRKVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FI+ LLE K VNGKE+QIQ+TGFME+NTGKFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIHGLLEAKKVNGKEIQIQITGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_003606715.1| Serine/arginine repetitive matrix protein [Medicago truncatula]
Length=891

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV MDVMRPWI ++VTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVNMDVMRPWITRKVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FI+ LLE K VNGKE+QIQ+TGFME+NTGKFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIHGLLEAKKVNGKEIQIQITGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_008385098.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Malus 
domestica]
Length=876

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 119/136 (88%), Gaps = 3/136 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKL+KSQKFAPELEHLVD+ KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDITKVSMDVMRPWIANRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKVVNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  120

Query  425  QFLDAK---GRGNKEE  463
            QFLDAK    R  KEE
Sbjct  121  QFLDAKQEEARKKKEE  136



>ref|XP_007208179.1| hypothetical protein PRUPE_ppa001408mg [Prunus persica]
 gb|EMJ09378.1| hypothetical protein PRUPE_ppa001408mg [Prunus persica]
Length=836

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 119/136 (88%), Gaps = 3/136 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELEHLVD+ KV M+VM PWIAKRVT+L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDISKVNMEVMHPWIAKRVTDLL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLEGK VNGKEVQI LTGFME+NT KFMKELW+LL+SAQNNA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKVVNGKEVQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  120

Query  425  QFLDAK---GRGNKEE  463
            QFLDAK    R  KEE
Sbjct  121  QFLDAKQEEARTKKEE  136



>ref|XP_002520517.1| copper ion binding protein, putative [Ricinus communis]
 gb|EEF41930.1| copper ion binding protein, putative [Ricinus communis]
Length=860

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQA+LLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQARLLKSQKFAPELEHLVDMRKVKMDVIRPWIANRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLE K+VNGKEVQIQLTGFME+NT KFMKELW+LLLSAQ N  GVPQ
Sbjct  61   GFEDEVLINFIYGLLEAKEVNGKEVQIQLTGFMEKNTVKFMKELWALLLSAQKNESGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_009364350.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Pyrus 
x bretschneideri]
Length=838

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 118/136 (87%), Gaps = 4/136 (3%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV MDVMRPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMSKVSMDVMRPWIANRATELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEGK-VNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  119

Query  425  QFLDAK---GRGNKEE  463
            QFLDAK    R  KEE
Sbjct  120  QFLDAKQEEARKKKEE  135



>gb|EEE58772.1| hypothetical protein OsJ_10288 [Oryza sativa Japonica Group]
Length=595

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEHLVDMTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLE K+ +GK++QIQLTGFME+NT KFMKELWSLLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_008356772.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Malus domestica]
Length=829

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 118/136 (87%), Gaps = 4/136 (3%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV MDVMRPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMSKVSMDVMRPWIANRATELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEGK-VNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  119

Query  425  QFLDAK---GRGNKEE  463
            QFLDAK    R  KEE
Sbjct  120  QFLDAKQEEARKKKEE  135



>ref|XP_008356765.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Malus domestica]
Length=830

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 118/136 (87%), Gaps = 4/136 (3%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV MDVMRPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMSKVSMDVMRPWIANRATELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEGK-VNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  119

Query  425  QFLDAK---GRGNKEE  463
            QFLDAK    R  KEE
Sbjct  120  QFLDAKQEEARKKKEE  135



>ref|XP_008801619.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Phoenix dactylifera]
Length=868

 Score =   234 bits (596),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQD RFSNKQAKLLKSQKFAPEL+H+VDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDARFSNKQAKLLKSQKFAPELDHVVDMTKVQMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI F+Y LL+GK+V+GK++QIQLTGFME+NTGKFMKELW LLLSAQNNA GVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQMQIQLTGFMEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_008801616.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008801617.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008801618.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Phoenix dactylifera]
Length=874

 Score =   234 bits (596),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQD RFSNKQAKLLKSQKFAPEL+H+VDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDARFSNKQAKLLKSQKFAPELDHVVDMTKVQMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI F+Y LL+GK+V+GK++QIQLTGFME+NTGKFMKELW LLLSAQNNA GVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQMQIQLTGFMEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_004507160.1| PREDICTED: LOW QUALITY PROTEIN: serine/arginine repetitive matrix 
protein 1-like [Cicer arietinum]
Length=870

 Score =   233 bits (595),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV M++MRPWI ++VTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVNMEIMRPWITRKVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FI+SLL+ K VNGKEVQIQ+TGFME+NTGKFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIHSLLDAKIVNGKEVQIQITGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>tpg|DAA44607.1| TPA: hypothetical protein ZEAMMB73_474732 [Zea mays]
Length=173

 Score =   216 bits (551),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPEL+HLVD  KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDTSKVKMDVMKPWIAKRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLE K+ +GK++QIQLTGFME+NT KFM+ELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMRELWTLLLSAQQNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG*D  475
            QFLD K    +++K  D
Sbjct  121  QFLDEKEAEIQQKKAED  137



>ref|XP_002314154.2| hypothetical protein POPTR_0009s04160g [Populus trichocarpa]
 gb|EEE88109.2| hypothetical protein POPTR_0009s04160g [Populus trichocarpa]
Length=882

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPEL+HLVD  K+KMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDTRKMKMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ N  GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAQKNESGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_007132039.1| hypothetical protein PHAVU_011G061700g [Phaseolus vulgaris]
 gb|ESW04033.1| hypothetical protein PHAVU_011G061700g [Phaseolus vulgaris]
Length=924

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV M+V++PW+ +RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMEVIKPWVTRRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FI+SLL+ K+VNGKEVQIQ+TGFME+NTGKFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIHSLLDVKEVNGKEVQIQITGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>gb|KDO66636.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
Length=803

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_006424900.1| hypothetical protein CICLE_v10030390mg [Citrus clementina]
 gb|ESR38140.1| hypothetical protein CICLE_v10030390mg [Citrus clementina]
Length=846

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>gb|KDO66635.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
Length=832

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_006488382.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Citrus sinensis]
Length=846

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_006488383.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Citrus sinensis]
Length=843

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>gb|KDO66634.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
Length=843

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>gb|KDO66630.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
 gb|KDO66631.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
 gb|KDO66632.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
 gb|KDO66633.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
Length=846

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>gb|ABF95203.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 gb|ABF95204.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=840

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEHLVDMTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLE K+ +GK++QIQLTGFME+NT KFMKELWSLLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>gb|ABW81062.1| proline-rich-protein [Arabidopsis lyrata subsp. lyrata]
Length=861

 Score =   231 bits (588),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN+ GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTGKFMKELWTLLLSAQNNSSGVPQ  120

Query  425  QFLDAK  442
            QFLDA+
Sbjct  121  QFLDAR  126



>ref|XP_002879206.1| hypothetical protein ARALYDRAFT_901882 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55465.1| hypothetical protein ARALYDRAFT_901882 [Arabidopsis lyrata subsp. 
lyrata]
Length=861

 Score =   231 bits (588),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN+ GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTGKFMKELWTLLLSAQNNSSGVPQ  120

Query  425  QFLDAK  442
            QFLDA+
Sbjct  121  QFLDAR  126



>ref|XP_006409968.1| hypothetical protein EUTSA_v10016250mg [Eutrema salsugineum]
 gb|ESQ51421.1| hypothetical protein EUTSA_v10016250mg [Eutrema salsugineum]
Length=831

 Score =   230 bits (587),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LL+SAQNN+ GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTGKFMKELWTLLISAQNNSSGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_006846337.1| hypothetical protein AMTR_s00012p00256890 [Amborella trichopoda]
 gb|ERN08012.1| hypothetical protein AMTR_s00012p00256890 [Amborella trichopoda]
Length=885

 Score =   231 bits (588),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNK AKLLKSQKFA EL+HLVD+ KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKAAKLLKSQKFASELDHLVDISKVKMDVIRPWIANRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GKDV+GK++QIQLTGFME+NTGKFMKELW+LLLSAQ N  GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKDVDGKQIQIQLTGFMEKNTGKFMKELWNLLLSAQKNISGVPQ  120

Query  425  QFLDAKGRGNKEEKG  469
            QFLDAK    K++K 
Sbjct  121  QFLDAKEEETKQKKA  135



>ref|XP_011461331.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=854

 Score =   230 bits (587),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 117/136 (86%), Gaps = 3/136 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMDVMRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+ K+ NGKE+QI LTGFME+NT KFMKELW+ LLSAQNNA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDVKEANGKEIQISLTGFMEKNTVKFMKELWTHLLSAQNNASGVPQ  120

Query  425  QFLDAK---GRGNKEE  463
            QFLDAK    R  KEE
Sbjct  121  QFLDAKQEEARKKKEE  136



>ref|XP_011461330.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=855

 Score =   230 bits (587),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 117/136 (86%), Gaps = 3/136 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMDVMRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+ K+ NGKE+QI LTGFME+NT KFMKELW+ LLSAQNNA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDVKEANGKEIQISLTGFMEKNTVKFMKELWTHLLSAQNNASGVPQ  120

Query  425  QFLDAK---GRGNKEE  463
            QFLDAK    R  KEE
Sbjct  121  QFLDAKQEEARKKKEE  136



>gb|ABW81113.1| proline-rich protein [Boechera divaricarpa]
Length=883

 Score =   230 bits (587),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN+ GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTGKFMKELWTLLLSAQNNSSGVPQ  120

Query  425  QFLDAK  442
            QFLDA+
Sbjct  121  QFLDAR  126



>ref|XP_011032244.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Populus euphratica]
Length=874

 Score =   230 bits (586),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPEL+HLVD  K+KMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDTRKMKMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N  GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>gb|KHN21923.1| Serine/arginine repetitive matrix protein 1 [Glycine soja]
Length=907

 Score =   230 bits (587),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV M+V++PWI +RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMEVIKPWITRRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FI+ LL+ K+VNGKEVQIQ+TGFME+NTGKFMKELW LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIHGLLDAKEVNGKEVQIQITGFMEKNTGKFMKELWMLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_011032245.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Populus euphratica]
Length=856

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPEL+HLVD  K+KMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDTRKMKMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N  GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_003539073.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Glycine max]
Length=916

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV M+V++PWI +RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMEVIKPWITRRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FI+ LL+ K+VNGKEVQIQ+TGFME+NTGKFMKELW LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIHGLLDAKEVNGKEVQIQITGFMEKNTGKFMKELWMLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_011032246.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Populus euphratica]
Length=840

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPEL+HLVD  K+KMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDTRKMKMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N  GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_010262597.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Nelumbo nucifera]
Length=616

 Score =   226 bits (576),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 119/175 (68%), Positives = 143/175 (82%), Gaps = 3/175 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KVKMDV+RPWIA RVT+L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVKMDVIRPWIANRVTKLL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI  IY LL+GKDVNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINLIYGLLDGKDVNGKEVQIHLTGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG*D*SNNK*NTEEKRERISRT*ARK--KKADGNVDISRDTH  583
            QFLDAK    +++K  +    K   ++K+E+  R   ++  KK DG VD+S++T+
Sbjct  121  QFLDAKEEETRKKKV-EADRIKLEIQKKKEKEGRELDQEKLKKMDGEVDVSKETN  174



