BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS053B07

Length=586
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003619702.1|  Ubiquitin-like protein                             360   3e-123   
gb|AGV54749.1|  ubiquitin 11                                            360   1e-122   Phaseolus vulgaris [French bean]
gb|ACA58351.1|  ubiquitin-like protein                                  356   3e-122   Sandersonia aurantiaca [Chinese-lantern lily]
gb|AFC36452.1|  ubiquitin                                               357   3e-122   Anoectochilus roxburghii
gb|ABI84246.1|  polyubiquitin 10                                        355   4e-122   Arachis hypogaea [goober]
emb|CBI22349.3|  unnamed protein product                                359   4e-122   Vitis vinifera
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             359   7e-122   
gb|AEZ49160.1|  polyubiquitin                                           358   7e-122   Wolffia australiana
gb|AFW66442.1|  putative ubiquitin family protein                       355   9e-122   
gb|AEW46688.1|  polyubiquitin                                           355   1e-121   Ulva linza
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   355   2e-121   Camelina sativa [gold-of-pleasure]
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      355   2e-121   Setaria italica
ref|XP_007154494.1|  hypothetical protein PHAVU_003G1236001g            354   2e-121   Phaseolus vulgaris [French bean]
gb|AFP44113.1|  ubiquitin                                               353   2e-121   Lycoris longituba
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                355   2e-121   Erythranthe guttata [common monkey flower]
ref|XP_009412006.1|  PREDICTED: polyubiquitin 11-like                   355   2e-121   
dbj|BAC57955.1|  polyubiquitin                                          355   2e-121   Tripolium pannonicum [sea starwort]
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             355   2e-121   
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             355   2e-121   Elaeis guineensis
gb|AET06143.1|  ubiquitin                                               355   2e-121   Papaver somniferum
gb|AAO43307.1|  putative polyubiquitin                                  356   2e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             355   2e-121   
ref|XP_002317213.1|  polyubiquitin family protein                       355   2e-121   Populus trichocarpa [western balsam poplar]
gb|ACJ85618.1|  unknown                                                 355   2e-121   Medicago truncatula
gb|AAP31578.1|  ubiquitin                                               355   2e-121   Hevea brasiliensis [jebe]
gb|KJB36627.1|  hypothetical protein B456_006G167800                    355   2e-121   Gossypium raimondii
emb|CAH59739.1|  polyubiquitin                                          355   2e-121   Plantago major [cart-track plant]
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             355   3e-121   Brachypodium distachyon [annual false brome]
ref|NP_567286.1|  ubiquitin 11                                          355   3e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003626479.1|  Ubiquitin-like protein                             357   3e-121   
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   355   3e-121   Citrus sinensis [apfelsine]
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    356   3e-121   
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             355   3e-121   Citrus clementina [clementine]
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   355   3e-121   Citrus sinensis [apfelsine]
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          355   3e-121   Sorghum bicolor [broomcorn]
ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             355   3e-121   
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             355   3e-121   Citrus clementina [clementine]
ref|XP_003607669.1|  Multidrug resistance protein ABC transporter...    362   3e-121   
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      357   3e-121   
gb|AIZ74335.1|  polyubiquitin 3                                         355   4e-121   Pinus massoniana [Chinese red pine]
gb|AFK41706.1|  unknown                                                 355   4e-121   Medicago truncatula
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             356   4e-121   Brachypodium distachyon [annual false brome]
gb|AAC35858.1|  polyubiquitin                                           355   5e-121   Capsicum chinense [bonnet pepper]
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             355   5e-121   
emb|CAD27944.1|  polyubiquitin-like                                     353   5e-121   Oryza sativa [red rice]
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      358   5e-121   Brachypodium distachyon [annual false brome]
