BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS053C10

Length=489
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001233854.1|  telomere binding protein                         84.0    1e-15   
ref|XP_006346713.1|  PREDICTED: telomere repeat-binding protein 4...  79.0    7e-14   Solanum tuberosum [potatoes]
ref|XP_009783131.1|  PREDICTED: telomere repeat-binding protein 4...  78.2    1e-13   Nicotiana sylvestris
ref|XP_006345970.1|  PREDICTED: telomere repeat-binding protein 4...  77.8    2e-13   Solanum tuberosum [potatoes]
ref|XP_009615640.1|  PREDICTED: telomere repeat-binding protein 4...  77.8    2e-13   Nicotiana tomentosiformis
ref|XP_009799099.1|  PREDICTED: telomere repeat-binding protein 4...  77.4    3e-13   Nicotiana sylvestris
gb|AAN39330.1|  telomere binding protein TBP1                         75.5    1e-12   Nicotiana glutinosa
ref|XP_004236731.1|  PREDICTED: telomere repeat-binding protein 3     73.6    6e-12   Solanum lycopersicum
emb|CDP00111.1|  unnamed protein product                              72.0    2e-11   Coffea canephora [robusta coffee]
ref|XP_009785792.1|  PREDICTED: telomere repeat-binding protein 3...  70.5    5e-11   Nicotiana sylvestris
emb|CAC19789.1|  MYB-like DNA-binding protein                         70.5    6e-11   Catharanthus roseus [chatas]
ref|XP_009620521.1|  PREDICTED: telomere repeat-binding protein 3...  69.3    1e-10   Nicotiana tomentosiformis
ref|XP_009785793.1|  PREDICTED: telomere repeat-binding protein 3...  68.6    3e-10   Nicotiana sylvestris
ref|XP_011085026.1|  PREDICTED: telomere repeat-binding protein 4     67.0    8e-10   Sesamum indicum [beniseed]
ref|XP_009607614.1|  PREDICTED: telomere repeat-binding protein 4...  66.6    1e-09   Nicotiana tomentosiformis
ref|XP_008233636.1|  PREDICTED: telomere repeat-binding protein 3...  65.5    2e-09   Prunus mume [ume]
emb|CAA48413.1|  BPF-1                                                63.9    9e-09   Petroselinum crispum
gb|ADM64318.1|  putative telomeric protein                            62.0    4e-08   Cestrum parqui [green cestrum]
ref|XP_007009231.1|  Telomeric DNA binding protein 1, putative is...  61.6    4e-08   
ref|XP_007009230.1|  Telomeric DNA binding protein 1, putative is...  61.2    5e-08   
ref|XP_007009227.1|  Telomeric DNA binding protein 1, putative is...  61.2    5e-08   
ref|XP_007009226.1|  Telomeric DNA binding protein 1, putative is...  61.2    6e-08   
ref|XP_007009228.1|  Telomeric DNA binding protein 1, putative is...  61.2    7e-08   
ref|XP_008371854.1|  PREDICTED: telomere repeat-binding protein 3...  60.8    8e-08   Malus domestica [apple tree]
ref|XP_009357741.1|  PREDICTED: telomere repeat-binding protein 3...  60.8    9e-08   Pyrus x bretschneideri [bai li]
ref|XP_009343592.1|  PREDICTED: telomere repeat-binding protein 3...  59.7    2e-07   Pyrus x bretschneideri [bai li]
gb|KJB73975.1|  hypothetical protein B456_011G266100                  58.9    2e-07   Gossypium raimondii
ref|XP_002316279.2|  hypothetical protein POPTR_0010s20990g           59.3    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_006378702.1|  hypothetical protein POPTR_0010s20990g           59.3    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_006378703.1|  hypothetical protein POPTR_0010s20990g           59.3    3e-07   Populus trichocarpa [western balsam poplar]
ref|XP_006378700.1|  hypothetical protein POPTR_0010s20990g           59.3    3e-07   
gb|KJB73977.1|  hypothetical protein B456_011G266100                  58.5    3e-07   Gossypium raimondii
gb|KJB73978.1|  hypothetical protein B456_011G266100                  58.5    4e-07   Gossypium raimondii
gb|KJB73976.1|  hypothetical protein B456_011G266100                  58.2    5e-07   Gossypium raimondii
ref|XP_010096584.1|  Telomere repeat-binding protein 4                58.2    7e-07   
ref|XP_008784600.1|  PREDICTED: telomere repeat-binding protein 5     57.8    8e-07   Phoenix dactylifera
gb|KHG29953.1|  Telomere repeat-binding 3 -like protein               57.8    8e-07   Gossypium arboreum [tree cotton]
ref|XP_008343536.1|  PREDICTED: telomere repeat-binding protein 3...  57.0    1e-06   
gb|EYU19914.1|  hypothetical protein MIMGU_mgv1a002489mg              56.6    2e-06   Erythranthe guttata [common monkey flower]
ref|XP_004307493.1|  PREDICTED: telomere repeat-binding protein 4     55.8    3e-06   Fragaria vesca subsp. vesca
ref|XP_011027217.1|  PREDICTED: telomere repeat-binding protein 3...  54.7    7e-06   Populus euphratica
ref|XP_011027219.1|  PREDICTED: telomere repeat-binding protein 3...  54.7    8e-06   Populus euphratica
ref|XP_008387777.1|  PREDICTED: telomere repeat-binding protein 5...  53.9    1e-05   
ref|XP_008359725.1|  PREDICTED: telomere repeat-binding protein 2...  53.5    2e-05   
ref|XP_008359724.1|  PREDICTED: telomere repeat-binding protein 5...  53.5    2e-05   
ref|XP_008387776.1|  PREDICTED: telomere repeat-binding protein 5...  53.5    2e-05   
gb|KHF99719.1|  Telomere repeat-binding 4 -like protein               53.5    2e-05   Gossypium arboreum [tree cotton]
ref|XP_008359722.1|  PREDICTED: telomere repeat-binding protein 5...  53.1    2e-05   
ref|XP_008359718.1|  PREDICTED: telomere repeat-binding protein 5...  53.1    2e-05   
ref|XP_008359721.1|  PREDICTED: telomere repeat-binding protein 5...  53.1    2e-05   
ref|XP_008387775.1|  PREDICTED: telomere repeat-binding protein 5...  53.5    2e-05   
ref|XP_008359723.1|  PREDICTED: telomere repeat-binding protein 5...  53.1    2e-05   
ref|XP_008387778.1|  PREDICTED: telomere repeat-binding protein 5...  53.5    2e-05   
ref|XP_008387772.1|  PREDICTED: telomere repeat-binding protein 5...  53.5    2e-05   
ref|XP_011077209.1|  PREDICTED: telomere repeat-binding protein 3...  53.1    3e-05   Sesamum indicum [beniseed]
gb|EPS64950.1|  hypothetical protein M569_09831                       52.8    3e-05   Genlisea aurea
ref|XP_010658554.1|  PREDICTED: telomere repeat-binding protein 4...  52.8    3e-05   Vitis vinifera
ref|XP_008240801.1|  PREDICTED: telomere repeat-binding protein 5...  52.8    3e-05   Prunus mume [ume]
gb|KHN17923.1|  Telomere repeat-binding protein 3                     52.8    3e-05   Glycine soja [wild soybean]
ref|XP_006591341.1|  PREDICTED: telomere repeat-binding protein 3...  52.8    3e-05   Glycine max [soybeans]
ref|XP_003538412.1|  PREDICTED: telomere repeat-binding protein 3...  52.8    3e-05   Glycine max [soybeans]
ref|XP_007206321.1|  hypothetical protein PRUPE_ppa002522mg           52.4    4e-05   Prunus persica
ref|XP_002311174.2|  hypothetical protein POPTR_0008s05740g           52.0    5e-05   
gb|KJB78826.1|  hypothetical protein B456_013G021300                  52.0    7e-05   Gossypium raimondii
ref|XP_010256898.1|  PREDICTED: telomere repeat-binding protein 5...  51.6    7e-05   Nelumbo nucifera [Indian lotus]
gb|KJB78829.1|  hypothetical protein B456_013G021300                  51.6    8e-05   Gossypium raimondii
ref|XP_010256896.1|  PREDICTED: telomere repeat-binding protein 5...  51.6    8e-05   Nelumbo nucifera [Indian lotus]
gb|KHG15516.1|  Telomere repeat-binding 3 -like protein               51.2    9e-05   Gossypium arboreum [tree cotton]
ref|XP_009349459.1|  PREDICTED: telomere repeat-binding protein 5...  51.2    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_011027692.1|  PREDICTED: telomere repeat-binding protein 3...  51.2    1e-04   Populus euphratica
ref|XP_006602000.1|  PREDICTED: telomere repeat-binding protein 3...  51.2    1e-04   Glycine max [soybeans]
ref|XP_009349457.1|  PREDICTED: telomere repeat-binding protein 5...  50.8    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_009349456.1|  PREDICTED: telomere repeat-binding protein 5...  50.8    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_009349458.1|  PREDICTED: telomere repeat-binding protein 6...  50.8    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_006602002.1|  PREDICTED: telomere repeat-binding protein 3...  50.8    1e-04   Glycine max [soybeans]
ref|XP_010262528.1|  PREDICTED: telomere repeat-binding protein 5     50.8    2e-04   Nelumbo nucifera [Indian lotus]
emb|CBI31661.3|  unnamed protein product                              50.1    2e-04   Vitis vinifera
ref|XP_010658557.1|  PREDICTED: telomere repeat-binding protein 4...  50.1    2e-04   Vitis vinifera
ref|XP_006488343.1|  PREDICTED: telomere repeat-binding protein 5...  50.1    2e-04   Citrus sinensis [apfelsine]
gb|KDO72832.1|  hypothetical protein CISIN_1g042386mg                 50.1    3e-04   Citrus sinensis [apfelsine]
ref|XP_006424852.1|  hypothetical protein CICLE_v10027927mg           50.1    3e-04   Citrus clementina [clementine]
ref|XP_006488345.1|  PREDICTED: telomere repeat-binding protein 5...  50.1    3e-04   Citrus sinensis [apfelsine]
emb|CAN72738.1|  hypothetical protein VITISV_021864                   50.1    3e-04   Vitis vinifera
ref|XP_006424854.1|  hypothetical protein CICLE_v10027927mg           49.7    3e-04   Citrus clementina [clementine]
ref|XP_009341748.1|  PREDICTED: telomere repeat-binding protein 5...  49.7    3e-04   Pyrus x bretschneideri [bai li]
ref|XP_006424849.1|  hypothetical protein CICLE_v10027927mg           49.7    4e-04   
gb|KDP44939.1|  hypothetical protein JCGZ_01439                       49.7    4e-04   Jatropha curcas
ref|XP_008461684.1|  PREDICTED: telomere repeat-binding protein 4...  49.3    4e-04   Cucumis melo [Oriental melon]
ref|XP_006378701.1|  hypothetical protein POPTR_0010s20990g           49.3    5e-04   
ref|XP_007221011.1|  hypothetical protein PRUPE_ppa002374mg           48.9    5e-04   
gb|KGN50558.1|  hypothetical protein Csa_5G182630                     48.5    7e-04   Cucumis sativus [cucumbers]
ref|XP_008801908.1|  PREDICTED: telomere repeat-binding protein 5...  48.5    7e-04   