>ref|XP_010920517.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Elaeis guineensis]
Length=774

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQD+RFSNKQAKLLK+QKFA EL+H+VDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDSRFSNKQAKLLKTQKFASELDHVVDMTKVQMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI F+Y LL+GK+V+GK++QIQLTGFME+NTGKFMKELW LLLSAQNNA GVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQMQIQLTGFMEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_010920514.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Elaeis guineensis]
 ref|XP_010920515.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Elaeis guineensis]
Length=876

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQD+RFSNKQAKLLK+QKFA EL+H+VDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDSRFSNKQAKLLKTQKFASELDHVVDMTKVQMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI F+Y LL+GK+V+GK++QIQLTGFME+NTGKFMKELW LLLSAQNNA GVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQMQIQLTGFMEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_004984929.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Setaria italica]
Length=842

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMSKVKMDVMKPWIAKRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLE K+ +GK++QIQLTGFME+NT KFMKELW LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWGLLLSAQQNASGVPQ  120

Query  425  QFLDAK  442
            QFLD K
Sbjct  121  QFLDEK  126



>tpg|DAA44610.1| TPA: hypothetical protein ZEAMMB73_474732, partial [Zea mays]
Length=581

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPEL+HLVD  KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDTSKVKMDVMKPWIAKRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLE K+ +GK++QIQLTGFME+NT KFM+ELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMRELWTLLLSAQQNASGVPQ  120

Query  425  QFLDAK  442
            QFLD K
Sbjct  121  QFLDEK  126



>ref|XP_002299851.2| hypothetical protein POPTR_0001s25140g [Populus trichocarpa]
 gb|EEE84656.2| hypothetical protein POPTR_0001s25140g [Populus trichocarpa]
Length=826

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPEL+HLV+  KVKMDV++PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVNTKKVKMDVIKPWIANRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N  GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>gb|KJB83751.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
Length=660

 Score =   226 bits (575),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELWSLLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWSLLLSAQRNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG  469
            QFLDAK    +++K 
Sbjct  121  QFLDAKEEETRKKKA  135



>gb|KJB83752.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
 gb|KJB83753.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
Length=604

 Score =   224 bits (572),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELWSLLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWSLLLSAQRNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG  469
            QFLDAK    +++K 
Sbjct  121  QFLDAKEEETRKKKA  135



>ref|XP_010228813.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Brachypodium distachyon]
Length=586

 Score =   221 bits (562),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNK AKLLK+QKFA EL+H VDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKHAKLLKTQKFASELDHQVDMSKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+ K+V+GK +QIQLTGFME+NT KFMKELWSLLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDVKEVDGKHIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_010228812.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Brachypodium distachyon]
Length=844

 Score =   222 bits (565),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNK AKLLK+QKFA EL+H VDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKHAKLLKTQKFASELDHQVDMSKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+ K+V+GK +QIQLTGFME+NT KFMKELWSLLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDVKEVDGKHIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_001762564.1| predicted protein [Physcomitrella patens]
 gb|EDQ72687.1| predicted protein [Physcomitrella patens]
Length=183

 Score =   206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNK  KLLKSQKFAPEL+  +D  KV+MDV++PW+A RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKMKKLLKSQKFAPELDVTIDTSKVQMDVIKPWVATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY +LE K+V+GK VQIQLTGFME+NTGKFMKELWSLL+SAQ+N  G+PQ
Sbjct  61   GFEDEVLINFIYGMLEEKNVDGKHVQIQLTGFMEKNTGKFMKELWSLLMSAQSNVSGIPQ  120

Query  425  QFLDAKGRGNKEEKG  469
            QFLD K    + +K 
Sbjct  121  QFLDQKAEETRLKKA  135



>ref|XP_009419742.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Musa 
acuminata subsp. malaccensis]
Length=838

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKLLK+QKFAP L+H VD+ KVKMDV+RPWIA R TEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKTQKFAPVLDHPVDVTKVKMDVIRPWIATRATELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI F+Y LL+GK V+GK++QIQLTGF+E+NTGKFMKELW LLLSAQNNA GVPQ
Sbjct  61   GFEDEVLINFVYGLLDGK-VDGKQIQIQLTGFLEKNTGKFMKELWGLLLSAQNNASGVPQ  119

Query  425  QFLDAK  442
            QFLDAK
Sbjct  120  QFLDAK  125



>ref|XP_006592181.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Glycine max]
Length=890

 Score =   220 bits (561),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 103/126 (82%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV M+V++PWI +RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMEVIKPWITRRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FI+SLL+ K+VNGKEVQIQ+TGFME+NTGKFMKELW LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIHSLLDAKEVNGKEVQIQITGFMEKNTGKFMKELWMLLLSAQKNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>gb|KJB83748.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
Length=860

 Score =   219 bits (559),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELWSLLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWSLLLSAQRNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG  469
            QFLDAK    +++K 
Sbjct  121  QFLDAKEEETRKKKA  135



>gb|KJB83749.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
Length=862

 Score =   219 bits (559),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELWSLLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWSLLLSAQRNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG  469
            QFLDAK    +++K 
Sbjct  121  QFLDAKEEETRKKKA  135



>gb|KJB83755.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
Length=815

 Score =   219 bits (557),  Expect = 6e-63, Method: Composition-based stats.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELWSLLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWSLLLSAQRNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG  469
            QFLDAK    +++K 
Sbjct  121  QFLDAKEEETRKKKA  135



>ref|XP_010262596.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Nelumbo nucifera]
Length=850

 Score =   219 bits (558),  Expect = 6e-63, Method: Composition-based stats.
 Identities = 119/175 (68%), Positives = 143/175 (82%), Gaps = 3/175 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KVKMDV+RPWIA RVT+L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVKMDVIRPWIANRVTKLL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI  IY LL+GKDVNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINLIYGLLDGKDVNGKEVQIHLTGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG*D*SNNK*NTEEKRERISRT*ARK--KKADGNVDISRDTH  583
            QFLDAK    +++K  +    K   ++K+E+  R   ++  KK DG VD+S++T+
Sbjct  121  QFLDAKEEETRKKKV-EADRIKLEIQKKKEKEGRELDQEKLKKMDGEVDVSKETN  174



>ref|XP_010262593.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010262594.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010262595.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Nelumbo nucifera]
Length=852

 Score =   219 bits (557),  Expect = 9e-63, Method: Composition-based stats.
 Identities = 119/175 (68%), Positives = 143/175 (82%), Gaps = 3/175 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KVKMDV+RPWIA RVT+L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVKMDVIRPWIANRVTKLL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI  IY LL+GKDVNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINLIYGLLDGKDVNGKEVQIHLTGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG*D*SNNK*NTEEKRERISRT*ARK--KKADGNVDISRDTH  583
            QFLDAK    +++K  +    K   ++K+E+  R   ++  KK DG VD+S++T+
Sbjct  121  QFLDAKEEETRKKKV-EADRIKLEIQKKKEKEGRELDQEKLKKMDGEVDVSKETN  174



>ref|XP_007016333.1| Splicing factor PWI domain-containing protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY33952.1| Splicing factor PWI domain-containing protein, putative isoform 
2 [Theobroma cacao]
Length=896

 Score =   218 bits (555),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 107/135 (79%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPEL+HLVDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDMTKVEMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWTLLLSAQRNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG  469
            QFLDAK    +++K 
Sbjct  121  QFLDAKEEETRKKKA  135



>ref|XP_007016332.1| Splicing factor PWI domain-containing protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY33951.1| Splicing factor PWI domain-containing protein, putative isoform 
1 [Theobroma cacao]
Length=943

 Score =   218 bits (554),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 107/135 (79%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPEL+HLVDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDMTKVEMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWTLLLSAQRNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG  469
            QFLDAK    +++K 
Sbjct  121  QFLDAKEEETRKKKA  135



>emb|CAC03679.1| SRM102 [Arabidopsis thaliana]
Length=894

 Score =   217 bits (552),  Expect = 5e-62, Method: Composition-based stats.
 Identities = 105/134 (78%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDITKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            GIEDEVLI FIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN  GVPQ
Sbjct  61   GIEDEVLINFIYGLLDGKVVNGKEIQITLTGFMEKNTGKFMKELWTLLLSAQNNPSGVPQ  120

Query  425  QFLDAKGRGNKEEK  466
            QFLDA+    K+++
Sbjct  121  QFLDARAAETKKKQ  134



>ref|XP_010043494.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Eucalyptus grandis]
 gb|KCW85510.1| hypothetical protein EUGRSUZ_B02307 [Eucalyptus grandis]
Length=878

 Score =   217 bits (552),  Expect = 5e-62, Method: Composition-based stats.
 Identities = 107/134 (80%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPELE LVDM KVKMDVM+PWIA RVT L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEFLVDMTKVKMDVMKPWIATRVTGLL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGKEVQIQLTGFME+NTGKFMKELW+LL+SAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQIQLTGFMEKNTGKFMKELWTLLISAQKNASGVPQ  120

Query  425  QFLDAKGRGNKEEK  466
            QFLDAK    +++K
Sbjct  121  QFLDAKEEETRKKK  134



>ref|XP_010043495.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Eucalyptus grandis]
Length=877

 Score =   217 bits (552),  Expect = 5e-62, Method: Composition-based stats.
 Identities = 107/134 (80%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPELE LVDM KVKMDVM+PWIA RVT L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEFLVDMTKVKMDVMKPWIATRVTGLL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGKEVQIQLTGFME+NTGKFMKELW+LL+SAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQIQLTGFMEKNTGKFMKELWTLLISAQKNASGVPQ  120

Query  425  QFLDAKGRGNKEEK  466
            QFLDAK    +++K
Sbjct  121  QFLDAKEEETRKKK  134



>ref|XP_010510519.1| PREDICTED: LOW QUALITY PROTEIN: serine/arginine repetitive matrix 
protein 1-like [Camelina sativa]
Length=841

 Score =   216 bits (551),  Expect = 6e-62, Method: Composition-based stats.
 Identities = 104/133 (78%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN+ GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTGKFMKELWTLLLSAQNNSSGVPQ  120

Query  425  QFLDAKGRGNKEE  463
            QFLDA+    K++
Sbjct  121  QFLDAREADTKKK  133



>ref|XP_010521878.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Tarenaya hassleriana]
Length=907

 Score =   216 bits (551),  Expect = 7e-62, Method: Composition-based stats.
 Identities = 109/136 (80%), Positives = 119/136 (88%), Gaps = 3/136 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKTQKFAPELEHLVDMAKVKMDVMKPWIANRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK VNGKE+QI LTGFME+NT KFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTTKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAK---GRGNKEE  463
            QFLDAK    R  KEE
Sbjct  121  QFLDAKEAETRKKKEE  136



>ref|XP_001774764.1| predicted protein [Physcomitrella patens]
 gb|EDQ60435.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   201 bits (512),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNK  KLLKSQKFAPEL+ ++D  KV+MDV++PW+A RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKMKKLLKSQKFAPELDVMIDTSKVQMDVIKPWVAIRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FI  +LE K+V+GK VQIQLTGFME+NTGKFMKELWSLL+SAQ+N  G+PQ
Sbjct  61   GFEDEVLINFINGMLEEKNVDGKHVQIQLTGFMEKNTGKFMKELWSLLISAQSNVSGIPQ  120