ref|XP_010227188.1|  PREDICTED: polyubiquitin isoform X1                358   5e-121   
gb|KJB62484.1|  hypothetical protein B456_009G418900                    354   5e-121   Gossypium raimondii
emb|CDP08567.1|  unnamed protein product                                359   6e-121   Coffea canephora [robusta coffee]
gb|ABY60454.1|  putative polyubiquitin                                  356   6e-121   Adonis aestivalis var. palaestina
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             361   6e-121   Phaseolus vulgaris [French bean]
ref|XP_003627152.1|  Ubiquitin                                          355   7e-121   
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             356   8e-121   
prf||1604470A  poly-ubiquitin                                           355   8e-121
ref|XP_003607668.1|  Multidrug resistance protein ABC transporter...    363   9e-121   
gb|ABD96088.1|  polyubiquitin                                           355   9e-121   Malus domestica [apple tree]
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          356   9e-121   Sorghum bicolor [broomcorn]
ref|XP_007014924.1|  Polyubiquitin 3                                    356   9e-121   Theobroma cacao [chocolate]
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            355   9e-121   Phaseolus vulgaris [French bean]
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             356   1e-120   
emb|CAC94926.1|  putative ubiquitin                                     354   1e-120   Pleurotus sp. 'Florida' [Florida oyster mushroom]
ref|XP_007512209.1|  polyubiquitin                                      358   1e-120   Bathycoccus prasinos
gb|EPS72031.1|  polyubiquitin                                           355   1e-120   Genlisea aurea
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                356   1e-120   Erythranthe guttata [common monkey flower]
dbj|BAJ85978.1|  predicted protein                                      356   1e-120   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      356   1e-120   Brassica rapa
gb|AFK43392.1|  unknown                                                 353   1e-120   Medicago truncatula
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    356   1e-120   Linum usitatissimum
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    353   1e-120   
emb|CAA40323.1|  polyubiquitin protein                                  357   1e-120   Helianthus annuus
gb|ACJ85643.1|  unknown                                                 353   1e-120   Medicago truncatula
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             356   1e-120   
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         356   1e-120   Jatropha curcas
gb|AGV54228.1|  polyubiquitin-like protein                              358   1e-120   Phaseolus vulgaris [French bean]
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           356   1e-120   Brassica rapa
gb|AES89865.2|  polyubiquitin 3                                         355   1e-120   Medicago truncatula
ref|NP_851029.1|  polyubiquitin 3                                       356   1e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             356   1e-120   
gb|AAQ84316.1|  fiber polyubiquitin                                     353   1e-120   Gossypium barbadense [Egyptian cotton]
gb|ABK94002.1|  unknown                                                 356   1e-120   Populus trichocarpa [western balsam poplar]
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           356   1e-120   Fragaria vesca subsp. vesca
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             356   2e-120   Citrus clementina [clementine]
emb|CDP08569.1|  unnamed protein product                                356   2e-120   Coffea canephora [robusta coffee]
emb|CAA48140.1|  ubiquitin                                              355   2e-120   Antirrhinum majus [garden snapdragon]
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             356   2e-120   Citrus clementina [clementine]
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      355   2e-120   Oryza brachyantha
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             355   2e-120   
emb|CBY46745.1|  polyubiquitin 10 protein                               356   2e-120   Lepidium appelianum [hairy whitetop]
emb|CAH59740.1|  polyubiquitin                                          355   2e-120   Plantago major [cart-track plant]
gb|AIS71924.1|  polyubiquitin                                           353   2e-120   Mangifera indica
gb|AES89866.2|  polyubiquitin 3                                         355   2e-120   Medicago truncatula
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      355   2e-120   Citrus sinensis [apfelsine]
gb|KJB81823.1|  hypothetical protein B456_013G163500                    355   2e-120   Gossypium raimondii