>ref|NP_001233854.1| telomere binding protein [Solanum lycopersicum]
 dbj|BAF36749.1| telomere binding protein [Solanum lycopersicum]
Length=689

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 74/128 (58%), Positives = 95/128 (74%), Gaps = 2/128 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT-GNVDDKQICAFELLSAVAGKlllesess  284
            MV KK+L++GF+G++ P +P+APRS RRR +   +DD QICAFELL+AVAGKLLLESESS
Sbjct  1    MVYKKKLDFGFNGFQVPVIPKAPRSVRRRRSCKKLDDDQICAFELLAAVAGKLLLESESS  60

Query  285  assnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKHG  464
             SSNAAEGK+  A  RD  +     +EGKA+K ECLD+GSCVES  L   A+Q+Q +KHG
Sbjct  61   TSSNAAEGKNEIADGRDGIKS-EQVEEGKAVKSECLDQGSCVESDYLPDTAVQDQNLKHG  119

Query  465  NGGSSYSE  488
                 ++E
Sbjct  120  FDKPHHAE  127



>ref|XP_006346713.1| PREDICTED: telomere repeat-binding protein 4-like [Solanum tuberosum]
Length=670

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 69/119 (58%), Positives = 87/119 (73%), Gaps = 2/119 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT-GNVDDKQICAFELLSAVAGKlllesess  284
            M  KKR+ +GF GY FP +P+APRS RRRH+  N+D+ QICAFELL+AVAG+LL ESESS
Sbjct  1    MSSKKRVRHGFSGYEFPVIPKAPRSVRRRHSHNNIDNDQICAFELLAAVAGELLQESESS  60

Query  285  assnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
            A SNAA GKD  +  R+V +     +E KA+K EC D+GSCVESA L   A+QE  +K+
Sbjct  61   ACSNAAVGKDELSDCREVVKR-EQLKEDKAVKSECFDQGSCVESAHLPEPAVQEPNLKY  118



>ref|XP_009783131.1| PREDICTED: telomere repeat-binding protein 4-like [Nicotiana 
sylvestris]
Length=688

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 71/119 (60%), Positives = 86/119 (72%), Gaps = 2/119 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT-GNVDDKQICAFELLSAVAGKlllesess  284
            M  KKRL YGF GY+FP +P+APRS RRRH+  N+D+ QICAFELL+AVAG+LL ESESS
Sbjct  1    MSSKKRLNYGFSGYQFPVIPKAPRSVRRRHSHNNLDNNQICAFELLAAVAGELLQESESS  60

Query  285  assnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
            A SNAAEGKD  A  R V  +    +E KA+K EC  +GSCVES  +   A+ EQ +KH
Sbjct  61   ACSNAAEGKDELADCR-VGVKCEQLKEDKAVKSECFSQGSCVESTYIPEPAVLEQNLKH  118



>ref|XP_006345970.1| PREDICTED: telomere repeat-binding protein 4-like [Solanum tuberosum]
Length=689

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 72/128 (56%), Positives = 93/128 (73%), Gaps = 2/128 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT-GNVDDKQICAFELLSAVAGKlllesess  284
            MV KK+L++GF+G++ P +P+APRS RRR +   +DD QICAFELL+AVAGKLLLESESS
Sbjct  1    MVYKKKLDFGFNGFQVPVIPKAPRSVRRRRSCKKLDDDQICAFELLAAVAGKLLLESESS  60

Query  285  assnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKHG  464
             SSNAAEGK+  A  RD  +     +EGKA+K E LD+GSCVES  +   A Q+Q +KHG
Sbjct  61   TSSNAAEGKNEIADGRDGIKS-EQVEEGKAVKSEYLDQGSCVESDYIPETAAQDQNLKHG  119

Query  465  NGGSSYSE  488
                 ++E
Sbjct  120  FDKPHHAE  127



>ref|XP_009615640.1| PREDICTED: telomere repeat-binding protein 4-like [Nicotiana 
tomentosiformis]
Length=680

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 71/128 (55%), Positives = 91/128 (71%), Gaps = 2/128 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT-GNVDDKQICAFELLSAVAGKlllesess  284
            MV KK+L++GF+G++ P +P+APRS RRR +    DD QICAFELL+AVAGKLL ESESS
Sbjct  1    MVSKKKLDFGFNGFQVPFIPKAPRSVRRRGSCKKFDDDQICAFELLAAVAGKLLQESESS  60

Query  285  assnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKHG  464
             SSNAAEGK   +  RD  +     +E KA+K ECLD+GSCVESA +   A++EQ +KH 
Sbjct  61   TSSNAAEGKYELSDCRDGIK-CEQVEEDKAVKSECLDQGSCVESAYIPEPAVREQNLKHD  119

Query  465  NGGSSYSE  488
                 Y+E
Sbjct  120  LDKPYYAE  127



>ref|XP_009799099.1| PREDICTED: telomere repeat-binding protein 4-like [Nicotiana 
sylvestris]
Length=677

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 68/127 (54%), Positives = 87/127 (69%), Gaps = 2/127 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGNVDDKQICAFELLSAVAGKlllesessa  287
            MV KK+L++GF+G++ P +P+APRS R   +   DD QICAFELL+AVAGKLL ESESS 
Sbjct  1    MVSKKKLDFGFNGFQVPFIPKAPRSRRGS-SKKFDDDQICAFELLAAVAGKLLQESESST  59

Query  288  ssnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKHGN  467
            SSN AEGK   +  RD  +     +E KA+K ECLD+GSCVESA +   A +EQ +KH  
Sbjct  60   SSNVAEGKYELSDCRDGIK-CEQVEEDKAVKSECLDQGSCVESAYIPEPAAREQNLKHDL  118

Query  468  GGSSYSE  488
                Y+E
Sbjct  119  DKPYYAE  125



>gb|AAN39330.1| telomere binding protein TBP1 [Nicotiana glutinosa]
Length=681

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 71/128 (55%), Positives = 90/128 (70%), Gaps = 2/128 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT-GNVDDKQICAFELLSAVAGKlllesess  284
            MV KK+L++GF+G++ P +P+APRS RRR T    DD QICAFELL+AVAGKLL ESESS
Sbjct  1    MVSKKKLDFGFNGFQVPFIPKAPRSVRRRGTCKKFDDDQICAFELLAAVAGKLLQESESS  60

Query  285  assnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKHG  464
             SSNAAEGK   +  RD  +     +E KA+K ECLD+GSCVESA +   A++EQ +K  
Sbjct  61   TSSNAAEGKYELSDCRDGIK-CEQVEEDKAVKSECLDQGSCVESAYVPEPAVREQNLKRD  119

Query  465  NGGSSYSE  488
                 Y+E
Sbjct  120  LDKPYYAE  127



>ref|XP_004236731.1| PREDICTED: telomere repeat-binding protein 3 [Solanum lycopersicum]
Length=667

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 64/119 (54%), Positives = 85/119 (71%), Gaps = 2/119 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT-GNVDDKQICAFELLSAVAGKlllesess  284
            M  KKR+ +GF G+ FP +P+APRS RRRH+  N+++ QICAFELL+ VAG+LL ESESS
Sbjct  1    MSSKKRVRHGFSGFEFPVIPKAPRSVRRRHSHKNINNDQICAFELLATVAGELLQESESS  60

Query  285  assnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
            A S+A  GKD  +  R+V +     +E KA+K EC D+GSCVESA L   A+QE  +K+
Sbjct  61   ACSSAVIGKDKLSDCREVVKR-EQLKEDKAVKSECFDQGSCVESAYLPEPAVQEPNLKY  118



>emb|CDP00111.1| unnamed protein product [Coffea canephora]
Length=692

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 61/119 (51%), Positives = 74/119 (62%), Gaps = 4/119 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpa--vpraprssrrrHTGNVDDKQICAFELLSAVAGKllleses  281
            MV+KKRL+YGF GY+ P           R  H  +V+D QICAFELL+AVAGKLL ESES
Sbjct  1    MVLKKRLDYGFHGYQIPVIPRAPRSVRRRGAHKKSVEDHQICAFELLAAVAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIK  458
            SASSNA+E K  P     + +E    +E KA + ECLD+GSCVES  +      EQ  K
Sbjct  61   SASSNASEAKVQPCHMDGIKKERS--EETKAFRTECLDQGSCVESTFIPERVAGEQNFK  117



>ref|XP_009785792.1| PREDICTED: telomere repeat-binding protein 3-like isoform X1 
[Nicotiana sylvestris]
Length=695

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 70/122 (57%), Positives = 86/122 (70%), Gaps = 4/122 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN-VDDKQICAFELLSAVAGKlllesess  284
            MV KKRL  GF GY+ P +P+APRS+R+R   N +DD QICAFELL+AVAGKLLLESESS
Sbjct  1    MVSKKRLNCGFSGYQIPVIPKAPRSARKRRPCNKLDDDQICAFELLAAVAGKLLLESESS  60

Query  285  assnaae--GKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIK  458
            ASSNA    GK   A  RD  +     ++ KA++ ECLD+GSC+ESA +   A QEQ  K
Sbjct  61   ASSNAGAPAGKYELANCRDSIKH-EQVEDDKAVRSECLDQGSCIESAYIPEAAEQEQTFK  119

Query  459  HG  464
            +G
Sbjct  120  NG  121



>emb|CAC19789.1| MYB-like DNA-binding protein [Catharanthus roseus]
Length=693

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 60/116 (52%), Positives = 74/116 (64%), Gaps = 2/116 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpa--vpraprssrrrHTGNVDDKQICAFELLSAVAGKllleses  281
            MV+K+RLEYGF GY+ P           R      VDD QICAFELL+AVAGKLL ESES
Sbjct  1    MVLKRRLEYGFSGYQIPVIPKAPRSVRRRGPRKKLVDDHQICAFELLAAVAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQ  449
            SASSNA+E KD   I  D  ++    +  K ++ ECLD+GSCVESA +   A++E 
Sbjct  61   SASSNASEPKDLLGIHLDGIKQERVEENNKTVRSECLDQGSCVESAFIPELAVKEH  116



>ref|XP_009620521.1| PREDICTED: telomere repeat-binding protein 3-like [Nicotiana 
tomentosiformis]
Length=684

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 69/120 (58%), Positives = 84/120 (70%), Gaps = 11/120 (9%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN-VDDKQICAFELLSAVAGKlllesess  284
            MV KKRL+ GF GY+ P +P+APRS+R+R   N +DD QICAFELL+AVAGKLLLESESS
Sbjct  1    MVSKKRLKCGFSGYQIPVIPKAPRSARKRRPCNKLDDDQICAFELLAAVAGKLLLESESS  60