Query  425  QFLDAKG  445
            QFLD K 
Sbjct  121  QFLDQKA  127



>ref|NP_180484.2| splicing factor PWI domain-containing protein [Arabidopsis thaliana]
 gb|AAM78093.1| At2g29210/F16P2.41 [Arabidopsis thaliana]
 gb|AAN18199.1| At2g29210/F16P2.41 [Arabidopsis thaliana]
 gb|AEC08223.1| serine/arginine repetitive matrix protein 1-like protein [Arabidopsis 
thaliana]
Length=878

 Score =   215 bits (547),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 105/134 (78%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDITKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            GIEDEVLI FIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN  GVPQ
Sbjct  61   GIEDEVLINFIYGLLDGKVVNGKEIQITLTGFMEKNTGKFMKELWTLLLSAQNNPSGVPQ  120

Query  425  QFLDAKGRGNKEEK  466
            QFLDA+    K+++
Sbjct  121  QFLDARAAETKKKQ  134



>ref|XP_010469978.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Camelina 
sativa]
Length=842

 Score =   214 bits (545),  Expect = 4e-61, Method: Composition-based stats.
 Identities = 103/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK +NGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN+ GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVLNGKEIQISLTGFMEKNTGKFMKELWTLLLSAQNNSSGVPQ  120

Query  425  QFLDAKGRGNKEE  463
            QFLDA+    K++
Sbjct  121  QFLDAREADTKKK  133



>gb|KDO66637.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
Length=774

 Score =   213 bits (541),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 115/170 (68%), Positives = 136/170 (80%), Gaps = 4/170 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG*D*SNNK*NTEEKRERISRT--*ARKKKADGNVDI  568
            QFLDAK    +++K    ++   N  +K+E+ SR     R +  DG V++
Sbjct  121  QFLDAKEEEARKKK--LEADRIANEIQKKEKESRELDKERSRNMDGAVEM  168



>ref|XP_009416220.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=785

 Score =   211 bits (537),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 102/134 (76%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKLLKSQKFA EL+H VDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAAELDHPVDMTKVQMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI F+Y LL+GK+V+GK++QIQLTGF+E+NTGKFMKELW LLLSAQNNA GVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQIQIQLTGFLEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  425  QFLDAKGRGNKEEK  466
            QFL+AK    K+ K
Sbjct  121  QFLNAKEEEMKKRK  134



>ref|XP_009416221.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=780

 Score =   211 bits (537),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 102/134 (76%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKLLKSQKFA EL+H VDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAAELDHPVDMTKVQMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI F+Y LL+GK+V+GK++QIQLTGF+E+NTGKFMKELW LLLSAQNNA GVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQIQIQLTGFLEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  425  QFLDAKGRGNKEEK  466
            QFL+AK    K+ K
Sbjct  121  QFLNAKEEEMKKRK  134



>ref|XP_006293680.1| hypothetical protein CARUB_v10022637mg [Capsella rubella]
 gb|ABW81160.1| unknown [Capsella rubella]
 gb|EOA26578.1| hypothetical protein CARUB_v10022637mg [Capsella rubella]
Length=839

 Score =   211 bits (536),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 103/134 (77%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQ N+ GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTGKFMKELWTLLLSAQGNSSGVPQ  120

Query  425  QFLDAKGRGNKEEK  466
            QFLDA+    K+++
Sbjct  121  QFLDAREADTKKKQ  134



>ref|XP_009144394.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Brassica 
rapa]
 ref|XP_009144395.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Brassica 
rapa]
 emb|CDY45430.1| BnaA05g12710D [Brassica napus]
Length=839

 Score =   209 bits (532),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 100/125 (80%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGTTADQDTRFSNKQAKL+KSQKFA ELE LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTTADQDTRFSNKQAKLMKSQKFASELETLVDVSKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+ K VNGKE+QI +TGFME+NT KFMKELW+LLLSAQ+N+ GVPQ
Sbjct  61   GFEDEVLINFIYGLLDNKVVNGKEIQIAITGFMEKNTVKFMKELWTLLLSAQSNSSGVPQ  120

Query  425  QFLDA  439
            QFLDA
Sbjct  121  QFLDA  125



>ref|XP_008681507.1| PREDICTED: uncharacterized protein LOC100304415 isoform X4 [Zea 
mays]
 tpg|DAA44609.1| TPA: hypothetical protein ZEAMMB73_474732 [Zea mays]
Length=895

 Score =   209 bits (533),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 103/137 (75%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPEL+HLVD  KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDTSKVKMDVMKPWIAKRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLE K+ +GK++QIQLTGFME+NT KFM+ELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMRELWTLLLSAQQNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG*D  475
            QFLD K    +++K  D
Sbjct  121  QFLDEKEAEIQQKKAED  137



>ref|XP_008681504.1| PREDICTED: uncharacterized protein LOC100304415 isoform X3 [Zea 
mays]
Length=900

 Score =   209 bits (533),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 103/137 (75%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPEL+HLVD  KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDTSKVKMDVMKPWIAKRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLE K+ +GK++QIQLTGFME+NT KFM+ELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMRELWTLLLSAQQNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG*D  475
            QFLD K    +++K  D
Sbjct  121  QFLDEKEAEIQQKKAED  137



>gb|EMS59731.1| Serine/arginine repetitive matrix protein 1 [Triticum urartu]
Length=915

 Score =   209 bits (533),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNK AKLLK+QKFA EL+H VDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKHAKLLKTQKFASELDHQVDMSKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+ K+V+GK +QIQLTGFME+NT KFM+ELWSLLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDAKEVDGKYIQIQLTGFMEKNTIKFMRELWSLLLSAQQNASGVPQ  120

Query  425  QFLDAK  442
            QFLDAK
Sbjct  121  QFLDAK  126



>ref|XP_008681486.1| PREDICTED: uncharacterized protein LOC100304415 isoform X1 [Zea 
mays]
Length=906

 Score =   209 bits (532),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 103/137 (75%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPEL+HLVD  KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDTSKVKMDVMKPWIAKRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLE K+ +GK++QIQLTGFME+NT KFM+ELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMRELWTLLLSAQQNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG*D  475
            QFLD K    +++K  D
Sbjct  121  QFLDEKEAEIQQKKAED  137



>ref|XP_008681498.1| PREDICTED: uncharacterized protein LOC100304415 isoform X2 [Zea 
mays]
 tpg|DAA44608.1| TPA: hypothetical protein ZEAMMB73_474732 [Zea mays]
Length=901

 Score =   209 bits (532),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 103/137 (75%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPEL+HLVD  KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDTSKVKMDVMKPWIAKRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LLE K+ +GK++QIQLTGFME+NT KFM+ELW+LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMRELWTLLLSAQQNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG*D  475
            QFLD K    +++K  D
Sbjct  121  QFLDEKEAEIQQKKAED  137



>emb|CDY65665.1| BnaC04g54780D [Brassica napus]
Length=817

 Score =   209 bits (531),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 99/125 (79%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGTTADQDTRFSNKQAKL+KSQKFA ELE LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTTADQDTRFSNKQAKLMKSQKFASELETLVDVSKVKMDVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+ K VNGKE+QI +TGFME+NT KFMKELW+LLLSAQ+N+ G+PQ
Sbjct  61   GFEDEVLINFIYGLLDKKVVNGKEIQIAITGFMEKNTVKFMKELWTLLLSAQSNSSGIPQ  120

Query  425  QFLDA  439
            QFLDA
Sbjct  121  QFLDA  125



>gb|ABW81077.1| Prp9 [Cleome spinosa]
Length=919

 Score =   209 bits (531),  Expect = 5e-59, Method: Composition-based stats.
 Identities = 105/131 (80%), Positives = 115/131 (88%), Gaps = 3/131 (2%)
 Frame = +2

Query  80   FRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIEDE  259
            F+GT+A+QDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+G EDE
Sbjct  31   FQGTSAEQDTRFSNKQAKLLKTQKFAPELEHLVDMAKVKMDVMKPWIANRVTELLGFEDE  90

Query  260  VLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQQFLDA  439
            VLI FIY LL+GK VNGKE+QI LTGFME+NT KFMKELW+LLLSAQ NA GVPQQFLDA
Sbjct  91   VLINFIYGLLDGKVVNGKEIQISLTGFMEKNTTKFMKELWTLLLSAQKNASGVPQQFLDA  150

Query  440  K---GRGNKEE  463
            K    R  KEE
Sbjct  151  KEAETRKKKEE  161



>ref|XP_004153149.1| PREDICTED: uncharacterized protein LOC101206654 [Cucumis sativus]
 ref|XP_004163809.1| PREDICTED: uncharacterized protein LOC101225621 [Cucumis sativus]
Length=899

 Score =   207 bits (527),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 104/135 (77%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKF  EL+ LVD  KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFPAELDQLVDTTKVKMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGKEVQIQLTGFME+NT KFMKELW LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQIQLTGFMEKNTVKFMKELWILLLSAQKNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG  469
            QFLDAK    +++K 
Sbjct  121  QFLDAKEEEIRKKKA  135



>ref|XP_008457448.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Cucumis 
melo]
Length=893

 Score =   207 bits (526),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 104/135 (77%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKF  EL+ LVD  KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFPAELDQLVDTTKVKMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGKEVQIQLTGFME+NT KFMKELW LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQIQLTGFMEKNTVKFMKELWILLLSAQKNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG  469
            QFLDAK    +++K 
Sbjct  121  QFLDAKEEEIRKKKA  135



>ref|XP_010685690.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010685691.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=888

 Score =   207 bits (526),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 105/126 (83%), Positives = 117/126 (93%), Gaps = 1/126 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTE-L  241
            M+GG FRGT+A+QDTRFSNKQAKLLK+QKFA ELEHLVD+ KVKMDV++PWIAKRVTE L
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKTQKFAAELEHLVDITKVKMDVIKPWIAKRVTEFL  60

Query  242  VGIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVP  421
             G EDE+LI FIY LLEGK+VNGK+VQIQLTGFME+NTGKFMKELW+LLLSAQNNA GVP
Sbjct  61   EGFEDELLINFIYGLLEGKEVNGKQVQIQLTGFMEKNTGKFMKELWALLLSAQNNASGVP  120

Query  422  QQFLDA  439
            QQFLDA
Sbjct  121  QQFLDA  126



>ref|XP_004145330.1| PREDICTED: uncharacterized protein LOC101207842 [Cucumis sativus]
 gb|KGN65748.1| hypothetical protein Csa_1G524700 [Cucumis sativus]
Length=878

 Score =   207 bits (526),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 104/135 (77%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKF  EL+ LVD  KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFPAELDQLVDTTKVKMDVIRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+GK+VNGKEVQIQLTGFME+NT KFMKELW LLLSAQ NA GVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQIQLTGFMEKNTVKFMKELWILLLSAQKNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG  469
            QFLDAK    +++K 
Sbjct  121  QFLDAKEEEIRKKKA  135