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             355   2e-120   Citrus clementina [clementine]
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      355   2e-120   Glycine max [soybeans]
ref|NP_849292.1|  polyubiquitin 14                                      355   2e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             355   2e-120   Capsella rubella
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           355   2e-120   Nelumbo nucifera [Indian lotus]
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  352   2e-120   Piloderma croceum F 1598
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             355   2e-120   
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         355   2e-120   Jatropha curcas
ref|XP_003590494.1|  Ubiquitin                                          356   2e-120   
gb|AIY27743.1|  polyubiquitin Ubi10                                     356   2e-120   Betula luminifera [liang ye hua]
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   352   2e-120   Piloderma croceum F 1598
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 352   2e-120   Dacryopinax primogenitus
ref|XP_006685644.1|  ubiquitin                                          352   2e-120   Yamadazyma tenuis ATCC 10573
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  352   2e-120   Hypholoma sublateritium FD-334 SS-4
ref|XP_011110054.1|  hypothetical protein H072_4094                     352   2e-120   
gb|ACD31680.1|  ubiquitin                                               355   2e-120   Gossypium hirsutum [American cotton]
ref|XP_006287868.1|  hypothetical protein CARUB_v10001095mg             358   3e-120   
gb|AAO43308.1|  putative polyubiquitin                                  353   3e-120   Arabidopsis thaliana [mouse-ear cress]
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  353   3e-120   Pisolithus microcarpus 441
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     352   3e-120   Rhodotorula toruloides
gb|AFW66439.1|  putative ubiquitin family protein                       355   3e-120   
emb|CAA54603.1|  pentameric polyubiquitin                               356   3e-120   Nicotiana tabacum [American tobacco]
gb|KJB14874.1|  hypothetical protein B456_002G147600                    356   3e-120   Gossypium raimondii
gb|KJB62487.1|  hypothetical protein B456_009G418900                    355   3e-120   Gossypium raimondii
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           359   4e-120   Eucalyptus grandis [rose gum]
gb|AAB95250.1|  ubiquitin                                               355   4e-120   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64530.1|  ubiquitin homolog                                       352   4e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         356   4e-120   
gb|KDB11907.1|  ubiquitin                                               355   4e-120   Ustilaginoidea virens
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            355   4e-120   Phaseolus vulgaris [French bean]
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           355   4e-120   Elaeis guineensis
ref|XP_003082269.1|  polyubiquitin (ISS)                                354   4e-120   
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   355   4e-120   Amanita muscaria Koide BX008
gb|AHC00631.1|  polyubiquitin                                           355   4e-120   Ganoderma lucidum
dbj|BAF00213.1|  polyubiquitin 4 UBQ4                                   356   4e-120   Arabidopsis thaliana [mouse-ear cress]
gb|AFY06654.1|  polyubiquitin                                           353   4e-120   Carica papaya [mamon]
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    355   5e-120   Phoenix dactylifera
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      354   5e-120   Camelina sativa [gold-of-pleasure]
emb|CEF99839.1|  Ubiquitin conserved site                               355   5e-120   Ostreococcus tauri
gb|AFW66438.1|  putative ubiquitin family protein                       356   6e-120   
gb|AGZ15412.1|  fiber polyubiquitin                                     351   7e-120   Phaseolus vulgaris [French bean]
gb|EWZ40370.1|  ubiquitin C                                             351   7e-120   Fusarium oxysporum Fo47
gb|KIY97324.1|  ubiquitin C                                             349   8e-120   Monoraphidium neglectum
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             351   8e-120   Selaginella moellendorffii
gb|AAO43309.1|  putative polyubiquitin                                  352   9e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001783045.1|  predicted protein                                  351   9e-120   
ref|XP_010454368.1|  PREDICTED: polyubiquitin 4-like                    356   1e-119   Camelina sativa [gold-of-pleasure]