Query  285  assnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKHG  464
            ASSNA      PA   +  E+       KA++ ECLD+GSCVESA +   A QEQ  K+G
Sbjct  61   ASSNAG----APAGKYEQVED------DKAVRSECLDQGSCVESAYIPEAAEQEQAFKNG  110



>ref|XP_009785793.1| PREDICTED: telomere repeat-binding protein 3-like isoform X2 
[Nicotiana sylvestris]
Length=684

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 68/120 (57%), Positives = 83/120 (69%), Gaps = 11/120 (9%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN-VDDKQICAFELLSAVAGKlllesess  284
            MV KKRL  GF GY+ P +P+APRS+R+R   N +DD QICAFELL+AVAGKLLLESESS
Sbjct  1    MVSKKRLNCGFSGYQIPVIPKAPRSARKRRPCNKLDDDQICAFELLAAVAGKLLLESESS  60

Query  285  assnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKHG  464
            ASSNA      PA   +  E+       KA++ ECLD+GSC+ESA +   A QEQ  K+G
Sbjct  61   ASSNAG----APAGKYEQVED------DKAVRSECLDQGSCIESAYIPEAAEQEQTFKNG  110



>ref|XP_011085026.1| PREDICTED: telomere repeat-binding protein 4 [Sesamum indicum]
Length=687

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 73/116 (63%), Gaps = 3/116 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpa--vpraprssrrrHTGNVDDKQICAFELLSAVAGKllleses  281
            MV KKRL+YGF+GYR P           R  H  +++D ++CAFELL+AVAGKLL ESES
Sbjct  1    MVSKKRLDYGFNGYRAPIIPRAPRSIRRRSPHKNSIEDSKLCAFELLAAVAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQ  449
            SASS+ A GK  P I +   ++  +  + KALK E  D GSC ESA +   ++ EQ
Sbjct  61   SASSSVANGKFQPGICQGGNKKEQSLDD-KALKSESFDHGSCAESAFIPEISVPEQ  115



>ref|XP_009607614.1| PREDICTED: telomere repeat-binding protein 4-like [Nicotiana 
tomentosiformis]
 ref|XP_009607681.1| PREDICTED: telomere repeat-binding protein 4-like [Nicotiana 
tomentosiformis]
Length=688

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 67/119 (56%), Positives = 80/119 (67%), Gaps = 2/119 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT-GNVDDKQICAFELLSAVAGKlllesess  284
            M  KKRL YGF G +FP +P+APRS RRRH+  N+D+ QICAFELL+AVAG+LL ESESS
Sbjct  1    MSSKKRLNYGFSGCQFPVIPKAPRSVRRRHSHNNLDNDQICAFELLAAVAGELLQESESS  60

Query  285  assnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
            A SN AEGK   A  R V  +    +E K +K EC  +GSCVES  +   A  EQ  KH
Sbjct  61   ACSNVAEGKGELAECR-VGVKCEQLKEDKPVKSECFSQGSCVESTYIPEPAALEQNFKH  118



>ref|XP_008233636.1| PREDICTED: telomere repeat-binding protein 3-like [Prunus mume]
Length=692

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 53/109 (49%), Positives = 68/109 (62%), Gaps = 5/109 (5%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYr--fpavpraprssrrrHTGNVDDKQICAFELLSAVAGK-lllese  278
            MV+KKRL++GFDG++             R  H  +VD+ QICAFELL+++AGK L     
Sbjct  1    MVLKKRLDFGFDGFQVPSIPRAPRSARRRGPHKKSVDNGQICAFELLASLAGKLLQESES  60

Query  279  ssassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAIL  425
            SSASSNA+EG   PA  +DV +E  +  E K LK ECLD+GS  ES  L
Sbjct  61   SSASSNASEGNSKPAFGKDVKQERQD--EHKPLKEECLDQGSSEESVSL  107



>emb|CAA48413.1| BPF-1 [Petroselinum crispum]
 emb|CAA44518.1| BPF-1 [Petroselinum crispum]
Length=689

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 59/120 (49%), Positives = 73/120 (61%), Gaps = 6/120 (5%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpa--vpraprssrrrHTGNVDDKQICAFELLSAVAGKllleses  281
            MV+KK  EYGF GY+ PA          R      VDD +ICAFELL+ VAGKLL ESES
Sbjct  1    MVLKKSQEYGFRGYQVPAIPRGPRSLRRRASFKKPVDDGEICAFELLATVAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRD-VTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIK  458
            S SSN AE KD   I +D + +EL    EG  ++ ECLD+GSC+ES ++   A  E+  K
Sbjct  61   STSSNVAELKDQIRIHKDGIKKEL---PEGSGVRSECLDQGSCIESVLVPDFAALERNSK  117



>gb|ADM64318.1| putative telomeric protein [Cestrum parqui]
Length=610

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 65/105 (62%), Positives = 84/105 (80%), Gaps = 4/105 (4%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN-VDDKQICAFELLSAVAGKlllesess  284
            MV KK+L++GF+G++ P +P+APRS RRR + N ++D +ICAFELL+AVAGKLL ESESS
Sbjct  1    MVSKKKLDWGFNGFQVPFIPKAPRSVRRRRSCNKLNDGEICAFELLAAVAGKLLEESESS  60

Query  285  assnaaeGKDGPAIXRDVTE-ELGNFQEGKALKPECLDRGSCVES  416
            ASSNAAEGK   +  RD ++ EL   +E KALK ECLD+GSCVE+
Sbjct  61   ASSNAAEGKYELSDCRDGSKREL--VEEDKALKSECLDQGSCVEN  103



>ref|XP_007009231.1| Telomeric DNA binding protein 1, putative isoform 6 [Theobroma 
cacao]
 gb|EOY18041.1| Telomeric DNA binding protein 1, putative isoform 6 [Theobroma 
cacao]
Length=516

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 78/107 (73%), Gaps = 3/107 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrr--rHTGNVDDKQICAFELLSAVAGKllleses  281
            MV KKRL+YGF+ +  P +PRAPRS+RR  +    VDD QICAFELL+++AGKLL ESES
Sbjct  1    MVFKKRLDYGFNAFNVPKIPRAPRSTRRRGQSKRTVDDSQICAFELLASLAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAI  422
            SASSNA+EG D  +I +DV ++   + + K LK EC ++GSC  S +
Sbjct  61   SASSNASEGHDHVSIGKDVVKQEIQYDD-KPLKTECFEQGSCEASVV  106



>ref|XP_007009230.1| Telomeric DNA binding protein 1, putative isoform 5 [Theobroma 
cacao]
 gb|EOY18040.1| Telomeric DNA binding protein 1, putative isoform 5 [Theobroma 
cacao]
Length=514

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 78/107 (73%), Gaps = 3/107 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrr--rHTGNVDDKQICAFELLSAVAGKllleses  281
            MV KKRL+YGF+ +  P +PRAPRS+RR  +    VDD QICAFELL+++AGKLL ESES
Sbjct  1    MVFKKRLDYGFNAFNVPKIPRAPRSTRRRGQSKRTVDDSQICAFELLASLAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAI  422
            SASSNA+EG D  +I +DV ++   + + K LK EC ++GSC  S +
Sbjct  61   SASSNASEGHDHVSIGKDVVKQEIQYDD-KPLKTECFEQGSCEASVV  106



>ref|XP_007009227.1| Telomeric DNA binding protein 1, putative isoform 2 [Theobroma 
cacao]
 ref|XP_007009229.1| Telomeric DNA binding protein 1, putative isoform 2 [Theobroma 
cacao]
 ref|XP_007009232.1| Telomeric DNA binding protein 1, putative isoform 2 [Theobroma 
cacao]
 gb|EOY18037.1| Telomeric DNA binding protein 1, putative isoform 2 [Theobroma 
cacao]
 gb|EOY18039.1| Telomeric DNA binding protein 1, putative isoform 2 [Theobroma 
cacao]
 gb|EOY18042.1| Telomeric DNA binding protein 1, putative isoform 2 [Theobroma 
cacao]
Length=507

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 78/107 (73%), Gaps = 3/107 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrr--rHTGNVDDKQICAFELLSAVAGKllleses  281
            MV KKRL+YGF+ +  P +PRAPRS+RR  +    VDD QICAFELL+++AGKLL ESES
Sbjct  1    MVFKKRLDYGFNAFNVPKIPRAPRSTRRRGQSKRTVDDSQICAFELLASLAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAI  422
            SASSNA+EG D  +I +DV ++   + + K LK EC ++GSC  S +
Sbjct  61   SASSNASEGHDHVSIGKDVVKQEIQYDD-KPLKTECFEQGSCEASVV  106



>ref|XP_007009226.1| Telomeric DNA binding protein 1, putative isoform 1 [Theobroma 
cacao]
 gb|EOY18036.1| Telomeric DNA binding protein 1, putative isoform 1 [Theobroma 
cacao]
Length=708

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 52/107 (49%), Positives = 69/107 (64%), Gaps = 3/107 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpa--vpraprssrrrHTGNVDDKQICAFELLSAVAGKllleses  281
            MV KKRL+YGF+ +  P           R +    VDD QICAFELL+++AGKLL ESES
Sbjct  1    MVFKKRLDYGFNAFNVPKIPRAPRSTRRRGQSKRTVDDSQICAFELLASLAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAI  422
            SASSNA+EG D  +I +DV ++   + + K LK EC ++GSC  S +
Sbjct  61   SASSNASEGHDHVSIGKDVVKQEIQYDD-KPLKTECFEQGSCEASVV  106



>ref|XP_007009228.1| Telomeric DNA binding protein 1, putative isoform 3 [Theobroma 
cacao]
 gb|EOY18038.1| Telomeric DNA binding protein 1, putative isoform 3 [Theobroma 
cacao]
Length=657

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 52/107 (49%), Positives = 69/107 (64%), Gaps = 3/107 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpa--vpraprssrrrHTGNVDDKQICAFELLSAVAGKllleses  281
            MV KKRL+YGF+ +  P           R +    VDD QICAFELL+++AGKLL ESES
Sbjct  1    MVFKKRLDYGFNAFNVPKIPRAPRSTRRRGQSKRTVDDSQICAFELLASLAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAI  422
            SASSNA+EG D  +I +DV ++   + + K LK EC ++GSC  S +
Sbjct  61   SASSNASEGHDHVSIGKDVVKQEIQYDD-KPLKTECFEQGSCEASVV  106



>ref|XP_008371854.1| PREDICTED: telomere repeat-binding protein 3-like [Malus domestica]
Length=674

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 62/107 (58%), Positives = 79/107 (74%), Gaps = 3/107 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrr-HTGNVDDKQICAFELLSAVAGKlllesess  284
            MV+KKRL++GF+G++ P +PRAPRS+RR  H  +V+D Q CAFELL+++AGKLL ESESS
Sbjct  1    MVLKKRLDFGFNGFQVPTIPRAPRSARRGPHRKSVEDGQFCAFELLASLAGKLLQESESS  60