>ref|XP_010685692.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=874

 Score =   206 bits (525),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 105/126 (83%), Positives = 117/126 (93%), Gaps = 1/126 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTE-L  241
            M+GG FRGT+A+QDTRFSNKQAKLLK+QKFA ELEHLVD+ KVKMDV++PWIAKRVTE L
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKTQKFAAELEHLVDITKVKMDVIKPWIAKRVTEFL  60

Query  242  VGIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVP  421
             G EDE+LI FIY LLEGK+VNGK+VQIQLTGFME+NTGKFMKELW+LLLSAQNNA GVP
Sbjct  61   EGFEDELLINFIYGLLEGKEVNGKQVQIQLTGFMEKNTGKFMKELWALLLSAQNNASGVP  120

Query  422  QQFLDA  439
            QQFLDA
Sbjct  121  QQFLDA  126



>gb|KHN32153.1| Serine/arginine repetitive matrix protein 1 [Glycine soja]
Length=952

 Score =   205 bits (522),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 98/119 (82%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  86   GTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIEDEVL  265
            GT+ADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV M+V++PWI +RVTEL+G EDEVL
Sbjct  70   GTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMEVIKPWITRRVTELLGFEDEVL  129

Query  266  IXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQQFLDAK  442
            I FI+SLL+ K+VNGKEVQIQ+TGFME+NTGKFMKELW LLLSAQ NA GVPQQFLDAK
Sbjct  130  INFIHSLLDAKEVNGKEVQIQITGFMEKNTGKFMKELWMLLLSAQKNASGVPQQFLDAK  188



>ref|XP_002973816.1| hypothetical protein SELMODRAFT_100233 [Selaginella moellendorffii]
 ref|XP_002983574.1| hypothetical protein SELMODRAFT_118260 [Selaginella moellendorffii]
 gb|EFJ15475.1| hypothetical protein SELMODRAFT_118260 [Selaginella moellendorffii]
 gb|EFJ24771.1| hypothetical protein SELMODRAFT_100233 [Selaginella moellendorffii]
Length=211

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ +QDTRFSNK AKLLK+QKFA EL+  +DM KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSTEQDTRFSNKMAKLLKTQKFASELDQPIDMSKVNMDVMRPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIY LL+ K  +GK +QIQLTGFME+NTG+FMKELW LL SAQ+NA G+PQ
Sbjct  61   GFEDEVLINFIYGLLDVKVGDGKHIQIQLTGFMEKNTGRFMKELWGLLASAQSNASGIPQ  120

Query  425  QFLDAKG  445
              LD K 
Sbjct  121  ALLDKKA  127



>ref|XP_008803113.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Phoenix dactylifera]
Length=875

 Score =   204 bits (519),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 111/176 (63%), Positives = 138/176 (78%), Gaps = 3/176 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KV+MDV+RPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVEMDVIRPWIATRATELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI F+Y LL+GK+V+GK++QIQLTGFME+NTGKFMKELW+LLLSAQNNA GVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQIQIQLTGFMEKNTGKFMKELWALLLSAQNNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG*D*SNNK*NTEEKRERISRT*ARKKK--ADGNVDISRDTHA  586
            Q LDAK       K  +        ++++E++ R   ++K+   DG  + SR  +A
Sbjct  121  QLLDAKKEETDRRKA-ETDRIAQEIQKRKEKVGRELEQEKQRGMDGAAEKSRSANA  175



>ref|XP_008803112.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Phoenix dactylifera]
Length=896

 Score =   204 bits (519),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 111/176 (63%), Positives = 138/176 (78%), Gaps = 3/176 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KV+MDV+RPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVEMDVIRPWIATRATELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI F+Y LL+GK+V+GK++QIQLTGFME+NTGKFMKELW+LLLSAQNNA GVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQIQIQLTGFMEKNTGKFMKELWALLLSAQNNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG*D*SNNK*NTEEKRERISRT*ARKKK--ADGNVDISRDTHA  586
            Q LDAK       K  +        ++++E++ R   ++K+   DG  + SR  +A
Sbjct  121  QLLDAKKEETDRRKA-ETDRIAQEIQKRKEKVGRELEQEKQRGMDGAAEKSRSANA  175



>ref|XP_010937571.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Elaeis guineensis]
Length=911

 Score =   204 bits (518),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 111/175 (63%), Positives = 135/175 (77%), Gaps = 1/175 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KVKMDV+RPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVKMDVIRPWIATRATELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEV+I F+Y LL+ K+V+GK++QIQLTGFME+NTGKFMKELW LLLSAQNNA GVPQ
Sbjct  61   GFEDEVIINFVYGLLDVKEVDGKQIQIQLTGFMEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG-*D*SNNK*NTEEKRERISRT*ARKKKADGNVDISRDTHA  586
            QFLDAK       K   D    +    +++ER      ++++ DG  + SR  +A
Sbjct  121  QFLDAKKEETDRRKAETDRIAQEIQKRKEKERRELEQEKQRRMDGVAEKSRSANA  175



>ref|XP_010937572.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Elaeis guineensis]
Length=876

 Score =   204 bits (518),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 111/175 (63%), Positives = 135/175 (77%), Gaps = 1/175 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KVKMDV+RPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVKMDVIRPWIATRATELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEV+I F+Y LL+ K+V+GK++QIQLTGFME+NTGKFMKELW LLLSAQNNA GVPQ
Sbjct  61   GFEDEVIINFVYGLLDVKEVDGKQIQIQLTGFMEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  425  QFLDAKGRGNKEEKG-*D*SNNK*NTEEKRERISRT*ARKKKADGNVDISRDTHA  586
            QFLDAK       K   D    +    +++ER      ++++ DG  + SR  +A
Sbjct  121  QFLDAKKEETDRRKAETDRIAQEIQKRKEKERRELEQEKQRRMDGVAEKSRSANA  175



>ref|XP_010326174.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Solanum lycopersicum]
Length=897

 Score =   202 bits (514),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 111/136 (82%), Positives = 120/136 (88%), Gaps = 3/136 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV++PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIKPWIAKRVTELI  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIYSLLE K  NGKE+QI LTGFMERNT KFMKELW+LLLSAQNNA GVPQ
Sbjct  61   GFEDEVLINFIYSLLERKVANGKELQISLTGFMERNTAKFMKELWALLLSAQNNASGVPQ  120

Query  425  QFLDAKG---RGNKEE  463
            QFL+AK    R NK E
Sbjct  121  QFLEAKEEEMRNNKAE  136



>gb|AAC95214.1| putative proline-rich protein [Arabidopsis thaliana]
Length=891

 Score =   202 bits (514),  Expect = 9e-57, Method: Composition-based stats.
 Identities = 100/127 (79%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   GTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIEDEVL  265
            GT+A+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+GIEDEVL
Sbjct  28   GTSAEQDTRFSNKQAKLMKSQKFAPELENLVDITKVKMDVMKPWIATRVTELLGIEDEVL  87

Query  266  IXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQQFLDAKG  445
            I FIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN  GVPQQFLDA+ 
Sbjct  88   INFIYGLLDGKVVNGKEIQITLTGFMEKNTGKFMKELWTLLLSAQNNPSGVPQQFLDARA  147

Query  446  RGNKEEK  466
               K+++
Sbjct  148  AETKKKQ  154



>ref|XP_004246955.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Solanum lycopersicum]
Length=921

 Score =   202 bits (514),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 111/136 (82%), Positives = 120/136 (88%), Gaps = 3/136 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+A+QDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV++PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIKPWIAKRVTELI  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI FIYSLLE K  NGKE+QI LTGFMERNT KFMKELW+LLLSAQNNA GVPQ
Sbjct  61   GFEDEVLINFIYSLLERKVANGKELQISLTGFMERNTAKFMKELWALLLSAQNNASGVPQ  120

Query  425  QFLDAKG---RGNKEE  463
            QFL+AK    R NK E
Sbjct  121  QFLEAKEEEMRNNKAE  136



>ref|XP_011035260.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Populus euphratica]
Length=879

 Score =   199 bits (506),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 101/135 (75%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPEL+HLV+  KVKMD+++PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVNTRKVKMDIIKPWIANRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI F+Y LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N  GVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  425  QFLDAKGRGNKEEKG  469
            QFLDAK    ++++ 
Sbjct  121  QFLDAKEEETRKKQA  135



>ref|XP_011035259.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Populus euphratica]
Length=890

 Score =   199 bits (506),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 101/135 (75%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPEL+HLV+  KVKMD+++PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVNTRKVKMDIIKPWIANRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI F+Y LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N  GVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  425  QFLDAKGRGNKEEKG  469
            QFLDAK    ++++ 
Sbjct  121  QFLDAKEEETRKKQA  135



>ref|XP_011035261.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Populus euphratica]
Length=877

 Score =   199 bits (505),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 101/135 (75%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPEL+HLV+  KVKMD+++PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVNTRKVKMDIIKPWIANRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI F+Y LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N  GVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  425  QFLDAKGRGNKEEKG  469
            QFLDAK    ++++ 
Sbjct  121  QFLDAKEEETRKKQA  135



>ref|XP_011035262.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Populus euphratica]
Length=854

 Score =   198 bits (503),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 101/135 (75%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+GG FRGT+ADQDTRFSNKQAKLLKSQKFAPEL+HLV+  KVKMD+++PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVNTRKVKMDIIKPWIANRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            G EDEVLI F+Y LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N  GVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  425  QFLDAKGRGNKEEKG  469
            QFLDAK    ++++ 
Sbjct  121  QFLDAKEEETRKKQA  135



>gb|EPB85601.1| hypothetical protein HMPREF1544_07594 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=175

 Score =   157 bits (396),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+ADQD+RFSNK+ KLLKS  F PE +  VDM KV +DV++PWI+ R+TEL+G 
Sbjct  4    AGFFKGTSADQDSRFSNKEKKLLKSMSFPPEFDQKVDMKKVNLDVIKPWISNRITELLGF  63

Query  251  EDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQQF  430
            EDEV+I +  SLLE KD + K +QI LTGF+E  T  F+ ELW+LLLSAQN+  G+P +F
Sbjct  64   EDEVVIDYTCSLLEEKDQDPKRMQINLTGFLESKTQAFLSELWNLLLSAQNSVGGIPTEF  123

Query  431  LDAK  442
            ++ K
Sbjct  124  IEQK  127



>emb|CDS13551.1| hypothetical protein LRAMOSA05727 [Absidia idahoensis var. thermophila]
Length=337

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+ADQD+RFSNK+ KLLKS  F PE +  V+M KVK+DV++PW+ +R+TEL+G+
Sbjct  27   AGFFKGTSADQDSRFSNKEKKLLKSMSFPPEFDQKVNMKKVKLDVIKPWMTQRITELLGV  86

Query  251  EDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQQF  430
            EDE++I F + LLE KD + K +QI LTGF+E+NT +F+ ELW LLLSAQ++  G+P+QF
Sbjct  87   EDELVIDFAFGLLEEKDPDPKLMQINLTGFLEKNTQQFILELWKLLLSAQDSVSGIPKQF  146