ref|XP_002874006.1|  hypothetical protein ARALYDRAFT_488966             356   1e-119   
ref|XP_002508175.1|  ubiquitin                                          356   1e-119   Micromonas commoda
ref|XP_010911599.1|  PREDICTED: polyubiquitin 4                         356   1e-119   Elaeis guineensis
ref|XP_002872109.1|  predicted protein                                  356   1e-119   
ref|XP_001755431.1|  predicted protein                                  351   1e-119   
ref|XP_006381473.1|  polyubiquitin family protein                       353   1e-119   
ref|XP_010240636.1|  PREDICTED: polyubiquitin isoform X1                356   1e-119   
gb|KIY53974.1|  polyubiquitin                                           353   1e-119   Fistulina hepatica ATCC 64428
gb|ADO60140.1|  ubiquitin                                               350   1e-119   Beauveria bassiana
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  350   1e-119   Paxillus rubicundulus Ve08.2h10
gb|KII93501.1|  hypothetical protein PLICRDRAFT_694663                  355   1e-119   Plicaturopsis crispa FD-325 SS-3
gb|KIY45417.1|  ubiquitin                                               353   1e-119   Fistulina hepatica ATCC 64428
gb|KJB62485.1|  hypothetical protein B456_009G418900                    353   1e-119   Gossypium raimondii
ref|XP_006396612.1|  hypothetical protein EUTSA_v10028730mg             356   1e-119   Eutrema salsugineum [saltwater cress]
ref|NP_001105376.1|  polyubiquitin                                      356   1e-119   
ref|XP_001828882.1|  ubiquitin C                                        353   1e-119   Coprinopsis cinerea okayama7#130
sp|Q58G87.2|UBQ3_ORYSJ  RecName: Full=Polyubiquitin 3; Contains: ...    356   1e-119   Oryza sativa Japonica Group [Japonica rice]
emb|CCL99875.1|  predicted protein                                      353   1e-119   Fibroporia radiculosa
gb|EGO00904.1|  hypothetical protein SERLA73DRAFT_178893                353   1e-119   Serpula lacrymans var. lacrymans S7.3
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    353   1e-119   Populus euphratica
ref|NP_001174480.1|  Os05g0504766                                       356   1e-119   
gb|KIM67150.1|  hypothetical protein SCLCIDRAFT_1210637                 353   1e-119   Scleroderma citrinum Foug A
ref|XP_003030030.1|  polyubiquitin                                      353   1e-119   Schizophyllum commune H4-8
ref|XP_010558157.1|  PREDICTED: polyubiquitin-like                      356   1e-119   Tarenaya hassleriana [spider flower]
gb|KIJ45725.1|  hypothetical protein M422DRAFT_106821                   353   1e-119   Sphaerobolus stellatus SS14
gb|EYU33608.1|  hypothetical protein MIMGU_mgv1a004315mg                356   1e-119   Erythranthe guttata [common monkey flower]
gb|KJB81825.1|  hypothetical protein B456_013G163500                    356   1e-119   Gossypium raimondii
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      356   1e-119   Nicotiana sylvestris
gb|AAK68824.1|  Unknown protein                                         350   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002266370.1|  PREDICTED: polyubiquitin 4-like                    356   1e-119   Vitis vinifera
ref|XP_006302388.1|  hypothetical protein CARUB_v10020456mg             356   1e-119   Capsella rubella
gb|KEH31155.1|  polyubiquitin 3                                         356   1e-119   Medicago truncatula
gb|AAX40652.1|  polyubiquitin                                           356   1e-119   Oryza sativa Japonica Group [Japonica rice]
dbj|BAL61087.1|  polyubiquitin                                          350   1e-119   Dianthus caryophyllus [carnation]
gb|ACS68205.1|  ubiquitin 10.2                                          356   1e-119   Brassica napus [oilseed rape]
gb|AAB68045.1|  polyubiquitin                                           356   1e-119   Fragaria x ananassa
ref|XP_001555417.1|  polyubiquitin                                      353   2e-119   Botrytis cinerea B05.10
ref|XP_008020911.1|  hypothetical protein SETTUDRAFT_162442             353   2e-119   Exserohilum turcica Et28A
ref|NP_568397.1|  ubiquitin 4                                           356   2e-119   Arabidopsis thaliana [mouse-ear cress]
emb|CDP05795.1|  unnamed protein product                                356   2e-119   Coffea canephora [robusta coffee]
gb|KIR63773.1|  polyubiquitin                                           353   2e-119   Cryptococcus gattii CA1873
ref|XP_001598085.1|  polyubiquitin                                      353   2e-119   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_010421267.1|  PREDICTED: polyubiquitin 4-like                    356   2e-119   Camelina sativa [gold-of-pleasure]
gb|AAB95252.1|  ubiquitin                                               356   2e-119   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ85658.1|  unknown                                                 350   2e-119   Medicago truncatula