Query  285  assnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAIL  425
            ASSNA+EG   PA   DV +E  +  E K LK EC D+GS  ES  L
Sbjct  61   ASSNASEGNLQPAFGIDVKQERQD--EHKPLKEECPDQGSSEESVSL  105



>ref|XP_009357741.1| PREDICTED: telomere repeat-binding protein 3-like [Pyrus x bretschneideri]
Length=674

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 62/107 (58%), Positives = 80/107 (75%), Gaps = 3/107 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrr-HTGNVDDKQICAFELLSAVAGKlllesess  284
            MV+KKRL++GF+G++ P++PRAPRS+RR  H  +V+D Q CAFELL+++AGKLL ESESS
Sbjct  1    MVLKKRLDFGFNGFQVPSIPRAPRSARRGPHRKSVEDGQFCAFELLASLAGKLLQESESS  60

Query  285  assnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAIL  425
            ASSNA+EG   PA   DV +E  +  E K LK EC D+GS  ES  L
Sbjct  61   ASSNASEGNLQPAFGIDVKQERQD--EHKPLKEECPDQGSSEESVSL  105



>ref|XP_009343592.1| PREDICTED: telomere repeat-binding protein 3-like [Pyrus x bretschneideri]
Length=677

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 66/122 (54%), Positives = 85/122 (70%), Gaps = 11/122 (9%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrr-HTGNVDDKQICAFELLSAVAGKlllesess  284
            M +KKRL++GF+G++ P +PRAPRS+RR  H  +V+D QI AFELL+++AGKLL ESESS
Sbjct  1    MGLKKRLDFGFNGFQVPNIPRAPRSARRGPHRKSVEDGQISAFELLASLAGKLLQESESS  60

Query  285  assnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAIL--------RRGAI  440
            ASSNA+EG   PA   DV +E  +  E K LK ECLD+GS  ES  L        R+G I
Sbjct  61   ASSNASEGNLQPAFGIDVKQERQD--EHKPLKEECLDQGSSEESVSLGLTSQNINRKGII  118

Query  441  QE  446
            +E
Sbjct  119  KE  120



>gb|KJB73975.1| hypothetical protein B456_011G266100, partial [Gossypium raimondii]
Length=338

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 79/108 (73%), Gaps = 3/108 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLSAVAGKllleses  281
            MV KKRL+YGF+ +  P VPRAPRS RRR      V+D QICAFELL+++AGKLL ESES
Sbjct  1    MVFKKRLDYGFNTFNVPDVPRAPRSIRRRCRSKRVVEDSQICAFELLASLAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDV-TEELGNFQEGKALKPECLDRGSCVESAI  422
            SASSNA+EG D  +I +DV  +E+    + K LK EC+++GSC  SA+
Sbjct  61   SASSNASEGHDHVSIGKDVLKQEIQYNDDEKPLKVECVEQGSCDASAV  108



>ref|XP_002316279.2| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
 gb|EEF02450.2| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
Length=696

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 54/110 (49%), Positives = 66/110 (60%), Gaps = 5/110 (5%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrf--pavpraprssrrrHTGNVDDKQICAFELLSAVAGKllleses  281
            MV+KKR  YGF+G+              R  +   V+D QICAFELL+++AGKLL ESES
Sbjct  1    MVVKKRQYYGFNGFHMPPVPRAPRSARGRGLNKMKVEDSQICAFELLASLAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRR  431
            SASSNA+E  D P I   V  E     + + LK ECLD GSC ESA+  R
Sbjct  61   SASSNASEANDQPIIGGGVKFEQ---DDDRPLKAECLDHGSCGESALFTR  107



>ref|XP_006378702.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
 gb|ERP56499.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
Length=705

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 54/110 (49%), Positives = 66/110 (60%), Gaps = 5/110 (5%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrf--pavpraprssrrrHTGNVDDKQICAFELLSAVAGKllleses  281
            MV+KKR  YGF+G+              R  +   V+D QICAFELL+++AGKLL ESES
Sbjct  1    MVVKKRQYYGFNGFHMPPVPRAPRSARGRGLNKMKVEDSQICAFELLASLAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRR  431
            SASSNA+E  D P I   V  E     + + LK ECLD GSC ESA+  R
Sbjct  61   SASSNASEANDQPIIGGGVKFEQ---DDDRPLKAECLDHGSCGESALFTR  107



>ref|XP_006378703.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
 gb|ERP56500.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
Length=707

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 54/110 (49%), Positives = 66/110 (60%), Gaps = 5/110 (5%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrf--pavpraprssrrrHTGNVDDKQICAFELLSAVAGKllleses  281
            MV+KKR  YGF+G+              R  +   V+D QICAFELL+++AGKLL ESES
Sbjct  1    MVVKKRQYYGFNGFHMPPVPRAPRSARGRGLNKMKVEDSQICAFELLASLAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRR  431
            SASSNA+E  D P I   V  E     + + LK ECLD GSC ESA+  R
Sbjct  61   SASSNASEANDQPIIGGGVKFEQ---DDDRPLKAECLDHGSCGESALFTR  107



>ref|XP_006378700.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
 ref|XP_006378704.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
 gb|ERP56497.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
 gb|ERP56501.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
Length=625

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 54/110 (49%), Positives = 66/110 (60%), Gaps = 5/110 (5%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrf--pavpraprssrrrHTGNVDDKQICAFELLSAVAGKllleses  281
            MV+KKR  YGF+G+              R  +   V+D QICAFELL+++AGKLL ESES
Sbjct  1    MVVKKRQYYGFNGFHMPPVPRAPRSARGRGLNKMKVEDSQICAFELLASLAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRR  431
            SASSNA+E  D P I   V  E     + + LK ECLD GSC ESA+  R
Sbjct  61   SASSNASEANDQPIIGGGVKFEQ---DDDRPLKAECLDHGSCGESALFTR  107



>gb|KJB73977.1| hypothetical protein B456_011G266100 [Gossypium raimondii]
Length=483

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 79/108 (73%), Gaps = 3/108 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLSAVAGKllleses  281
            MV KKRL+YGF+ +  P VPRAPRS RRR      V+D QICAFELL+++AGKLL ESES
Sbjct  1    MVFKKRLDYGFNTFNVPDVPRAPRSIRRRCRSKRVVEDSQICAFELLASLAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVT-EELGNFQEGKALKPECLDRGSCVESAI  422
            SASSNA+EG D  +I +DV  +E+    + K LK EC+++GSC  SA+
Sbjct  61   SASSNASEGHDHVSIGKDVLKQEIQYNDDEKPLKVECVEQGSCDASAV  108



>gb|KJB73978.1| hypothetical protein B456_011G266100 [Gossypium raimondii]
Length=683

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 62/108 (57%), Positives = 79/108 (73%), Gaps = 3/108 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLSAVAGKllleses  281
            MV KKRL+YGF+ +  P VPRAPRS RRR      V+D QICAFELL+++AGKLL ESES
Sbjct  1    MVFKKRLDYGFNTFNVPDVPRAPRSIRRRCRSKRVVEDSQICAFELLASLAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDV-TEELGNFQEGKALKPECLDRGSCVESAI  422
            SASSNA+EG D  +I +DV  +E+    + K LK EC+++GSC  SA+
Sbjct  61   SASSNASEGHDHVSIGKDVLKQEIQYNDDEKPLKVECVEQGSCDASAV  108



>gb|KJB73976.1| hypothetical protein B456_011G266100 [Gossypium raimondii]
Length=603

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 62/108 (57%), Positives = 79/108 (73%), Gaps = 3/108 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLSAVAGKllleses  281
            MV KKRL+YGF+ +  P VPRAPRS RRR      V+D QICAFELL+++AGKLL ESES
Sbjct  1    MVFKKRLDYGFNTFNVPDVPRAPRSIRRRCRSKRVVEDSQICAFELLASLAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDV-TEELGNFQEGKALKPECLDRGSCVESAI  422
            SASSNA+EG D  +I +DV  +E+    + K LK EC+++GSC  SA+
Sbjct  61   SASSNASEGHDHVSIGKDVLKQEIQYNDDEKPLKVECVEQGSCDASAV  108



>ref|XP_010096584.1| Telomere repeat-binding protein 4 [Morus notabilis]
 gb|EXB65252.1| Telomere repeat-binding protein 4 [Morus notabilis]
Length=693

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 80/110 (73%), Gaps = 6/110 (5%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrr-rHTGNVDDKQICAFELLSAVAGKlll--ese  278
            MV+KKRLEYGF+G++ P +PRAPRS+RR  +    DD QICAFELL+++AG+LL   ES 
Sbjct  1    MVLKKRLEYGFNGFQVPTIPRAPRSARRGSNKKKADDSQICAFELLASLAGQLLQECESA  60

Query  279  ssassnaaeGKDGPAIXRDVTEELGNFQEG-KALKPECLDRGSCVESAIL  425
            SSASSNA+EG + PA  +DV  +    Q+G K LK EC ++GS  ESA +
Sbjct  61   SSASSNASEGNNQPAFGKDVITQ--ERQDGDKLLKEECFEQGSSEESAFV  108



>ref|XP_008784600.1| PREDICTED: telomere repeat-binding protein 5 [Phoenix dactylifera]
 ref|XP_008784601.1| PREDICTED: telomere repeat-binding protein 5 [Phoenix dactylifera]
Length=704

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 47/116 (41%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGKllleses  281
            MV++KRL+YG  GY+ PA+P  PRS+R + +    V+D ++CAF+LL+ VAG+LL E ++
Sbjct  1    MVLQKRLDYGSSGYQVPAMPHVPRSARGKRSVRKKVEDNRMCAFDLLATVAGRLLSERQN  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQ  449
            S +     G   P   +D+ ++   F+  K LK E  D+GSC ESA+      Q Q
Sbjct  61   SPTPCNITGTSNPTAGKDIIKQ-EQFENEKPLKAEAFDQGSCDESALGSEIVFQRQ  115



>gb|KHG29953.1| Telomere repeat-binding 3 -like protein [Gossypium arboreum]
Length=707

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 3/108 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLSAVAGKllleses  281
            MV KKRL+YGF+ +  P VPRAPRS RRR      V+D QICAFELL+++AGKLL ESES
Sbjct  1    MVFKKRLDYGFNTFNVPDVPRAPRSIRRRCRSKRVVEDSQICAFELLASLAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVT-EELGNFQEGKALKPECLDRGSCVESAI  422
            SASSNA+EG D  +I +DV  +E+    + K LK EC ++GSC  SA+
Sbjct  61   SASSNASEGHDRVSIGKDVVKQEIQYDDDEKPLKVECFEQGSCDTSAV  108



>ref|XP_008343536.1| PREDICTED: telomere repeat-binding protein 3-like [Malus domestica]
Length=678