Query  431  LDAK  442
            L+ K
Sbjct  147  LEQK  150



>emb|CDH50351.1| pwi domain-containing protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=324

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+ADQD+RFSNK+ KLLKS  F PE +  V+M KVK+DV++PW+ +R+TEL+G+
Sbjct  4    AGFFKGTSADQDSRFSNKEKKLLKSMSFPPEFDQKVNMKKVKLDVIKPWMTQRITELLGV  63

Query  251  EDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQQF  430
            EDE++I F + LLE KD + K +QI LTGF+E+NT +F+ ELW LLLSAQ++  G+P+QF
Sbjct  64   EDELVIDFAFGLLEEKDPDPKLMQINLTGFLEKNTQQFILELWKLLLSAQDSVSGIPKQF  123

Query  431  LDAK  442
            L+ K
Sbjct  124  LEQK  127



>ref|XP_006409967.1| hypothetical protein EUTSA_v10016250mg [Eutrema salsugineum]
 gb|ESQ51420.1| hypothetical protein EUTSA_v10016250mg [Eutrema salsugineum]
Length=804

 Score =   163 bits (412),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  176  VDMGKVKMDVMRPWIAKRVTELVGIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNT  355
            VD+ KVKMDVM+PWIA RVTEL+G EDEVLI FIY LL+GK VNGKE+QI LTGFME+NT
Sbjct  11   VDVTKVKMDVMKPWIATRVTELLGFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNT  70

Query  356  GKFMKELWSLLLSAQNNAXGVPQQFLDAK  442
            GKFMKELW+LL+SAQNN+ GVPQQFLDAK
Sbjct  71   GKFMKELWTLLISAQNNSSGVPQQFLDAK  99



>dbj|GAN09279.1| PWI domain-containing protein [Mucor ambiguus]
Length=258

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+ADQD+RFSNK+ KLLKS  F  E +  VDM KV +DV++PWI+ R+TEL+G 
Sbjct  4    AGFFKGTSADQDSRFSNKEKKLLKSMSFPSEFDQKVDMKKVNLDVIKPWISNRITELLGF  63

Query  251  EDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQQF  430
            EDEV+I +  SLLE KD + K +QI LTGF+E  T  F+ ELW+LLLSAQN+  G+P +F
Sbjct  64   EDEVVIDYTCSLLEEKDQDPKRMQINLTGFLESKTQAFLSELWNLLLSAQNSVGGIPTEF  123

Query  431  LDAK  442
            ++ K
Sbjct  124  IEQK  127



>gb|KDO66638.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
Length=807

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  182  MGKVKMDVMRPWIAKRVTELVGIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGK  361
            M KVKMDVM+PWIA RVTEL+G EDEVLI FIY LLEGK+VNGKEVQI LTGFME++T K
Sbjct  1    MTKVKMDVMKPWIATRVTELLGFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAK  60

Query  362  FMKELWSLLLSAQNNAXGVPQQFLDAK  442
            FMKELW+LLLSAQ NA GVPQQFLDAK
Sbjct  61   FMKELWTLLLSAQKNASGVPQQFLDAK  87



>emb|CEG73501.1| Putative PWI domain-containing protein [Rhizopus microsporus]
 emb|CEI87964.1| Putative PWI domain-containing protein [Rhizopus microsporus]
Length=228

 Score =   151 bits (382),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+ADQD+RFSNK+ KLLK+  F PE +  VDM KV +DV+RPWIA +VTEL+G 
Sbjct  4    AGFFKGTSADQDSRFSNKEKKLLKTMSFPPEFDKKVDMKKVNLDVIRPWIANKVTELLGF  63

Query  251  EDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQQF  430
            EDEV+  +  SLLE ++++ K +QI LTGF+E N   F+KELW+LLLSAQN+  G+P  F
Sbjct  64   EDEVVADYAASLLEEENIDPKMMQINLTGFLENNAKVFVKELWNLLLSAQNSVGGIPAIF  123

Query  431  LDAK  442
            ++ K
Sbjct  124  IEQK  127



>emb|CEP13732.1| hypothetical protein [Parasitella parasitica]
Length=251

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+ADQD+RFSNK+ KLLK+  F  E +  VDM KV +DV++PWI+ R+TEL+G 
Sbjct  4    AGFFKGTSADQDSRFSNKEKKLLKTMTFPSEFDQKVDMKKVNLDVIKPWISNRITELLGF  63

Query  251  EDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQQF  430
            EDEV+I +  SLLE KD + K +QI LTGF+E  T  F+ ELW LLLSAQN+  G+P +F
Sbjct  64   EDEVVIDYTCSLLEEKDQDPKRMQINLTGFLEGKTQAFLGELWKLLLSAQNSVGGIPVEF  123

Query  431  LDAK  442
            ++ K
Sbjct  124  IEQK  127



>gb|KDQ07409.1| hypothetical protein BOTBODRAFT_120067, partial [Botryobasidium 
botryosum FD-172 SS1]
Length=159

 Score =   149 bits (375),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 92/126 (73%), Gaps = 3/126 (2%)
 Frame = +2

Query  74   GLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIE  253
            G F+GT+ DQD RFS+K+++LLKS KF PE +  VDM KV + VMRPWIAKRV EL+G E
Sbjct  29   GFFKGTSTDQDRRFSDKESRLLKSMKFPPEFDQKVDMRKVNLQVMRPWIAKRVVELIGFE  88

Query  254  DEVLIXFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            DEV++ +   LLE K     + K +QI LTGF+E  T +FM  LW+LL+SAQ++  GVPQ
Sbjct  89   DEVVVEYAMGLLEDKSKPTPDPKLMQINLTGFLESKTPEFMSSLWTLLISAQSSIGGVPQ  148

Query  425  QFLDAK  442
            QFLD K
Sbjct  149  QFLDEK  154



>gb|KDD75666.1| hypothetical protein H632_c561p1 [Helicosporidium sp. ATCC 50920]
Length=141

 Score =   147 bits (370),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M+G  FRG +A+QD RF +K+ KL+ S +F  E +  V++  V   VM+PWIA RVTEL+
Sbjct  1    MSGNGFRGVSAEQDGRFKDKERKLMASMRFPREFDTKVNLVAVNWTVMKPWIATRVTELL  60

Query  245  GIEDEVLIXFIYSLLEGKD-VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVP  421
            GIED+VLI +IY+ LEGK  +N +++QI LTGF+E+N   F KELWSLL+SA++N  G+P
Sbjct  61   GIEDDVLIEYIYAQLEGKQTINPRQLQINLTGFLEQNAASFCKELWSLLMSAESNGTGIP  120

Query  422  QQFLDAKG  445
            Q+FLD K 
Sbjct  121  QRFLDEKA  128



>emb|CDH50352.1| pwi domain-containing protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=330

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 97/130 (75%), Gaps = 6/130 (5%)
 Frame = +2

Query  71   GGLFRGT------TADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRV  232
             G F+ +       ADQD+RFSNK+ KLLKS  F PE +  V+M KVK+DV++PW+ +R+
Sbjct  4    AGFFKSSVLAHFLAADQDSRFSNKEKKLLKSMSFPPEFDQKVNMKKVKLDVIKPWMTQRI  63

Query  233  TELVGIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAX  412
            TEL+G+EDE++I F + LLE KD + K +QI LTGF+E+NT +F+ ELW LLLSAQ++  
Sbjct  64   TELLGVEDELVIDFAFGLLEEKDPDPKLMQINLTGFLEKNTQQFILELWKLLLSAQDSVS  123

Query  413  GVPQQFLDAK  442
            G+P+QFL+ K
Sbjct  124  GIPKQFLEQK  133



>gb|AHH81768.1| serine/arginine repetitive matrix protein 1-like protein, partial 
[Biomphalaria glabrata]
Length=307

 Score =   146 bits (368),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 91/125 (73%), Gaps = 1/125 (1%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G FRGTTA QDTRFS+K+ KL+K+ KF   LE  VDM KV +D ++PWIA+R+TEL+G+
Sbjct  3    AGFFRGTTAQQDTRFSDKRKKLMKTMKFGEGLERKVDMTKVNVDSLKPWIAQRITELLGM  62

Query  251  EDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVPQQ  427
            ED+V++ F+Y+ LE +  + KE+QI +TGF+  +N   F+ ELW  L SAQ N  G+P Q
Sbjct  63   EDDVVVEFVYNQLEERHPDAKEMQINITGFLNGKNARIFLSELWDHLCSAQENVTGIPNQ  122

Query  428  FLDAK  442
            FL+ K
Sbjct  123  FLEQK  127



>ref|XP_005988814.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Latimeria chalumnae]
Length=923

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLL+  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLRQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V++ FI++ LE K+ + K +QI LTGF+  +N  +F+ ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVIVEFIFNQLEEKNPDAKMMQINLTGFLNGKNAREFLGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLEQK  127



>ref|XP_005988815.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Latimeria chalumnae]
Length=927

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLL+  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLRQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V++ FI++ LE K+ + K +QI LTGF+  +N  +F+ ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVIVEFIFNQLEEKNPDAKMMQINLTGFLNGKNAREFLGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLEQK  127



>gb|EMS22473.1| SR-rich pre-mRNA splicing activator [Rhodosporidium toruloides 
NP11]
 emb|CDR46859.1| RHTO0S13e02630g1_1 [Rhodosporidium toruloides]
Length=417

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 91/135 (67%), Gaps = 3/135 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M    FRGT+ DQD RF +KQ+ LL+  +F P  +  VDM KV+M VM+PWI K+V EL+
Sbjct  1    MGSNFFRGTSLDQDPRFKDKQSALLRKTQFPPSFDTKVDMRKVEMGVMKPWITKKVIELL  60

Query  245  GIEDEVLIXFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXG  415
            G ED+VLI +IYSLLE  +   V+GK +QI LTGF+E  T  FM  LW LLLSAQ+N   
Sbjct  61   GFEDDVLIEYIYSLLEDPENPVVDGKNMQILLTGFLESKTAAFMNHLWDLLLSAQSNPLR  120

Query  416  VPQQFLDAKGRGNKE  460
            VP + L+ K R  +E
Sbjct  121  VPTELLEEKKREMRE  135



>gb|KJB83750.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
 gb|KJB83754.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
Length=823

 Score =   149 bits (376),  Expect = 7e-38, Method: Composition-based stats.
 Identities = 74/96 (77%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +2

Query  182  MGKVKMDVMRPWIAKRVTELVGIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGK  361
            M KVKMDV+RPWIA RVTEL+G EDEVLI FIY LL+GK+VNGK+VQI LTGFME+NTGK
Sbjct  1    MTKVKMDVIRPWIATRVTELLGFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGK  60

Query  362  FMKELWSLLLSAQNNAXGVPQQFLDAKGRGNKEEKG  469
            FMKELWSLLLSAQ NA GVPQQFLDAK    +++K 
Sbjct  61   FMKELWSLLLSAQRNASGVPQQFLDAKEEETRKKKA  96



>gb|KIM46751.1| hypothetical protein M413DRAFT_40460, partial [Hebeloma cylindrosporum 
h7]
Length=144