gb|ADD52202.1|  ubiquitin                                               356   2e-119   Catharanthus roseus [chatas]
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    356   2e-119   Nicotiana sylvestris
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      353   2e-119   Camelina sativa [gold-of-pleasure]
ref|XP_007366816.1|  polyubiquitin                                      353   2e-119   Dichomitus squalens LYAD-421 SS1
gb|AAY86773.1|  polyubiquitin                                           356   2e-119   Noccaea caerulescens
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      356   2e-119   Nelumbo nucifera [Indian lotus]
ref|NP_001148453.1|  LOC100282068                                       356   2e-119   Zea mays [maize]
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        356   2e-119   
emb|CBY46746.1|  polyubiquitin 10 protein                               356   2e-119   Lepidium campestre [bastard cress]
gb|KIR29996.1|  polyubiquitin                                           353   2e-119   Cryptococcus gattii VGII LA55
gb|EYU18102.1|  hypothetical protein MIMGU_mgv1a008166mg                356   2e-119   Erythranthe guttata [common monkey flower]
ref|NP_849300.4|  polyubiquitin 10                                      356   2e-119   Arabidopsis thaliana [mouse-ear cress]
gb|ABU40645.1|  polyubiquitin                                           356   2e-119   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010696408.1|  PREDICTED: polyubiquitin 4                         356   2e-119   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009596689.1|  PREDICTED: polyubiquitin-like                      356   2e-119   Nicotiana tomentosiformis
ref|XP_006428816.1|  hypothetical protein CICLE_v10011684mg             356   2e-119   
ref|XP_009591312.1|  PREDICTED: polyubiquitin 4                         356   2e-119   Nicotiana tomentosiformis
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   350   2e-119   Brassica rapa
gb|KDQ20365.1|  hypothetical protein BOTBODRAFT_123907                  353   2e-119   Botryobasidium botryosum FD-172 SS1
ref|XP_007339454.1|  ubiquitin                                          353   2e-119   
gb|KJB13592.1|  hypothetical protein B456_002G083000                    356   2e-119   Gossypium raimondii
ref|XP_001420612.1|  predicted protein                                  355   2e-119   Ostreococcus lucimarinus CCE9901
gb|AAB36545.1|  ubiquitin-like protein                                  357   2e-119   Phaseolus vulgaris [French bean]
ref|XP_007763327.1|  polyubiquitin                                      353   2e-119   Coniophora puteana RWD-64-598 SS2
ref|XP_001931824.1|  ubiquitin                                          350   2e-119   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      353   2e-119   Camelina sativa [gold-of-pleasure]
gb|KJB81824.1|  hypothetical protein B456_013G163500                    356   2e-119   Gossypium raimondii
gb|AAL09741.1|  AT4g05320/C17L7_240                                     355   2e-119   Arabidopsis thaliana [mouse-ear cress]
emb|CCT70325.1|  UBI4-Ubiquitin                                         352   2e-119   Fusarium fujikuroi IMI 58289
ref|XP_001764949.1|  predicted protein                                  353   2e-119   
emb|CEP60563.1|  LALA0S01e13784g1_1                                     350   2e-119   Lachancea lanzarotensis
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                356   3e-119   Pyrus x bretschneideri [bai li]
ref|XP_010270791.1|  PREDICTED: polyubiquitin-like                      355   3e-119   Nelumbo nucifera [Indian lotus]
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              350   3e-119   Pseudocercospora fijiensis CIRAD86
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  350   3e-119   Naumovozyma dairenensis CBS 421
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                355   3e-119   
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           352   3e-119   Nicotiana tomentosiformis
ref|NP_001053957.1|  Os04g0628100                                       355   3e-119   
ref|XP_719867.1|  hypothetical protein CaO19.6771                       349   4e-119   Candida albicans SC5314
gb|KIM48035.1|  hypothetical protein M413DRAFT_16078                    355   4e-119   Hebeloma cylindrosporum h7
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      355   4e-119   Nicotiana tomentosiformis
gb|AAQ07453.1|  ubiquitin                                               355   4e-119   Musa acuminata AAA Group [Cavendish banana]
gb|EMS65864.1|  Polyubiquitin                                           355   4e-119   Triticum urartu
gb|EPX74297.1|  ubiquitin                                               349   4e-119   Schizosaccharomyces octosporus yFS286