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 66/122 (54%), Positives = 83/122 (68%), Gaps = 11/122 (9%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrr-HTGNVDDKQICAFELLSAVAGKlllesess  284
            M +KKRL++GF+G++ P +PRAPRS+RR  H  +V D QI AFELL+++AGKLL ESESS
Sbjct  1    MGLKKRLDFGFNGFQVPNIPRAPRSARRGPHRKSVKDGQISAFELLASLAGKLLQESESS  60

Query  285  assnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAIL--------RRGAI  440
            ASSNA+EG   PA   DV  E  +  E K LK ECLD+GS  ES  L        R+G I
Sbjct  61   ASSNASEGNLQPAFGIDVKLERQD--EHKPLKEECLDQGSSEESVSLGLTSQNINRKGII  118

Query  441  QE  446
            +E
Sbjct  119  KE  120



>gb|EYU19914.1| hypothetical protein MIMGU_mgv1a002489mg [Erythranthe guttata]
Length=667

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 63/119 (53%), Positives = 77/119 (65%), Gaps = 3/119 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN---VDDKQICAFELLSAVAGKlllese  278
            MV KKRL+ G DGYR P +P+APRS RRR       V+  ++CAFELL+AVAGKLL ESE
Sbjct  1    MVSKKRLDTGLDGYRAPFIPKAPRSIRRRGPLKKLVVEHGELCAFELLAAVAGKLLQESE  60

Query  279  ssassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKI  455
            SSASSN AEGK    I  D  E +   ++ KALK E  D GS  ESA +   ++QE  +
Sbjct  61   SSASSNIAEGKSPLDIFPDENERVQPKEDNKALKSESFDHGSFAESAFVPEVSVQEHNL  119



>ref|XP_004307493.1| PREDICTED: telomere repeat-binding protein 4 [Fragaria vesca 
subsp. vesca]
Length=697

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 48/109 (44%), Positives = 68/109 (62%), Gaps = 5/109 (5%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpa--vpraprssrrrHTGNVDDKQICAFELLSAVAGK-lllese  278
            MV+KKRL++GF+G++ P           R      V+D+QICAFELL+++AGK L     
Sbjct  1    MVLKKRLDFGFNGFQVPTIPKAPRSARRRGPQKKPVEDEQICAFELLASIAGKLLQESES  60

Query  279  ssassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAIL  425
            SSASSNA++G+  PA  ++V +E+ +  E K LK ECL +G   ES  L
Sbjct  61   SSASSNASQGESQPAFGKEVKQEIQD--EHKLLKDECLYQGCSEESVSL  107



>ref|XP_011027217.1| PREDICTED: telomere repeat-binding protein 3-like isoform X1 
[Populus euphratica]
Length=703

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 64/110 (58%), Gaps = 3/110 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrf--pavpraprssrrrHTGNVDDKQICAFELLSAVAGKllleses  281
            MV+KKR  YGF+G+              R  +   V+D QICAFELL+++AGKLL ESES
Sbjct  1    MVVKKRQYYGFNGFHMPPVPRAPRSARGRGLNKTKVEDSQICAFELLASLAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRR  431
            SASSNA+E  D P I      +     + + L+ ECLD GSC ESA   R
Sbjct  61   SASSNASEANDQPVIGGGGGVKFEQ-DDDRPLRAECLDHGSCGESAFFTR  109



>ref|XP_011027219.1| PREDICTED: telomere repeat-binding protein 3-like isoform X3 
[Populus euphratica]
Length=701

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 64/110 (58%), Gaps = 3/110 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrf--pavpraprssrrrHTGNVDDKQICAFELLSAVAGKllleses  281
            MV+KKR  YGF+G+              R  +   V+D QICAFELL+++AGKLL ESES
Sbjct  1    MVVKKRQYYGFNGFHMPPVPRAPRSARGRGLNKTKVEDSQICAFELLASLAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRR  431
            SASSNA+E  D P I      +     + + L+ ECLD GSC ESA   R
Sbjct  61   SASSNASEANDQPVIGGGGGVKFEQ-DDDRPLRAECLDHGSCGESAFFTR  109



>ref|XP_008387777.1| PREDICTED: telomere repeat-binding protein 5-like isoform X4 
[Malus domestica]
Length=617

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 3/129 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGKllleses  281
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE L++VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
               +N + GKD P    DV  +     +G  LK E  + GSC E   L    +QE++  +
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERRESY  119

Query  462  GNGGSSYSE  488
               G S+S+
Sbjct  120  TLNGVSHSQ  128



>ref|XP_008359725.1| PREDICTED: telomere repeat-binding protein 2-like isoform X6 
[Malus domestica]
Length=358

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 3/129 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGKllleses  281
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE L++VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
               +N + GKD P    DV  +     +G  LK E  + GSC E   L    +QE++  +
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERRESY  119

Query  462  GNGGSSYSE  488
               G S+S+
Sbjct  120  TLNGVSHSQ  128



>ref|XP_008359724.1| PREDICTED: telomere repeat-binding protein 5-like isoform X5 
[Malus domestica]
Length=360

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 3/129 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGKllleses  281
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE L++VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
               +N + GKD P    DV  +     +G  LK E  + GSC E   L    +QE++  +
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERRESY  119

Query  462  GNGGSSYSE  488
               G S+S+
Sbjct  120  TLNGVSHSQ  128



>ref|XP_008387776.1| PREDICTED: telomere repeat-binding protein 5-like isoform X3 
[Malus domestica]
Length=631

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 3/129 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGKllleses  281
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE L++VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
               +N + GKD P    DV  +     +G  LK E  + GSC E   L    +QE++  +
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERRESY  119

Query  462  GNGGSSYSE  488
               G S+S+
Sbjct  120  TLNGVSHSQ  128



>gb|KHF99719.1| Telomere repeat-binding 4 -like protein [Gossypium arboreum]
Length=676

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 52/107 (49%), Positives = 70/107 (65%), Gaps = 4/107 (4%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLSAVAGKllleses  281
            MV KKRL+YGF+ +    VPRAPRS R+R      V+D +ICAFELL+++AGKLL   ES
Sbjct  1    MVFKKRLDYGFNAFSVSNVPRAPRSIRKRDRTKRVVEDSRICAFELLASLAGKLLEAGES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAI  422
             ASSNA+ G D  ++ +DV  +L    + K LK EC++  SC  S +
Sbjct  61   FASSNASAGHDHVSVVKDV--KLETQYDDKPLKTECVEHVSCDASVV  105



>ref|XP_008359722.1| PREDICTED: telomere repeat-binding protein 5-like isoform X3 
[Malus domestica]
Length=372

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 3/129 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGKllleses  281
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE L++VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
               +N + GKD P    DV  +     +G  LK E  + GSC E   L    +QE++  +
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERRESY  119

Query  462  GNGGSSYSE  488
               G S+S+
Sbjct  120  TLNGVSHSQ  128



>ref|XP_008359718.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Malus domestica]
 ref|XP_008359719.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Malus domestica]
 ref|XP_008359720.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Malus domestica]
Length=390

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 3/129 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGKllleses  281
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE L++VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
               +N + GKD P    DV  +     +G  LK E  + GSC E   L    +QE++  +
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERRESY  119

Query  462  GNGGSSYSE  488
               G S+S+
Sbjct  120  TLNGVSHSQ  128



>ref|XP_008359721.1| PREDICTED: telomere repeat-binding protein 5-like isoform X2 
[Malus domestica]
Length=389

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 3/129 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGKllleses  281
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE L++VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
               +N + GKD P    DV  +     +G  LK E  + GSC E   L    +QE++  +
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERRESY  119

Query  462  GNGGSSYSE  488
               G S+S+
Sbjct  120  TLNGVSHSQ  128



>ref|XP_008387775.1| PREDICTED: telomere repeat-binding protein 5-like isoform X2 
[Malus domestica]
Length=648

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 3/129 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGKllleses  281
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE L++VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
               +N + GKD P    DV  +     +G  LK E  + GSC E   L    +QE++  +
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERRESY  119

Query  462  GNGGSSYSE  488
               G S+S+
Sbjct  120  TLNGVSHSQ  128



>ref|XP_008359723.1| PREDICTED: telomere repeat-binding protein 5-like isoform X4 
[Malus domestica]
Length=369

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 3/129 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGKllleses  281
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE L++VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
               +N + GKD P    DV  +     +G  LK E  + GSC E   L    +QE++  +
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERRESY  119

Query  462  GNGGSSYSE  488
               G S+S+
Sbjct  120  TLNGVSHSQ  128



>ref|XP_008387778.1| PREDICTED: telomere repeat-binding protein 5-like isoform X5 
[Malus domestica]
Length=604

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 3/129 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGKllleses  281
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE L++VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
               +N + GKD P    DV  +     +G  LK E  + GSC E   L    +QE++  +
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERRESY  119

Query  462  GNGGSSYSE  488
               G S+S+
Sbjct  120  TLNGVSHSQ  128



>ref|XP_008387772.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Malus domestica]
 ref|XP_008387773.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Malus domestica]
 ref|XP_008387774.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Malus domestica]
Length=649

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 3/129 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGKllleses  281
            MV+++RLEYGF+GYR P VPRA RS+R R      ++  QI AFE L++VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRMPEVPRASRSARGRGPIRSKLEANQIXAFESLASVAGKLLQESKD  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
               +N + GKD P    DV  +     +G  LK E  + GSC E   L    +QE++  +
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQXDKGNLLKEEPCELGSCDEETFLYVHGLQERRESY  119

Query  462  GNGGSSYSE  488
               G S+S+
Sbjct  120  TLNGVSHSQ  128



>ref|XP_011077209.1| PREDICTED: telomere repeat-binding protein 3-like [Sesamum indicum]
 ref|XP_011077212.1| PREDICTED: telomere repeat-binding protein 3-like [Sesamum indicum]
 ref|XP_011077213.1| PREDICTED: telomere repeat-binding protein 3-like [Sesamum indicum]
Length=695

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 69/118 (58%), Gaps = 3/118 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrf--pavpraprssrrrHTGNVDDKQICAFELLSAVAGKllleses  281
            MV KKRL+  F+GYR             R      V+D ++CAFELL+AVAGKLL ESES
Sbjct  1    MVSKKRLDCRFNGYRAPIVPRAPRSIRRRGPRKKLVEDSKLCAFELLAAVAGKLLEESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKI  455
            SASSN AEGK       D  E++   ++  ALK E LDRGS  ESA +    +QE K+
Sbjct  61   SASSNIAEGKVKVGACLDGDEKV-QPKDDTALKSESLDRGSSAESAFVPEICVQEHKL  117



>gb|EPS64950.1| hypothetical protein M569_09831, partial [Genlisea aurea]
Length=659

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 52/120 (43%), Positives = 69/120 (58%), Gaps = 8/120 (7%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpav----praprssrrrHTGNVDDKQICAFELLSAVAGKllles  275
            MV+K+RL++ F G    A            +      ++++ +C+FELL+AVAGKLL ES
Sbjct  1    MVLKRRLDFRFSGNGNEAATIPRAPRSIRKKPPRKKILEEENLCSFELLAAVAGKLLEES  60