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 90/123 (73%), Gaps = 3/123 (2%)
 Frame = +2

Query  83   RGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIEDEV  262
            +GT+ADQD RFS+K+ KLLKS KF PE E  VDM KV ++V+RPWIAK++TEL+G EDEV
Sbjct  1    KGTSADQDRRFSDKEVKLLKSMKFPPEFEKKVDMRKVNLNVIRPWIAKKITELIGFEDEV  60

Query  263  LIXFIYSLLEGK---DVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQQFL  433
            ++ +   LLE +   + + K++QI LTGF+ ++T  FM  LW LLL AQ +  GVP+ FL
Sbjct  61   VVEYAMGLLEDEQQPNPDPKKMQINLTGFLNKDTPVFMDALWKLLLEAQEDVTGVPRTFL  120

Query  434  DAK  442
            + K
Sbjct  121  EQK  123



>gb|KIJ61599.1| hypothetical protein HYDPIDRAFT_137559 [Hydnomerulius pinastri 
MD-312]
Length=279

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 91/127 (72%), Gaps = 3/127 (2%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+ADQD RFS+K+ KLLKS KF PE +  VDM KV + V++PWIAK+VTELVG+
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKSMKFPPEFDKKVDMKKVNLQVIKPWIAKKVTELVGL  63

Query  251  EDEVLIXFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVP  421
            EDEV++ +   LLE  +    + K++QI LTGF+  +T  FM  LW+LLL AQ +  GVP
Sbjct  64   EDEVVVEYAMGLLEDPNHTHPDPKKMQINLTGFLTSSTPTFMTALWTLLLEAQESPAGVP  123

Query  422  QQFLDAK  442
            + F++ K
Sbjct  124  KTFVEEK  130



>gb|KDQ31993.1| hypothetical protein PLEOSDRAFT_1025753, partial [Pleurotus ostreatus 
PC15]
Length=136

 Score =   136 bits (342),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 90/128 (70%), Gaps = 5/128 (4%)
 Frame = +2

Query  74   GLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIE  253
            G F+GT+A+QD RFS+K+ KLLKS KF PE +  VDM KV ++V+RPW+AK+VTELVG E
Sbjct  1    GFFKGTSAEQDRRFSDKELKLLKSMKFPPEFDKKVDMRKVNLEVIRPWVAKKVTELVGFE  60

Query  254  DEVLIXFIYSLLEGKD-----VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGV  418
            DEV++ +   LLE +       + K++QI LTGF+ ++T  FM  LW LLL AQ    GV
Sbjct  61   DEVVVEYAMGLLEDQKQSPQFPDPKKMQINLTGFLTKDTPAFMLALWKLLLEAQEEVSGV  120

Query  419  PQQFLDAK  442
            P+ FL+ K
Sbjct  121  PRTFLEEK  128



>gb|KIO25371.1| hypothetical protein M407DRAFT_25274 [Tulasnella calospora MUT 
4182]
Length=418

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 93/126 (74%), Gaps = 2/126 (2%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+ADQD+RFSNK  +L K  KF PE +  VDM KV++ V +PWI KRVTE++G+
Sbjct  4    AGFFKGTSADQDSRFSNKDQRLRKQIKFPPEFDQKVDMKKVELSVFKPWIYKRVTEIIGL  63

Query  251  EDEVLIXFIYSLLE--GKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            EDEV+I ++   LE  GK  + K++QI+LTGF+   TG+FM +LW LLLSAQ +  GVP 
Sbjct  64   EDEVVIEYVNEQLEQSGKSPDPKDIQIKLTGFLGSKTGEFMLQLWKLLLSAQVSPGGVPA  123

Query  425  QFLDAK  442
            +F++AK
Sbjct  124  EFIEAK  129



>ref|XP_007366678.1| PWI domain-containing protein [Dichomitus squalens LYAD-421 SS1]
 gb|EJF60539.1| PWI domain-containing protein [Dichomitus squalens LYAD-421 SS1]
Length=215

 Score =   138 bits (348),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 88/129 (68%), Gaps = 3/129 (2%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G F+GT+ADQD RFS+K+ KLLK+ KF PE +  VDM KV + V+RPWI K+V ELV
Sbjct  1    MCSGFFKGTSADQDRRFSDKELKLLKTMKFPPEFDKKVDMRKVNLAVIRPWIVKKVVELV  60

Query  245  GIEDEVLIXFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXG  415
            G EDEV++ +   LLE       + + +QI LTGF+ +NT  FM  LW+LLL AQ +  G
Sbjct  61   GFEDEVVVEYAMGLLEDDSQPTPDPRRMQINLTGFLTKNTPAFMSALWNLLLEAQESPAG  120

Query  416  VPQQFLDAK  442
            VP+ F++ K
Sbjct  121  VPRTFVEEK  129



>ref|XP_002124610.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Ciona intestinalis]
 ref|XP_009861959.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Ciona intestinalis]
Length=197

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 92/127 (72%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+ DQD RF+NKQ KLLKS KFA  L   VDM K+++D ++PWI+KR+TE++
Sbjct  1    MDAGFFRGTSTDQDNRFANKQKKLLKSMKFADGLGVKVDMRKIQLDTIKPWISKRITEML  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I F+Y+ LE +  + K +QI LTGF+  +N+  F+ ELW  L SAQ+N  G+P
Sbjct  61   GFEDDVVIAFVYNSLEEQFPDPKVLQINLTGFLNGKNSRIFLGELWEHLASAQDNDMGIP  120

Query  422  QQFLDAK  442
            Q FL+ K
Sbjct  121  QVFLEEK  127



>ref|XP_009549905.1| hypothetical protein HETIRDRAFT_243565, partial [Heterobasidion 
irregulare TC 32-1]
 gb|ETW77888.1| hypothetical protein HETIRDRAFT_243565, partial [Heterobasidion 
irregulare TC 32-1]
Length=134

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 90/126 (71%), Gaps = 3/126 (2%)
 Frame = +2

Query  74   GLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIE  253
            G F+GT+ADQD RFS+K+ KLLKS KF PE +  VDM KV ++V+RPW+AK+V ELVG E
Sbjct  1    GFFKGTSADQDRRFSDKELKLLKSIKFPPEFDKKVDMRKVNIEVIRPWVAKKVVELVGFE  60

Query  254  DEVLIXFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            DEV++ +   LLE +     + K++QI LTGF+  +T  FM  LW+LLL AQ +  G+P+
Sbjct  61   DEVVVEYAMGLLEDESQPTPDPKKMQINLTGFLTASTPAFMSALWALLLEAQESPAGIPK  120

Query  425  QFLDAK  442
             F++ K
Sbjct  121  TFVEEK  126



>gb|KIM70671.1| hypothetical protein SCLCIDRAFT_76017, partial [Scleroderma citrinum 
Foug A]
Length=134

 Score =   135 bits (340),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 89/126 (71%), Gaps = 3/126 (2%)
 Frame = +2

Query  74   GLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIE  253
            G F+GT+ADQD RFS+K+ KLLKS KF PE +  VDM KV +++++PWIAK+VTELVG E
Sbjct  1    GFFKGTSADQDRRFSDKELKLLKSMKFPPEFDKKVDMKKVNLEIIKPWIAKKVTELVGFE  60

Query  254  DEVLIXFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            DEV+I +   LLE       + K++QI LTGF+  +T  FM  LW LLL +Q++  GVP 
Sbjct  61   DEVVIEYAMGLLEDPHQTTPDPKKMQINLTGFLTSSTPAFMTALWDLLLESQDSPGGVPT  120

Query  425  QFLDAK  442
              ++AK
Sbjct  121  SMVEAK  126



>dbj|GAA99222.1| hypothetical protein E5Q_05915 [Mixia osmundae IAM 14324]
 gb|KEI39847.1| hypothetical protein L969DRAFT_47755 [Mixia osmundae IAM 14324]
Length=530

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 91/126 (72%), Gaps = 3/126 (2%)
 Frame = +2

Query  80   FRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIEDE  259
             RGTT +QD RF++K  +LLK+ KF  E    VDM KV+M VMRPWIA+RVTEL+G+EDE
Sbjct  4    MRGTTFEQDIRFADKDKQLLKTMKFPAEFAQRVDMRKVEMSVMRPWIARRVTELLGMEDE  63

Query  260  VLIXFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQQF  430
            V+I ++  LLE K    V+ K++QI LTGF+ER T  FM ELW+LLLSAQ +   VP QF
Sbjct  64   VVIEYVNGLLEDKAAPLVDPKKMQISLTGFLERKTAPFMIELWNLLLSAQASPVKVPAQF  123

Query  431  LDAKGR  448
            ++ K R
Sbjct  124  IEEKKR  129



>gb|KII87767.1| hypothetical protein PLICRDRAFT_112049 [Plicaturopsis crispa 
FD-325 SS-3]
Length=330

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 89/127 (70%), Gaps = 3/127 (2%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+ADQD RFS+K+ KLLKS KF PE +  VDM KV + V+RPWIAK++ ELVG 
Sbjct  17   AGFFKGTSADQDRRFSDKELKLLKSMKFPPEFDKKVDMRKVNLQVIRPWIAKKIIELVGF  76

Query  251  EDEVLIXFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVP  421
            EDEV++ +   LLE K     + K++QI LTGF+  +T  FM  LW+LLL AQ +  GVP
Sbjct  77   EDEVVVEYAMGLLEDKQQPTPDPKKMQINLTGFLTNSTPSFMTSLWNLLLEAQESEAGVP  136

Query  422  QQFLDAK  442
            + FL+ K
Sbjct  137  RTFLEEK  143



>emb|CCO26855.1| PWI domain-containing protein C825,05c [Rhizoctonia solani AG-1 
IB]
Length=274

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 88/126 (70%), Gaps = 2/126 (2%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+A+QD RF++K+ +LLKS KF PE +  VDM KV++ VMRPWI K+V ELVG 
Sbjct  4    AGFFKGTSAEQDRRFADKEHRLLKSMKFPPEFDRKVDMRKVELSVMRPWITKKVVELVGF  63

Query  251  EDEVLIXFIYSLLE--GKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            EDEV++ ++  LLE   K  + K +QI LTGF+E  T  FM  LW+LLL AQ++  GVP 
Sbjct  64   EDEVVVEYVMGLLEDRSKPPDPKLMQINLTGFLESKTPAFMSSLWALLLEAQDSPAGVPA  123

Query  425  QFLDAK  442
             F+  K
Sbjct  124  SFVQEK  129



>ref|XP_002124674.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Ciona intestinalis]
Length=233

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 92/127 (72%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+ DQD RF+NKQ KLLKS KFA  L   VDM K+++D ++PWI+KR+TE++
Sbjct  37   MDAGFFRGTSTDQDNRFANKQKKLLKSMKFADGLGVKVDMRKIQLDTIKPWISKRITEML  96

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I F+Y+ LE +  + K +QI LTGF+  +N+  F+ ELW  L SAQ+N  G+P
Sbjct  97   GFEDDVVIAFVYNSLEEQFPDPKVLQINLTGFLNGKNSRIFLGELWEHLASAQDNDMGIP  156