ref|XP_001797032.1|  hypothetical protein SNOG_06667                    349   4e-119   Parastagonospora nodorum SN15
ref|XP_010275241.1|  PREDICTED: polyubiquitin-like                      355   4e-119   Nelumbo nucifera [Indian lotus]
ref|XP_003052575.1|  predicted protein                                  352   4e-119   [Nectria] haematococca mpVI 77-13-4
gb|KJB62483.1|  hypothetical protein B456_009G418900                    355   5e-119   Gossypium raimondii
ref|XP_002980153.1|  hypothetical protein SELMODRAFT_271419             352   5e-119   
emb|CAB81074.1|  polyubiquitin (ubq10)                                  357   5e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493589.1|  PREDICTED: polyubiquitin-like                      356   5e-119   Camelina sativa [gold-of-pleasure]
dbj|GAK65396.1|  ubiquitin                                              353   6e-119   Moesziomyces antarcticus
ref|XP_001755307.1|  predicted protein                                  352   6e-119   
ref|XP_002953480.1|  polyubiquitin                                      352   6e-119   Volvox carteri f. nagariensis
gb|AAN31845.1|  putative polyubiquitin (UBQ10)                          357   7e-119   Arabidopsis thaliana [mouse-ear cress]
gb|ACX46987.1|  ubiquitin                                               356   7e-119   Guzmania wittmackii x Guzmania lingulata
ref|XP_006372519.1|  polyubiquitin family protein                       351   7e-119   Populus trichocarpa [western balsam poplar]
gb|EMS60894.1|  Polyubiquitin                                           357   9e-119   Triticum urartu
emb|CBY16339.1|  unnamed protein product                                347   9e-119   Oikopleura dioica
gb|AFK47245.1|  unknown                                                 348   1e-118   Medicago truncatula
ref|XP_002551324.1|  ubiquitin                                          351   1e-118   Candida tropicalis MYA-3404
ref|XP_009784908.1|  PREDICTED: polyubiquitin-like isoform X2           356   1e-118   Nicotiana sylvestris
gb|AIS40894.1|  polyubiquitin                                           357   1e-118   Kalanchoe fedtschenkoi [lavender-scallops]
gb|KIM22018.1|  hypothetical protein M408DRAFT_333137                   348   1e-118   Serendipita vermifera MAFF 305830
ref|XP_003010029.1|  polyubiquitin UbiD/Ubi4, putative                  348   1e-118   Trichophyton benhamiae CBS 112371
ref|XP_001830230.1|  ubiquitin                                          351   1e-118   Coprinopsis cinerea okayama7#130
gb|KII92029.1|  hypothetical protein PLICRDRAFT_172184                  354   1e-118   Plicaturopsis crispa FD-325 SS-3
gb|EUC59758.1|  polyubiquitin                                           353   1e-118   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_004956019.1|  PREDICTED: polyubiquitin 4-like                    353   1e-118   Setaria italica
ref|XP_007211609.1|  hypothetical protein PRUPE_ppa005507mg             356   1e-118   Prunus persica
ref|XP_010324326.1|  PREDICTED: polyubiquitin isoform X1                356   1e-118   
ref|XP_008345409.1|  PREDICTED: polyubiquitin-like                      356   1e-118   
dbj|BAK03691.1|  predicted protein                                      356   1e-118   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP42860.1|  hypothetical protein JCGZ_23802                         356   1e-118   Jatropha curcas
gb|EGO00841.1|  hypothetical protein SERLA73DRAFT_121253                353   1e-118   Serpula lacrymans var. lacrymans S7.3
gb|KIK17147.1|  hypothetical protein PISMIDRAFT_685607                  353   1e-118   Pisolithus microcarpus 441
ref|XP_001880135.1|  ubiquitin                                          353   1e-118   Laccaria bicolor S238N-H82
ref|XP_002452705.1|  hypothetical protein SORBIDRAFT_04g031060          356   1e-118   Sorghum bicolor [broomcorn]
gb|KDQ30621.1|  hypothetical protein PLEOSDRAFT_1088454                 353   1e-118   Pleurotus ostreatus PC15
gb|AFR98116.1|  polyubiquitin                                           353   1e-118   Cryptococcus neoformans var. grubii H99
gb|EYU33607.1|  hypothetical protein MIMGU_mgv1a004315mg                356   1e-118   Erythranthe guttata [common monkey flower]
ref|XP_004953565.1|  PREDICTED: polyubiquitin-like                      356   1e-118   Setaria italica
ref|XP_011094650.1|  PREDICTED: polyubiquitin                           356   2e-118   Sesamum indicum [beniseed]
ref|XP_001210780.1|  ubiquitin                                          350   2e-118   Aspergillus terreus NIH2624
ref|XP_010423744.1|  PREDICTED: polyubiquitin                           356   2e-118   Camelina sativa [gold-of-pleasure]
gb|KDR85168.1|  hypothetical protein GALMADRAFT_131895                  353   2e-118   Galerina marginata CBS 339.88
gb|EJU00136.1|  ubiquitin                                               353   2e-118   Dacryopinax primogenitus