Query  276  essassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKI  455
            E SAS +AAEGK+     R   E+     EG ALK E  DRGSC ESA LR  +IQE  +
Sbjct  61   EGSASCSAAEGKNQ---LRQGNEKELPKDEG-ALKFEIFDRGSCAESAFLREISIQEHNL  116



>ref|XP_010658554.1| PREDICTED: telomere repeat-binding protein 4 isoform X1 [Vitis 
vinifera]
 ref|XP_010658555.1| PREDICTED: telomere repeat-binding protein 4 isoform X1 [Vitis 
vinifera]
 ref|XP_010658556.1| PREDICTED: telomere repeat-binding protein 4 isoform X1 [Vitis 
vinifera]
Length=706

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 55/124 (44%), Positives = 77/124 (62%), Gaps = 8/124 (6%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN----VDDKQICAFELLSAVAGK-llle  272
            MV+KK+ +YGF+G+    +PRAPRS R +  G+    V+D QICA +LL+ +AGK L   
Sbjct  1    MVLKKKQDYGFNGFHVSTIPRAPRSIRFQRRGSIKKPVEDSQICAIDLLATLAGKLLQES  60

Query  273  sessassnaaeGKDGPAIXRD-VTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQ  449
              SSASSN A GKD   I +D + +EL +  + K LK ECLD+GSC     + + A Q+ 
Sbjct  61   ESSSASSNVAAGKDRLNISKDGIKQELQD--DDKPLKGECLDQGSCEGIVFVSKLASQDL  118

Query  450  KIKH  461
              K+
Sbjct  119  SPKY  122



>ref|XP_008240801.1| PREDICTED: telomere repeat-binding protein 5-like [Prunus mume]
 ref|XP_008240809.1| PREDICTED: telomere repeat-binding protein 5-like [Prunus mume]
Length=663

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 54/129 (42%), Positives = 79/129 (61%), Gaps = 4/129 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrH--TGNVDDKQICAFELLSAVAGKllleses  281
            MV+++RL+YGF+GY+ P VPRA RS+R R      ++  QI AFE+L++VAGKLL ESE 
Sbjct  1    MVLQRRLDYGFNGYQVPEVPRASRSARGRGPIKKKLEANQIRAFEILASVAGKLLQESEH  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
               +N + GKD   I  D T+     ++G   K +  +RGSC E  +L  G +QE +  +
Sbjct  61   PLPTNDSCGKDAHFIFDDTTKS--KQEKGNLSKEDPCERGSCDEQTLLCVGRMQECQQSY  118

Query  462  GNGGSSYSE  488
               G S+S+
Sbjct  119  TLNGVSHSQ  127



>gb|KHN17923.1| Telomere repeat-binding protein 3 [Glycine soja]
Length=676

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 53/120 (44%), Positives = 70/120 (58%), Gaps = 5/120 (4%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpa--vpraprssrrrHTGNVDDKQICAFELLSAVAGKllleses  281
            MV+KKR+++GFDG R P           R      V+D Q+CA ELL+++AG+LL ESE 
Sbjct  1    MVLKKRVDHGFDGLRVPVIPKAPRSARRRIAFKKAVEDGQVCAIELLASLAGQLLQESEG  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEG-KALKPECLDRGSCVESAILRRGAIQEQKIK  458
            SASSNA+EG   P   + V E+  + Q+G K LK E + +GSCVES      A Q    K
Sbjct  61   SASSNASEGNHHPPFSQGVIEQ--DIQDGVKPLKKEEIHQGSCVESTFKTEVASQNSSQK  118



>ref|XP_006591341.1| PREDICTED: telomere repeat-binding protein 3-like isoform X2 
[Glycine max]
Length=676

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 53/120 (44%), Positives = 70/120 (58%), Gaps = 5/120 (4%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpa--vpraprssrrrHTGNVDDKQICAFELLSAVAGKllleses  281
            MV+KKR+++GFDG R P           R      V+D Q+CA ELL+++AG+LL ESE 
Sbjct  1    MVLKKRVDHGFDGLRVPVIPKAPRSARRRIAFKKAVEDGQVCAIELLASLAGQLLQESEG  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEG-KALKPECLDRGSCVESAILRRGAIQEQKIK  458
            SASSNA+EG   P   + V E+  + Q+G K LK E + +GSCVES      A Q    K
Sbjct  61   SASSNASEGNHHPPFSQGVIEQ--DIQDGVKPLKKEEIHQGSCVESTFKTEVASQNSSQK  118



>ref|XP_003538412.1| PREDICTED: telomere repeat-binding protein 3-like isoform X1 
[Glycine max]
Length=679

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 53/120 (44%), Positives = 70/120 (58%), Gaps = 5/120 (4%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpa--vpraprssrrrHTGNVDDKQICAFELLSAVAGKllleses  281
            MV+KKR+++GFDG R P           R      V+D Q+CA ELL+++AG+LL ESE 
Sbjct  1    MVLKKRVDHGFDGLRVPVIPKAPRSARRRIAFKKAVEDGQVCAIELLASLAGQLLQESEG  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEG-KALKPECLDRGSCVESAILRRGAIQEQKIK  458
            SASSNA+EG   P   + V E+  + Q+G K LK E + +GSCVES      A Q    K
Sbjct  61   SASSNASEGNHHPPFSQGVIEQ--DIQDGVKPLKKEEIHQGSCVESTFKTEVASQNSSQK  118



>ref|XP_007206321.1| hypothetical protein PRUPE_ppa002522mg [Prunus persica]
 gb|EMJ07520.1| hypothetical protein PRUPE_ppa002522mg [Prunus persica]
Length=662

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 54/129 (42%), Positives = 79/129 (61%), Gaps = 4/129 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrH--TGNVDDKQICAFELLSAVAGKllleses  281
            MV+++RL+YGF+GY+ P VPRA RS+R R      ++  QI AFE+L++VAGKLL ESE 
Sbjct  1    MVLQRRLDYGFNGYQVPEVPRASRSARGRVPIKKKLEANQIRAFEILASVAGKLLQESEH  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
               +N + GKD   I  D T+     ++G   K +  +RGSC E  +L  G +QE +  +
Sbjct  61   PLPTNDSCGKDAHFIFDDTTKS--KQEKGNLSKEDPCERGSCDEQTLLCVGRMQECQQSY  118

Query  462  GNGGSSYSE  488
               G S+S+
Sbjct  119  TLNGVSHSQ  127



>ref|XP_002311174.2| hypothetical protein POPTR_0008s05740g [Populus trichocarpa]
 gb|EEE88541.2| hypothetical protein POPTR_0008s05740g [Populus trichocarpa]
Length=707

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 60/109 (55%), Positives = 75/109 (69%), Gaps = 5/109 (5%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN---VDDKQICAFELLSAVAGKlllese  278
            MV+KKR  YGF+G+  P VPRAPRS+RR  + N   V+D Q+CAF+LL+++AGKLL ESE
Sbjct  1    MVVKKRQYYGFNGFHMPPVPRAPRSARRGLSLNKKKVEDSQLCAFDLLASLAGKLLQESE  60

Query  279  ssassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAIL  425
            SSASSNA+E  D P I     +      E + LK ECLD GSC ESA +
Sbjct  61   SSASSNASEANDQPIIGGGGVK--CEQAEERPLKAECLDHGSCGESAFV  107



>gb|KJB78826.1| hypothetical protein B456_013G021300 [Gossypium raimondii]
 gb|KJB78827.1| hypothetical protein B456_013G021300 [Gossypium raimondii]
 gb|KJB78828.1| hypothetical protein B456_013G021300 [Gossypium raimondii]
Length=697

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 55/107 (51%), Positives = 71/107 (66%), Gaps = 4/107 (4%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLSAVAGKllleses  281
            MV KKRL+YGF+ +    VPRAPRS R+R      V+D +ICAFELL+++AGKLL E ES
Sbjct  1    MVFKKRLDYGFNAFSVSNVPRAPRSIRKRDRTKRVVEDSRICAFELLASLAGKLLEEGES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAI  422
            SASSNA+ G D  +I +DV  +L    + K LK EC+   SC  S +
Sbjct  61   SASSNASAGHDHVSIGKDV--KLETRYDDKPLKTECVGHVSCDASVV  105



>ref|XP_010256898.1| PREDICTED: telomere repeat-binding protein 5-like isoform X2 
[Nelumbo nucifera]
Length=680

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 44/108 (41%), Positives = 63/108 (58%), Gaps = 5/108 (5%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGNVDDKQICAFELLSAVAGKlllesessa  287
            MV++KRLEYGF+GY+ P   R+ R         V D  +CAF+LL+ VAGKLL E ESS 
Sbjct  1    MVLQKRLEYGFNGYQVPRASRSARGRGSVRK-KVHDNPMCAFDLLATVAGKLLQEGESSP  59

Query  288  ssnaaeGKD--GPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAIL  425
            +   A  ++   P +  ++  E  +  E + LK E  D+GSC ES ++
Sbjct  60   APAKASARNDQNPLVKHNLEAEQQD--EERTLKVEPFDQGSCNESVLV  105



>gb|KJB78829.1| hypothetical protein B456_013G021300 [Gossypium raimondii]
Length=620

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 55/107 (51%), Positives = 71/107 (66%), Gaps = 4/107 (4%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLSAVAGKllleses  281
            MV KKRL+YGF+ +    VPRAPRS R+R      V+D +ICAFELL+++AGKLL E ES
Sbjct  1    MVFKKRLDYGFNAFSVSNVPRAPRSIRKRDRTKRVVEDSRICAFELLASLAGKLLEEGES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAI  422
            SASSNA+ G D  +I +DV  +L    + K LK EC+   SC  S +
Sbjct  61   SASSNASAGHDHVSIGKDV--KLETRYDDKPLKTECVGHVSCDASVV  105



>ref|XP_010256896.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010256897.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Nelumbo nucifera]
Length=686

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 44/108 (41%), Positives = 63/108 (58%), Gaps = 5/108 (5%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGNVDDKQICAFELLSAVAGKlllesessa  287
            MV++KRLEYGF+GY+ P   R+ R         V D  +CAF+LL+ VAGKLL E ESS 
Sbjct  1    MVLQKRLEYGFNGYQVPRASRSARGRGSVRK-KVHDNPMCAFDLLATVAGKLLQEGESSP  59

Query  288  ssnaaeGKD--GPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAIL  425
            +   A  ++   P +  ++  E  +  E + LK E  D+GSC ES ++
Sbjct  60   APAKASARNDQNPLVKHNLEAEQQD--EERTLKVEPFDQGSCNESVLV  105



>gb|KHG15516.1| Telomere repeat-binding 3 -like protein [Gossypium arboreum]
Length=660