Query  422  QQFLDAK  442
            Q FL+ K
Sbjct  157  QVFLEEK  163



>ref|XP_008041955.1| PWI domain-containing protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW54865.1| PWI domain-containing protein [Trametes versicolor FP-101664 
SS1]
Length=285

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 90/138 (65%), Gaps = 3/138 (2%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+ADQD RFS+K+ KLLK+ KF PE E  VDM KV + V+RPWI K+V ELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKTMKFPPEFEKKVDMRKVNLSVIRPWIVKKVIELVGF  63

Query  251  EDEVLIXFIYSLLE---GKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVP  421
            EDEV++ +   LLE       + + +QI LTGF+ ++T  FM  LW LLL AQ +  GVP
Sbjct  64   EDEVVVEYAMGLLEDDAAPTPDPRRMQINLTGFLTKSTPAFMSALWQLLLEAQESPAGVP  123

Query  422  QQFLDAKGRGNKEEKG*D  475
            + F++ K    ++ K  D
Sbjct  124  RTFVEEKKAEMRQAKAGD  141



>ref|XP_005988813.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Latimeria chalumnae]
Length=923

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 92/127 (72%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M G  + GT+A+QD RFSNKQ KLL+  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MEGPRWPGTSAEQDNRFSNKQKKLLRQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V++ FI++ LE K+ + K +QI LTGF+  +N  +F+ ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVIVEFIFNQLEEKNPDAKMMQINLTGFLNGKNAREFLGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLEQK  127



>dbj|BAB25575.1| unnamed protein product [Mus musculus]
Length=265

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>gb|KIP02407.1| hypothetical protein PHLGIDRAFT_112065 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=211

 Score =   136 bits (343),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 89/128 (70%), Gaps = 5/128 (4%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+ADQD RFS+K+ KLLKS KF PE E  VDM KV + V+RPWI  +V ELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKSMKFPPEFEKKVDMRKVNLTVIRPWIVSKVVELVGF  63

Query  251  EDEVLIXFIYSLLEGKDV----NGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGV  418
            EDEV++ +   LLE  DV    + +++QI LTGF+ ++T  FM  LW+LLL AQ +  GV
Sbjct  64   EDEVVVEYAMGLLE-DDVQPTPDPRKMQINLTGFLTKDTPTFMSALWTLLLEAQESPAGV  122

Query  419  PQQFLDAK  442
            P+  ++AK
Sbjct  123  PRSMVEAK  130



>ref|XP_005988816.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X4 [Latimeria chalumnae]
Length=901

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 92/127 (72%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M G  + GT+A+QD RFSNKQ KLL+  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MEGPRWPGTSAEQDNRFSNKQKKLLRQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V++ FI++ LE K+ + K +QI LTGF+  +N  +F+ ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVIVEFIFNQLEEKNPDAKMMQINLTGFLNGKNAREFLGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLEQK  127



>emb|CDO71127.1| hypothetical protein BN946_scf184844.g131 [Trametes cinnabarina]
Length=339

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 89/138 (64%), Gaps = 3/138 (2%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+ADQD RFS+K+ KLLK+ KF PE +  VDM KV + V+RPWI K+V ELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKTMKFPPEFDKKVDMRKVNLSVIRPWIVKKVVELVGF  63

Query  251  EDEVLIXFIYSLLEG---KDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVP  421
            EDEV++ +   LLE       + + +QI LTGF+  NT  FM  LW LLL AQ +  GVP
Sbjct  64   EDEVVVEYAMGLLEDDSQPTPDPRRMQINLTGFLTNNTPAFMSALWKLLLEAQESPAGVP  123

Query  422  QQFLDAKGRGNKEEKG*D  475
            + F++ K    ++ K  D
Sbjct  124  RTFVEEKKEEMRQAKAGD  141



>ref|XP_004341588.1| PWI domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR19502.1| PWI domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=457

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 91/126 (72%), Gaps = 1/126 (1%)
 Frame = +2

Query  68   TGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVG  247
             GG FRGT+ +QD RFS+K  K +  +KF PE +  VD+ KV MD ++PW+A R+T+L+G
Sbjct  4    AGGFFRGTSTEQDARFSDKYKKYVAGRKFPPEFDLKVDLRKVAMDAIKPWVASRITQLLG  63

Query  248  IEDEVLIXFIYSLLEGKD-VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
             EDEVLI F + LL+ K+ +N KE+Q+ L GF+E ++ +F+ +LW LLLSAQ +  G+P 
Sbjct  64   FEDEVLIGFAFGLLDDKESLNPKELQLNLDGFLEADSPQFVADLWKLLLSAQASPGGIPA  123

Query  425  QFLDAK  442
            +FL+ K
Sbjct  124  EFLEQK  129



>gb|KIO14306.1| hypothetical protein M404DRAFT_992582 [Pisolithus tinctorius 
Marx 270]
Length=507

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 90/127 (71%), Gaps = 3/127 (2%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+ADQD RFS+K+ KLLKS KF PE E  VDM KV M+++RPWIAK+VTELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKSMKFPPEFEKKVDMKKVNMEIIRPWIAKKVTELVGF  63

Query  251  EDEVLIXFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVP  421
            EDEV+I +   LLE  +    + K++QI L GF+  +T  FMK LW LLL +Q++  GVP
Sbjct  64   EDEVVIEYAMGLLEDPNHTTPDPKKMQINLMGFLTSSTPAFMKALWDLLLESQDSPGGVP  123

Query  422  QQFLDAK  442
               ++AK
Sbjct  124  TSMVEAK  130



>gb|KIK98909.1| hypothetical protein PAXRUDRAFT_618522 [Paxillus rubicundulus 
Ve08.2h10]
Length=210

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 88/127 (69%), Gaps = 3/127 (2%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+ DQD RFS+K+ KLLKS KF PE +  VDM KV + V++PWIAK+VTELVG 
Sbjct  4    AGFFKGTSTDQDRRFSDKELKLLKSMKFPPEFDKKVDMKKVNLQVIKPWIAKKVTELVGF  63

Query  251  EDEVLIXFIYSLLEGKDV---NGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVP  421
            EDEV++ +   LLE  +    + K++QI LTGF+  +T  FM  LW LLL AQ +  GVP
Sbjct  64   EDEVVVEYAMGLLEDPNYTTPDPKKMQINLTGFLTSSTPTFMTALWKLLLEAQESLAGVP  123

Query  422  QQFLDAK  442
            Q F++ K
Sbjct  124  QTFVEEK  130



>gb|KIK68799.1| hypothetical protein GYMLUDRAFT_68631 [Gymnopus luxurians FD-317 
M1]
Length=408

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 90/127 (71%), Gaps = 3/127 (2%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+ADQD RFS+K+ KLLKS KF PE +  VDM KV + V+RPWIAK+V ELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKSMKFPPEFDKKVDMRKVNLTVIRPWIAKKVVELVGF  63

Query  251  EDEVLIXFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVP  421
            EDEV++ +   LLE K     + +++QI LTGF+ ++T  FM  LW LLL AQ++  GVP
Sbjct  64   EDEVVVEYAMGLLEDKQELFPDPRKMQINLTGFLTKDTPAFMSALWKLLLEAQSDMTGVP  123

Query  422  QQFLDAK  442
            + F++ K
Sbjct  124  RTFVEEK  130



>gb|KIK21297.1| hypothetical protein PISMIDRAFT_66449, partial [Pisolithus microcarpus 
441]
Length=143

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 90/135 (67%), Gaps = 12/135 (9%)
 Frame = +2

Query  74   GLFRGTTADQDTRFSNKQAKLLKSQKFAPELEH---------LVDMGKVKMDVMRPWIAK  226
            G F+GT+ADQD RFS+K+ KLLKS KF PE E           VDM KV M+++RPWIAK
Sbjct  1    GFFKGTSADQDRRFSDKELKLLKSMKFPPEFEKKVPCRLLPVRVDMKKVNMEIIRPWIAK  60

Query  227  RVTELVGIEDEVLIXFIYSLLEGKDV---NGKEVQIQLTGFMERNTGKFMKELWSLLLSA  397
            +VTELVG EDEV+I +   LLE  +    + K++QI L GF+  +T  FMK LW LLL +
Sbjct  61   KVTELVGFEDEVVIEYAMGLLEDPNYTTPDPKKMQINLMGFLTSSTPAFMKALWDLLLES  120

Query  398  QNNAXGVPQQFLDAK  442
            Q++  GVP   ++AK
Sbjct  121  QDSPGGVPVSMVEAK  135



>ref|NP_998607.1| serine/arginine repetitive matrix protein 1 [Danio rerio]
 gb|AAH58068.1| Serine/arginine repetitive matrix 1 [Danio rerio]
Length=896

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 94/127 (74%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNK  KLLK  KFA  LE  VDM KV ++V++PWI +RVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKHKKLLKQLKFAECLEKKVDMTKVNLEVIKPWITQRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I F+++ LE K+ +GK +QI LTGF+  +N  +FMK+LW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFVFNQLEEKNPDGKMMQINLTGFLNGKNAREFMKDLWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLEQK  127



>ref|XP_006752139.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Leptonychotes 
weddellii]
Length=347

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>gb|ETS63133.1| hypothetical protein PaG_02911 [Pseudozyma aphidis DSM 70725]
Length=306

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M    ++G +A QD+RF++K+A LL+  KF    +  VDM KV++ VM+PWIA+R+TEL+
Sbjct  1    MGDSSYKGVSASQDSRFTDKEASLLRKLKFPRHFDTKVDMHKVELSVMKPWIARRITELL  60

Query  245  GIEDEVLIXFIYSLL-EGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVP  421
            G EDEV++ +   +L EG+  + K++QIQLTGF+E +T +FM ELW LL+SAQ +  GVP
Sbjct  61   GFEDEVVLEYAVGMLEEGRYPDAKKMQIQLTGFLEASTAEFMAELWELLISAQASPGGVP  120

Query  422  QQFLDAK  442
            Q+F++ K
Sbjct  121  QRFVEEK  127



>ref|XP_005158559.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Danio rerio]
Length=929

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 94/127 (74%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNK  KLLK  KFA  LE  VDM KV ++V++PWI +RVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKHKKLLKQLKFAECLEKKVDMTKVNLEVIKPWITQRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I F+++ LE K+ +GK +QI LTGF+  +N  +FMK+LW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFVFNQLEEKNPDGKMMQINLTGFLNGKNAREFMKDLWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLEQK  127



>ref|XP_011060800.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Acromyrmex 
echinatior]
Length=148

 Score =   132 bits (332),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 89/123 (72%), Gaps = 1/123 (1%)
 Frame = +2

Query  77   LFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIED  256
            ++ GTTA QDTRFS+K+ KLLK  KF   L   VDM KVK+DV++PWI  ++T+++G+ED
Sbjct  1    MYTGTTASQDTRFSDKEKKLLKQMKFGDSLTQKVDMSKVKLDVIKPWITTKITQILGMED  60

Query  257  EVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVPQQFL  433
            +V++ F+Y+ LE K  + +++QI LTGF+  RN   FM ELW LL+SAQ +  G+P+ FL
Sbjct  61   DVVVEFVYNQLEEKFPDPRKMQINLTGFLNGRNARSFMGELWDLLVSAQESVTGIPEAFL  120