gb|AAC16012.1|  polyubiquitin                                           356   2e-118   Elaeagnus umbellata [aki-gumi]
gb|EKV13151.1|  hypothetical protein PDIG_39650                         351   2e-118   Penicillium digitatum PHI26
ref|XP_007316637.1|  hypothetical protein SERLADRAFT_368035             353   2e-118   Serpula lacrymans var. lacrymans S7.9
gb|AAD03343.1|  ubiquitin                                               356   2e-118   Pisum sativum [garden pea]
dbj|BAP70433.1|  Ubiquitin                                              350   2e-118   Kluyveromyces marxianus
gb|KIW56414.1|  polyubiquitin                                           350   2e-118   Exophiala xenobiotica
ref|XP_010431529.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    356   2e-118   Camelina sativa [gold-of-pleasure]
gb|KIM40192.1|  hypothetical protein M413DRAFT_73842                    353   2e-118   
ref|XP_003196661.1|  ATP-dependent protein binding protein              353   2e-118   
emb|CAA40324.1|  hexaubiquitin protein                                  356   2e-118   
ref|XP_010436682.1|  PREDICTED: polyubiquitin 4-like                    356   2e-118   
dbj|BAK02501.1|  predicted protein                                      356   2e-118   
gb|KJB81827.1|  hypothetical protein B456_013G163500                    356   2e-118   
ref|XP_009784905.1|  PREDICTED: polyubiquitin-like isoform X1           356   2e-118   
ref|XP_010262389.1|  PREDICTED: polyubiquitin                           356   2e-118   
ref|XP_002891806.1|  predicted protein                                  353   2e-118   
gb|AAV65292.1|  polyubiquitin                                           350   2e-118   
ref|NP_849299.4|  polyubiquitin 10                                      356   2e-118   
ref|XP_003542730.1|  PREDICTED: polyubiquitin 10-like                   356   2e-118   
gb|AAB95251.1|  ubiquitin                                               356   2e-118   
ref|XP_007049060.1|  Polyubiquitin 10                                   356   2e-118   
gb|EEH07231.1|  ubiquitin                                               350   2e-118   
gb|EEQ88150.1|  ubiquitin                                               350   2e-118   
ref|XP_006428817.1|  hypothetical protein CICLE_v10011684mg             356   2e-118   
ref|NP_001045980.1|  Os02g0161900                                       356   2e-118   
ref|XP_001227036.1|  polyubiquitin                                      350   2e-118   
ref|XP_002839703.1|  hypothetical protein                               350   2e-118   
ref|XP_001266981.1|  polyubiquitin (UbiD), putative                     350   2e-118   
gb|AAO43310.1|  putative polyubiquitin                                  348   2e-118   
ref|XP_007154492.1|  hypothetical protein PHAVU_003G123400g             352   2e-118   
ref|XP_008350368.1|  PREDICTED: polyubiquitin                           356   2e-118   
gb|KIK81924.1|  hypothetical protein PAXRUDRAFT_736824                  348   2e-118   
gb|KJB13590.1|  hypothetical protein B456_002G083000                    356   2e-118   
gb|AAC67552.1|  polyubiquitin                                           353   2e-118   
ref|XP_011094250.1|  PREDICTED: polyubiquitin-like                      356   2e-118   
gb|EEH20847.2|  polyubiquitin                                           350   2e-118   
gb|ACN40936.1|  unknown                                                 356   2e-118   
ref|XP_003350608.1|  hypothetical protein SMAC_07925                    347   2e-118   
dbj|BAJ91912.1|  predicted protein                                      355   2e-118   
gb|EPS29015.1|  hypothetical protein PDE_03961                          350   2e-118   
ref|XP_007864655.1|  ubiquitin                                          353   2e-118   
gb|KEZ40313.1|  Polyubiquitin                                           350   2e-118   
ref|XP_010756991.1|  polyubiquitin                                      350   2e-118   
ref|XP_002419618.1|  ubiquitin, putative                                350   2e-118   
ref|XP_659604.1|  hypothetical protein AN2000.2                         351   2e-118   
gb|KIJ68260.1|  hypothetical protein HYDPIDRAFT_173033                  353   2e-118   
sp|P0CG73.1|UBI1P_CANAX  RecName: Full=Polyubiquitin; Contains: R...    347   2e-118   
ref|XP_002494205.1|  Ubiquitin                                          350   2e-118   
ref|XP_002888365.1|  polyubiquitin                                      355   3e-118   
gb|AGT38457.1|  polyubiquitin                                           356   3e-118   
gb|AAO43306.1|  putative polyubiquitin                                  351   3e-118   
ref|XP_010537590.1|  PREDICTED: polyubiquitin 11                        347   3e-118   
gb|EGA57707.1|  Ubi4p                                                   348   3e-118   