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 52/105 (50%), Positives = 72/105 (69%), Gaps = 3/105 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTG--NVDDKQICAFELLSAVAGKllleses  281
            MV KKRL+YGF+ +    VPRAPRS RRR      V++ Q CAFE+L+++AGKLL ESES
Sbjct  1    MVFKKRLDYGFNAFNVHDVPRAPRSMRRRSQSKCTVEESQFCAFEMLASLAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVES  416
            SAS NA+EG +  +I ++  ++   + E K LKP+C ++G C  S
Sbjct  61   SASGNASEGHECDSIGKNCFKQEIQY-EDKPLKPKCFEQGRCEAS  104



>ref|XP_009349459.1| PREDICTED: telomere repeat-binding protein 5-like isoform X4 
[Pyrus x bretschneideri]
Length=616

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 55/129 (43%), Positives = 74/129 (57%), Gaps = 3/129 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGKllleses  281
            MV+++RLEYGF+GYR P VPRA RS+R R       +  QI AFE L++VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRVPEVPRASRSARGRGPIRSKFEANQIHAFESLASVAGKLLQESKD  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
               +N + GKD P    DV  +      G  LK E  + GSC E   L    +QE++  +
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQQDTGNLLKEEPCELGSCDEETFLYVHGLQERQESY  119

Query  462  GNGGSSYSE  488
               G S+S+
Sbjct  120  TLNGVSHSQ  128



>ref|XP_011027692.1| PREDICTED: telomere repeat-binding protein 3-like [Populus euphratica]
Length=618

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 66/110 (60%), Gaps = 6/110 (5%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrf----pavpraprssrrrHTGNVDDKQICAFELLSAVAGKllles  275
            MV+KKR  YGF+G+       A   A +     +   V+D Q+CAFELL+++AGKLL ES
Sbjct  1    MVVKKRQYYGFNGFHMPPVPRAPRSARQRGLSLNKKKVEDSQLCAFELLASLAGKLLQES  60

Query  276  essassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAIL  425
            ESSASSNA+E  + P I     +      E + LK ECLD GSC ESA +
Sbjct  61   ESSASSNASEANNQPIIGGGGVK--CEQAEDRPLKAECLDHGSCRESAFV  108



>ref|XP_006602000.1| PREDICTED: telomere repeat-binding protein 3-like isoform X1 
[Glycine max]
 ref|XP_006602001.1| PREDICTED: telomere repeat-binding protein 3-like isoform X2 
[Glycine max]
 gb|KHN07566.1| Telomere repeat-binding protein 3 [Glycine soja]
Length=674

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 5/120 (4%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLSAVAGKllleses  281
            MV+KKR++YGF+G+R P +P+APRS+RRR   N  V+D Q+CA ELL+++AG+LL ESES
Sbjct  1    MVLKKRVDYGFNGFRVPVIPKAPRSARRRVAFNKAVEDGQVCAIELLASLAGQLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQ-EGKALKPECLDRGSCVESAILRRGAIQEQKIK  458
            SASSNA+EG   PA  + V E+  + Q E K LK E + +G+C ES      A Q+   K
Sbjct  61   SASSNASEGNHQPAFSQGVIEQ--DIQDEVKPLKMEEIHQGNCAESTFKTEVASQKSSQK  118



>ref|XP_009349457.1| PREDICTED: telomere repeat-binding protein 5-like isoform X2 
[Pyrus x bretschneideri]
Length=647

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 55/129 (43%), Positives = 74/129 (57%), Gaps = 3/129 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGKllleses  281
            MV+++RLEYGF+GYR P VPRA RS+R R       +  QI AFE L++VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRVPEVPRASRSARGRGPIRSKFEANQIHAFESLASVAGKLLQESKD  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
               +N + GKD P    DV  +      G  LK E  + GSC E   L    +QE++  +
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQQDTGNLLKEEPCELGSCDEETFLYVHGLQERQESY  119

Query  462  GNGGSSYSE  488
               G S+S+
Sbjct  120  TLNGVSHSQ  128



>ref|XP_009349456.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Pyrus x bretschneideri]
Length=648

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 55/129 (43%), Positives = 74/129 (57%), Gaps = 3/129 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGKllleses  281
            MV+++RLEYGF+GYR P VPRA RS+R R       +  QI AFE L++VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRVPEVPRASRSARGRGPIRSKFEANQIHAFESLASVAGKLLQESKD  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
               +N + GKD P    DV  +      G  LK E  + GSC E   L    +QE++  +
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQQDTGNLLKEEPCELGSCDEETFLYVHGLQERQESY  119

Query  462  GNGGSSYSE  488
               G S+S+
Sbjct  120  TLNGVSHSQ  128



>ref|XP_009349458.1| PREDICTED: telomere repeat-binding protein 6-like isoform X3 
[Pyrus x bretschneideri]
Length=630

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 55/129 (43%), Positives = 74/129 (57%), Gaps = 3/129 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGKllleses  281
            MV+++RLEYGF+GYR P VPRA RS+R R       +  QI AFE L++VAGKLL ES+ 
Sbjct  1    MVLQRRLEYGFNGYRVPEVPRASRSARGRGPIRSKFEANQIHAFESLASVAGKLLQESKD  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
               +N + GKD P    DV  +      G  LK E  + GSC E   L    +QE++  +
Sbjct  61   PLPTNDSCGKD-PHFKFDVITKSEQQDTGNLLKEEPCELGSCDEETFLYVHGLQERQESY  119

Query  462  GNGGSSYSE  488
               G S+S+
Sbjct  120  TLNGVSHSQ  128



>ref|XP_006602002.1| PREDICTED: telomere repeat-binding protein 3-like isoform X3 
[Glycine max]
Length=650

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 5/120 (4%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGN--VDDKQICAFELLSAVAGKllleses  281
            MV+KKR++YGF+G+R P +P+APRS+RRR   N  V+D Q+CA ELL+++AG+LL ESES
Sbjct  1    MVLKKRVDYGFNGFRVPVIPKAPRSARRRVAFNKAVEDGQVCAIELLASLAGQLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQ-EGKALKPECLDRGSCVESAILRRGAIQEQKIK  458
            SASSNA+EG   PA  + V E+  + Q E K LK E + +G+C ES      A Q+   K
Sbjct  61   SASSNASEGNHQPAFSQGVIEQ--DIQDEVKPLKMEEIHQGNCAESTFKTEVASQKSSQK  118



>ref|XP_010262528.1| PREDICTED: telomere repeat-binding protein 5 [Nelumbo nucifera]
 ref|XP_010262529.1| PREDICTED: telomere repeat-binding protein 5 [Nelumbo nucifera]
 ref|XP_010262530.1| PREDICTED: telomere repeat-binding protein 5 [Nelumbo nucifera]
 ref|XP_010262531.1| PREDICTED: telomere repeat-binding protein 5 [Nelumbo nucifera]
 ref|XP_010262532.1| PREDICTED: telomere repeat-binding protein 5 [Nelumbo nucifera]
 ref|XP_010262533.1| PREDICTED: telomere repeat-binding protein 5 [Nelumbo nucifera]
 ref|XP_010262534.1| PREDICTED: telomere repeat-binding protein 5 [Nelumbo nucifera]
Length=684

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 44/103 (43%), Positives = 59/103 (57%), Gaps = 3/103 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHTGNVDDKQICAFELLSAVAGKlllesess-  284
            MV++KR +YGF+GY  P   R+ R         V+D  +CAFELL+ VAGKLL E E+S 
Sbjct  1    MVLQKRFDYGFNGYHVPRASRSARGRGSVKK-KVEDNSMCAFELLATVAGKLLQEKETSP  59

Query  285  assnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVE  413
              + A  G D   I + + +E  +  E K LK E  D+GSC E
Sbjct  60   IHAKALAGNDRTTIVKHIVKE-EHQDEVKILKSEPFDQGSCNE  101



>emb|CBI31661.3| unnamed protein product [Vitis vinifera]
Length=681

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 56/122 (46%), Positives = 77/122 (63%), Gaps = 6/122 (5%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGK-lllese  278
            MV+KK+ +YGF+G+    +PRAPRS RRR +    V+D QICA +LL+ +AGK L     
Sbjct  1    MVLKKKQDYGFNGFHVSTIPRAPRSIRRRGSIKKPVEDSQICAIDLLATLAGKLLQESES  60

Query  279  ssassnaaeGKDGPAIXRD-VTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKI  455
            SSASSN A GKD   I +D + +EL +  + K LK ECLD+GSC     + + A Q+   
Sbjct  61   SSASSNVAAGKDRLNISKDGIKQELQD--DDKPLKGECLDQGSCEGIVFVSKLASQDLSP  118

Query  456  KH  461
            K+
Sbjct  119  KY  120



>ref|XP_010658557.1| PREDICTED: telomere repeat-binding protein 4 isoform X2 [Vitis 
vinifera]
Length=704

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 56/122 (46%), Positives = 77/122 (63%), Gaps = 6/122 (5%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGK-lllese  278
            MV+KK+ +YGF+G+    +PRAPRS RRR +    V+D QICA +LL+ +AGK L     
Sbjct  1    MVLKKKQDYGFNGFHVSTIPRAPRSIRRRGSIKKPVEDSQICAIDLLATLAGKLLQESES  60

Query  279  ssassnaaeGKDGPAIXRD-VTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKI  455
            SSASSN A GKD   I +D + +EL +  + K LK ECLD+GSC     + + A Q+   
Sbjct  61   SSASSNVAAGKDRLNISKDGIKQELQD--DDKPLKGECLDQGSCEGIVFVSKLASQDLSP  118

Query  456  KH  461
            K+
Sbjct  119  KY  120



>ref|XP_006488343.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 
[Citrus sinensis]
 ref|XP_006488344.1| PREDICTED: telomere repeat-binding protein 5-like isoform X2 
[Citrus sinensis]
Length=706

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 41/103 (40%), Positives = 60/103 (58%), Gaps = 4/103 (4%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrf--pavpraprssrrrHTGNVDDKQICAFELLSAVAGKlllese-  278
            MV++KRL+YGF+GY+             R       +D Q+CAF+LL+ VAGKLLLE + 
Sbjct  1    MVLQKRLDYGFNGYQVPYTPRATRSARKRCSFKKRAEDNQMCAFDLLATVAGKLLLEKQC  60

Query  279  ssassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSC  407
            + +SSN    +D  A+ +++ E+     E K LK E  D+GSC
Sbjct  61   TPSSSNTPSDEDQSAVAKEI-EQKAMQDENKQLKVETCDQGSC  102



>gb|KDO72832.1| hypothetical protein CISIN_1g042386mg [Citrus sinensis]
Length=699

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 41/103 (40%), Positives = 60/103 (58%), Gaps = 4/103 (4%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrf--pavpraprssrrrHTGNVDDKQICAFELLSAVAGKlllese-  278
            MV++KRL+YGF+GY+             R       +D Q+CAF+LL+ VAGKLLLE + 
Sbjct  1    MVLQKRLDYGFNGYQVPYTPRATRSARKRCSFKKRAEDNQMCAFDLLATVAGKLLLEKQC  60