Query  434  DAK  442
              K
Sbjct  121  QQK  123



>gb|EDL80753.1| serine/arginine repetitive matrix 1 (predicted), isoform CRA_b 
[Rattus norvegicus]
Length=503

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_007852080.1| hypothetical protein Moror_3102 [Moniliophthora roreri MCA 2997]
 gb|ESK88604.1| hypothetical protein Moror_3102 [Moniliophthora roreri MCA 2997]
Length=460

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 91/127 (72%), Gaps = 3/127 (2%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+ADQD RFS+K+ KLLK+ KF PE +  VDM KV ++V++PWI K+V ELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKTMKFPPEFDKKVDMRKVNLNVIKPWITKKVVELVGF  63

Query  251  EDEVLIXFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVP  421
            EDEV++ +   LLE K     + K++QI LTGF+ ++T  FM  LW+LLL AQN+  GVP
Sbjct  64   EDEVVVEYAMGLLEDKSQPTPDPKKMQINLTGFLTKDTPAFMSALWNLLLEAQNDVTGVP  123

Query  422  QQFLDAK  442
            + F++ K
Sbjct  124  RTFVEEK  130



>gb|ELU41649.1| SR-rich pre-mRNA splicing activator [Rhizoctonia solani AG-1 
IA]
Length=430

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 88/126 (70%), Gaps = 2/126 (2%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+A+QD RF++K+ +LLKS KF PE +  VDM KV++ VMRPWI K+V ELVG 
Sbjct  4    AGFFKGTSAEQDRRFADKEHRLLKSIKFPPEFDRKVDMRKVELSVMRPWITKKVVELVGF  63

Query  251  EDEVLIXFIYSLLE--GKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            EDEV++ ++  LLE   K  + K +QI LTGF+E  T  FM  LW+LLL AQ++  GVP 
Sbjct  64   EDEVVVEYVMGLLEDRSKPPDPKVMQINLTGFLESKTPAFMSSLWALLLEAQDSPAGVPA  123

Query  425  QFLDAK  442
             F+  K
Sbjct  124  SFVQEK  129



>dbj|BAK63562.1| serine/arginine repetitive matrix protein 1 [Pan troglodytes]
Length=508

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_007424155.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X6 [Python bivittatus]
Length=746

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>dbj|GAC76886.1| splicing coactivator SRm160/300, subunit SRm160 [Pseudozyma antarctica 
T-34]
Length=306

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M    ++G +A QD+RF++K+A LL+  KF    +  VDM KV++ VM+PWIA+R+TEL+
Sbjct  1    MGDSSYKGVSASQDSRFTDKEASLLRKLKFPRHFDTKVDMHKVELSVMKPWIARRITELL  60

Query  245  GIEDEVLIXFIYSLL-EGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVP  421
            G EDEV++ +   +L EG+  + K++QIQLTGF+E +T +FM ELW LL+SAQ +  GVP
Sbjct  61   GFEDEVVLEYAMGMLEEGRYPDAKKMQIQLTGFLEASTQEFMAELWELLISAQASPGGVP  120

Query  422  QQFLDAK  442
            Q+F++ K
Sbjct  121  QRFVEEK  127



>ref|XP_005665165.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X13 [Sus scrofa]
Length=875

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>gb|EUC66839.1| serine/arginine repetitive matrix-like protein, putative [Rhizoctonia 
solani AG-3 Rhs1AP]
Length=466

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 86/126 (68%), Gaps = 2/126 (2%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
             G F+GT+A+QD RF++K+ +LLKS KF PE +  VDM KV + VMRPWI K+V ELVG 
Sbjct  4    AGFFKGTSAEQDRRFADKEHRLLKSMKFPPEFDRKVDMRKVNLQVMRPWITKKVVELVGF  63

Query  251  EDEVLIXFIYSLLE--GKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQ  424
            EDEV++ +   LLE   K  + K +QI LTGF+E  T  FM  LW+LLL AQN+  GVP 
Sbjct  64   EDEVVVEYAMGLLEDQSKPPDPKVMQINLTGFLESKTPAFMSALWTLLLEAQNSPAGVPA  123

Query  425  QFLDAK  442
             F+  K
Sbjct  124  SFVQEK  129



>ref|XP_010824971.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Bos taurus]
 ref|XP_010800937.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Bos taurus]
Length=746

 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_007424151.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Python bivittatus]
Length=892

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_007424152.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Python bivittatus]
Length=873

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_005665160.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X8 [Sus scrofa]
Length=903

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_005665159.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X7 [Sus scrofa]
Length=904

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_003482044.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoformX2 
[Sus scrofa]
Length=874

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_005665163.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X11 [Sus scrofa]
Length=887

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_004850657.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Heterocephalus glaber]
Length=900

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_003127751.3| PREDICTED: serine/arginine repetitive matrix protein 1 isoformX1 
[Sus scrofa]
Length=904

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_011282836.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Felis catus]
Length=874

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_005665161.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X9 [Sus scrofa]
Length=902

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_010343877.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Saimiri 
boliviensis boliviensis]
Length=863

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>gb|AAP97290.1|AF419855_1 Ser/Arg-related nuclear matrix protein [Homo sapiens]
 gb|AAC09321.1| Ser/Arg-related nuclear matrix protein [Homo sapiens]
Length=820

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_005665162.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X10 [Sus scrofa]
Length=889

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_007424150.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Python bivittatus]
Length=906

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_011282833.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Felis catus]
Length=903

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_011282835.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Felis catus]
Length=896

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_004783474.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Mustela 
putorius furo]
Length=906

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_011282834.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Felis catus]
Length=902

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_006862351.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Chrysochloris asiatica]
Length=902

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_003227241.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Anolis carolinensis]
Length=887

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_004425801.1| PREDICTED: uncharacterized protein LOC101387536 isoform 3 [Ceratotherium 
simum simum]
Length=873

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_011282832.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Felis catus]
Length=904

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_006239247.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Rattus norvegicus]
Length=907

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|NP_001101456.2| serine/arginine repetitive matrix protein 1 [Rattus norvegicus]
 gb|AAI66715.1| Srrm1 protein [Rattus norvegicus]
Length=908

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_006196850.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Vicugna pacos]
Length=905

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_004741210.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Mustela putorius furo]
Length=906

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_003415444.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Loxodonta africana]
Length=902

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_004377162.1| PREDICTED: uncharacterized protein LOC101351236 isoform 2 [Trichechus 
manatus latirostris]
Length=899

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_005665157.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Sus scrofa]
Length=916

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_005665158.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Sus scrofa]
Length=915

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_005353112.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X5 [Microtus ochrogaster]
Length=900

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_008531008.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Equus przewalskii]
Length=899

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_006078051.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X5 [Bubalus bubalis]
Length=899

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_004425800.1| PREDICTED: uncharacterized protein LOC101387536 isoform 2 [Ceratotherium 
simum simum]
Length=903

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_005079657.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Mesocricetus auratus]
Length=908

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_007491381.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X10 [Monodelphis domestica]
Length=897

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_008531007.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Equus przewalskii]
Length=901

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_006078050.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X4 [Bubalus bubalis]
Length=901

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_005245778.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Homo sapiens]
 ref|XP_009449178.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X7 [Pan troglodytes]
Length=902

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_003799816.1| PREDICTED: uncharacterized protein LOC100961903 isoform 1 [Otolemur 
garnettii]
Length=904

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_004394850.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Odobenus 
rosmarus divergens]
Length=803

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_005665155.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Sus scrofa]
Length=918

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_006862350.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Chrysochloris asiatica]
Length=914

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_005875244.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Myotis brandtii]
Length=899

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_006539091.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Mus musculus]
Length=908

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_006539090.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Mus musculus]
Length=909

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>gb|AAC17422.1| plenty-of-prolines-101 [Mus musculus]
Length=897

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_010632010.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Fukomys damarensis]
Length=901

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_011226923.1| PREDICTED: LOW QUALITY PROTEIN: serine/arginine repetitive matrix 
protein 1 [Ailuropoda melanoleuca]
Length=906

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_006777593.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X5 [Myotis davidii]
Length=899

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_004850656.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Heterocephalus glaber]
Length=912

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_852745.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoformX2 
[Canis lupus familiaris]
Length=904

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_006777592.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X4 [Myotis davidii]
Length=901

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_004850655.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Heterocephalus glaber]
Length=913

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_001252332.2| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Bos taurus]
 ref|XP_002685753.2| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Bos taurus]
Length=901

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_004850654.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Heterocephalus glaber]
Length=914

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_006539092.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Mus musculus]
Length=907

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_005353111.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X4 [Microtus ochrogaster]
Length=907

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>gb|EXX63474.1| hypothetical protein RirG_151940 [Rhizophagus irregularis DAOM 
197198w]
Length=369

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = +2

Query  71   GGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  250
            GG F+GT+ +QD+RFS+KQ KLLKS  F  E    VD+ KV + V+RPW+A+++ EL+G 
Sbjct  4    GGFFKGTSLEQDSRFSDKQKKLLKSMNFPSEFNQKVDLKKVNLTVIRPWVAQKIVELLGG  63

Query  251  EDEVLIXFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAXGVPQQF  430
            EDEV++ +++ LLE  D++ + +QI LTGF+E+N   F+ ELW LLLSAQ    G+P  F
Sbjct  64   EDEVVVNYVFGLLEEPDLDPRMMQINLTGFLEKNAPIFVTELWKLLLSAQEGENGIPAIF  123

Query  431  LDAK  442
            L+ K
Sbjct  124  LEQK  127



>ref|XP_008961404.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Pan paniscus]
Length=902

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_008998898.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Callithrix jacchus]
Length=902

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_007121181.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X4 [Physeter catodon]
Length=902

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_011355919.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Pteropus vampyrus]
Length=904

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_008573197.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Galeopterus variegatus]
Length=904

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>gb|EDL29985.1| serine/arginine repetitive matrix 1, isoform CRA_a [Mus musculus]
Length=897

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_006239246.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Rattus norvegicus]
Length=914

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_004425799.1| PREDICTED: uncharacterized protein LOC101387536 isoform 1 [Ceratotherium 
simum simum]
Length=915

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_003810827.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Pan paniscus]
Length=904

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_005665156.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Sus scrofa]
Length=917

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_010828369.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Bison bison bison]
Length=901

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_008146299.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Eptesicus fuscus]
Length=901

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_007978194.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Chlorocebus sabaeus]
Length=902

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_004465430.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
6 [Dasypus novemcinctus]
Length=902

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_004465429.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
5 [Dasypus novemcinctus]
Length=903

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_005353110.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Microtus ochrogaster]
Length=916

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_006539093.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Mus musculus]
Length=893

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



>ref|XP_008118563.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Anolis carolinensis]
Length=901

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  65   MTGGLFRGTTADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  244
            M  G FRGT+A+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  245  GIEDEVLIXFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNAXGVP  421
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N  G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  422  QQFLDAK  442
              FL+ K
Sbjct  121  SAFLELK  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925