Query  279  ssassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSC  407
            + +SSN    +D  A+ +++ E+     E K LK E  D+GSC
Sbjct  61   TPSSSNTPSDEDQSAVAKEI-EQKAMQDENKQLKVETCDQGSC  102



>ref|XP_006424852.1| hypothetical protein CICLE_v10027927mg [Citrus clementina]
 ref|XP_006424853.1| hypothetical protein CICLE_v10027927mg [Citrus clementina]
 ref|XP_006488346.1| PREDICTED: telomere repeat-binding protein 5-like isoform X4 
[Citrus sinensis]
 gb|ESR38092.1| hypothetical protein CICLE_v10027927mg [Citrus clementina]
 gb|ESR38093.1| hypothetical protein CICLE_v10027927mg [Citrus clementina]
Length=699

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 41/103 (40%), Positives = 60/103 (58%), Gaps = 4/103 (4%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrf--pavpraprssrrrHTGNVDDKQICAFELLSAVAGKlllese-  278
            MV++KRL+YGF+GY+             R       +D Q+CAF+LL+ VAGKLLLE + 
Sbjct  1    MVLQKRLDYGFNGYQVPYTPRATRSARKRCSFKKRAEDNQMCAFDLLATVAGKLLLEKQC  60

Query  279  ssassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSC  407
            + +SSN    +D  A+ +++ E+     E K LK E  D+GSC
Sbjct  61   TPSSSNTPSDEDQSAVAKEI-EQKAMQDENKQLKVETCDQGSC  102



>ref|XP_006488345.1| PREDICTED: telomere repeat-binding protein 5-like isoform X3 
[Citrus sinensis]
Length=701

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 41/103 (40%), Positives = 60/103 (58%), Gaps = 4/103 (4%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrf--pavpraprssrrrHTGNVDDKQICAFELLSAVAGKlllese-  278
            MV++KRL+YGF+GY+             R       +D Q+CAF+LL+ VAGKLLLE + 
Sbjct  1    MVLQKRLDYGFNGYQVPYTPRATRSARKRCSFKKRAEDNQMCAFDLLATVAGKLLLEKQC  60

Query  279  ssassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSC  407
            + +SSN    +D  A+ +++ E+     E K LK E  D+GSC
Sbjct  61   TPSSSNTPSDEDQSAVAKEI-EQKAMQDENKQLKVETCDQGSC  102



>emb|CAN72738.1| hypothetical protein VITISV_021864 [Vitis vinifera]
Length=672

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 70/104 (67%), Gaps = 6/104 (6%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGK-lllese  278
            MV+KK+ +YGF+G+    +PRAPRS RRR +    V+D QICA +LL+ +AGK L     
Sbjct  1    MVLKKKQDYGFNGFHVSTIPRAPRSIRRRGSIKKPVEDSQICAIDLLATLAGKLLQESES  60

Query  279  ssassnaaeGKDGPAIXRD-VTEELGNFQEGKALKPECLDRGSC  407
            SSASSN A GKD   I +D + +EL +  + K LK ECLD+GSC
Sbjct  61   SSASSNVAAGKDRLNISKDGIKQELQD--DDKPLKGECLDQGSC  102



>ref|XP_006424854.1| hypothetical protein CICLE_v10027927mg [Citrus clementina]
 ref|XP_006488347.1| PREDICTED: telomere repeat-binding protein 5-like isoform X5 
[Citrus sinensis]
 gb|ESR38094.1| hypothetical protein CICLE_v10027927mg [Citrus clementina]
Length=694

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 41/103 (40%), Positives = 60/103 (58%), Gaps = 4/103 (4%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrf--pavpraprssrrrHTGNVDDKQICAFELLSAVAGKlllese-  278
            MV++KRL+YGF+GY+             R       +D Q+CAF+LL+ VAGKLLLE + 
Sbjct  1    MVLQKRLDYGFNGYQVPYTPRATRSARKRCSFKKRAEDNQMCAFDLLATVAGKLLLEKQC  60

Query  279  ssassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSC  407
            + +SSN    +D  A+ +++ E+     E K LK E  D+GSC
Sbjct  61   TPSSSNTPSDEDQSAVAKEI-EQKAMQDENKQLKVETCDQGSC  102



>ref|XP_009341748.1| PREDICTED: telomere repeat-binding protein 5-like [Pyrus x bretschneideri]
Length=655

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 53/129 (41%), Positives = 75/129 (58%), Gaps = 3/129 (2%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGKllleses  281
            MV+++RL+YGF GYR P VPRA RS+R R      +D  QI AFE+L++VAGKLL ES+ 
Sbjct  1    MVLQRRLDYGFSGYRMPEVPRASRSARGRGPIRKKLDANQIHAFEILASVAGKLLQESKD  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAILRRGAIQEQKIKH  461
               +N + GKD P        +     +G+ LK E  + GSC E   L    +QE++  +
Sbjct  61   PLPTNDSCGKD-PHFKFGGITKSKQQDKGRLLKEEPCESGSCDEETFLYVHGLQERRKSY  119

Query  462  GNGGSSYSE  488
               G S+S+
Sbjct  120  TLNGVSHSQ  128



>ref|XP_006424849.1| hypothetical protein CICLE_v10027927mg [Citrus clementina]
 gb|ESR38089.1| hypothetical protein CICLE_v10027927mg [Citrus clementina]
Length=631

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 41/103 (40%), Positives = 60/103 (58%), Gaps = 4/103 (4%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrf--pavpraprssrrrHTGNVDDKQICAFELLSAVAGKlllese-  278
            MV++KRL+YGF+GY+             R       +D Q+CAF+LL+ VAGKLLLE + 
Sbjct  1    MVLQKRLDYGFNGYQVPYTPRATRSARKRCSFKKRAEDNQMCAFDLLATVAGKLLLEKQC  60

Query  279  ssassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSC  407
            + +SSN    +D  A+ +++ E+     E K LK E  D+GSC
Sbjct  61   TPSSSNTPSDEDQSAVAKEI-EQKAMQDENKQLKVETCDQGSC  102



>gb|KDP44939.1| hypothetical protein JCGZ_01439 [Jatropha curcas]
Length=709

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 53/108 (49%), Positives = 68/108 (63%), Gaps = 6/108 (6%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrf--pavpraprssrrrHTGNVDDKQICAFELLSAVAGKllleses  281
            MV+KKR +YGF+G+              R      V+D QICAFELL+A+AGKLL ESES
Sbjct  1    MVLKKRQDYGFNGFHVPFIPRAPRSARQRGLQKKKVEDSQICAFELLAALAGKLLQESES  60

Query  282  sassnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGSCVESAIL  425
            SASS+A+E  D PAI  +  +E    ++ K LK ECLD+GSC ES  +
Sbjct  61   SASSSASETNDQPAIGDNGIKE----EQDKPLKIECLDQGSCEESVFI  104



>ref|XP_008461684.1| PREDICTED: telomere repeat-binding protein 4 isoform X2 [Cucumis 
melo]
Length=689

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 50/100 (50%), Positives = 67/100 (67%), Gaps = 3/100 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrH-TGNVDDKQICAFELLSAVAGKlllesess  284
            MVMKKRL+ GF+G+    VPR PRS R+ H   + +D QICA ELL+++AGKLL + ES+
Sbjct  1    MVMKKRLDNGFNGFSNWTVPRGPRSLRKVHRKKDFEDGQICAIELLASLAGKLLQDGEST  60

Query  285  assnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGS  404
            A SN ++G D   I  +V +E  + +E KA K EC D GS
Sbjct  61   ACSNTSDG-DHSVIGTNVVKEERSSEE-KAFKVECCDGGS  98



>ref|XP_006378701.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
 gb|ERP56498.1| hypothetical protein POPTR_0010s20990g [Populus trichocarpa]
Length=689

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = +3

Query  207  VDDKQICAFELLSAVAGKlllesessassnaaeGKDGPAIXRDVTEELGNFQEGKALKPE  386
            V+D QICAFELL+++AGKLL ESESSASSNA+E  D P I   V  E     + + LK E
Sbjct  29   VEDSQICAFELLASLAGKLLQESESSASSNASEANDQPIIGGGVKFEQ---DDDRPLKAE  85

Query  387  CLDRGSCVESAILRR  431
            CLD GSC ESA+  R
Sbjct  86   CLDHGSCGESALFTR  100



>ref|XP_007221011.1| hypothetical protein PRUPE_ppa002374mg [Prunus persica]
 gb|EMJ22210.1| hypothetical protein PRUPE_ppa002374mg [Prunus persica]
Length=680

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 54/79 (68%), Gaps = 5/79 (6%)
 Frame = +3

Query  195  HTGNVDDKQICAFELLSAVAGK-lllesessassnaaeGKDGPAIXRDVTEELGNFQEG-  368
            H  +VD+ QICAFELL+++AGK L   + SSASSNA+EG   PA  +DV +E    Q+G 
Sbjct  20   HKKSVDNGQICAFELLASLAGKLLQESASSSASSNASEGNSKPAFGKDVKQER---QDGH  76

Query  369  KALKPECLDRGSCVESAIL  425
            K LK ECLD+GS  ES  L
Sbjct  77   KPLKEECLDQGSSEESVSL  95



>gb|KGN50558.1| hypothetical protein Csa_5G182630 [Cucumis sativus]
Length=690

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 50/100 (50%), Positives = 66/100 (66%), Gaps = 3/100 (3%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrH-TGNVDDKQICAFELLSAVAGKlllesess  284
            MVMKKRL+ GF G+    VPR PRS R+ H   + +D QICA ELL+++AGKLL + ES+
Sbjct  1    MVMKKRLDNGFSGFSNWTVPRGPRSLRKVHRKKDFEDGQICAIELLASLAGKLLQDGEST  60

Query  285  assnaaeGKDGPAIXRDVTEELGNFQEGKALKPECLDRGS  404
            A SN ++G D   I  +V +E  + +E KA K EC D GS
Sbjct  61   ACSNTSDG-DRSVIGTNVVKEERSSEE-KAFKVECCDGGS  98



>ref|XP_008801908.1| PREDICTED: telomere repeat-binding protein 5-like [Phoenix dactylifera]
Length=440

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 62/104 (60%), Gaps = 7/104 (7%)
 Frame = +3

Query  108  MVMKKRLEYGFDGYrfpavpraprssrrrHT--GNVDDKQICAFELLSAVAGKllleses  281
            MV++KRL+YG  GY+ PA+P  PRS+R + +    V++ Q+CAF+LL+ VAGKLL E ES
Sbjct  1    MVLQKRLDYGSSGYQVPAMPHVPRSARGKRSVRKKVENNQMCAFDLLATVAGKLLSERES  60

Query  282  sassnaaeGKDGPAIXRDVT--EELGNFQEGKALKPECLDRGSC  407
            S +     G   P   +D    E+L N    K  K E  D+G C
Sbjct  61   SLTPCDITGTSNPTTEKDTVKQEQLDN---EKPFKTEAFDQGGC  101



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557548962370