gb|AFD53810.1|  ubiquitin                                               348   3e-118   
ref|XP_008244357.1|  PREDICTED: polyubiquitin isoform X1                355   3e-118   
emb|CCG34086.1|  Polyubiquitin                                          350   3e-118   
ref|XP_002791169.1|  ubiquitin                                          350   3e-118   
ref|XP_011038259.1|  PREDICTED: polyubiquitin-like                      350   3e-118   
gb|AAA82978.1|  polyubiquitin                                           352   3e-118   
tpe|CBF85986.1|  TPA: Polyubiquitin Fragment [Source:UniProtKB/Tr...    350   4e-118   
gb|EZF98642.1|  polyubiquitin                                           347   4e-118   
ref|XP_011037020.1|  PREDICTED: polyubiquitin-like                      352   4e-118   
ref|XP_008796191.1|  PREDICTED: polyubiquitin-like                      350   4e-118   
tpd|FAA00317.1|  TPA: polyubiquitin                                     349   4e-118   
gb|AFW70219.1|  polyubiquitin-like protein                              356   4e-118   
emb|CCO30833.1|  Polyubiquitin                                          353   4e-118   
gb|AEH41483.1|  ubiquitin                                               349   4e-118   
gb|KJB62482.1|  hypothetical protein B456_009G418900                    352   4e-118   
ref|XP_002888394.1|  hexaubiquitin protein                              356   5e-118   
ref|XP_010046742.1|  PREDICTED: polyubiquitin-like                      355   5e-118   
ref|XP_008441422.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    355   5e-118   
ref|XP_002976481.1|  hypothetical protein SELMODRAFT_271198             352   5e-118   
emb|CDH08450.1|  ubiquitin and ubiquitin-like proteins                  349   6e-118   
ref|XP_001246797.1|  polyubiquitin                                      349   6e-118   
ref|XP_002842034.1|  hypothetical protein                               349   6e-118   
gb|KIM30634.1|  hypothetical protein M408DRAFT_328170                   346   6e-118   
ref|XP_002992907.1|  hypothetical protein SELMODRAFT_162680             352   6e-118   
gb|AAP80689.1|  polyubiquitin                                           347   6e-118   
gb|ACB87916.1|  polyubiquitin 1                                         345   7e-118   
dbj|BAK61738.1|  ubiquitin                                              345   7e-118   
dbj|GAA87419.1|  polyubiquitin                                          349   7e-118   
ref|XP_001538486.1|  polyubiquitin                                      349   7e-118   
ref|XP_007808982.1|  ubiquitin                                          350   8e-118   
ref|XP_001777816.1|  predicted protein                                  351   9e-118   
dbj|BAL61084.1|  polyubiqutin                                           351   9e-118   
gb|KHJ83418.1|  ubiquitin family protein                                345   9e-118   
gb|AGM32540.1|  polyubiquitin-B-like isoform                            347   1e-117   
ref|XP_003607667.1|  Multidrug resistance protein ABC transporter...    363   1e-117   
ref|XP_005644220.1|  polyubiquitin                                      348   1e-117   
ref|XP_006694532.1|  hypothetical protein CTHT_0041260                  348   1e-117   
emb|CAA52290.1|  polyubiquitin                                          351   1e-117   
ref|XP_958803.1|  ubiquitin                                             348   1e-117   
ref|XP_003843815.1|  hypothetical protein LEMA_P014660.1                352   1e-117   
gb|KIY97628.1|  ubiquitin C                                             348   1e-117   
gb|KJB62486.1|  hypothetical protein B456_009G418900                    351   1e-117   
ref|XP_004341200.1|  polyubiquitin, putative                            345   1e-117   
ref|XP_004249885.1|  PREDICTED: polyubiquitin-like                      356   1e-117   
ref|XP_010451655.1|  PREDICTED: polyubiquitin 4-like                    356   1e-117   
gb|AAC49013.1|  polyubiquitin containing 7 ubiquitin monomers           356   1e-117   
gb|ABD32351.2|  Ubiquitin                                               356   1e-117   
tpd|FAA00319.1|  TPA: polyubiquitin                                     353   1e-117   
gb|AFW66445.1|  ubiquitin2                                              356   1e-117   
emb|CCA16073.1|  polyubiquitin putative                                 356   1e-117   
ref|XP_011388891.1|  putative ubiquitin                                 353   1e-117   
ref|XP_007545871.1|  PREDICTED: polyubiquitin-B isoform X2              346   1e-117   
emb|CAA51679.1|  ubiquitin                                              356   1e-117   
gb|EYU33611.1|  hypothetical protein MIMGU_mgv1a004315mg                356   1e-117   
ref|XP_007410937.1|  hypothetical protein MELLADRAFT_87680              356   1e-117   
gb|AAY33920.2|  polyubiquitin                                           351   1e-117   
gb|EMS24129.1|  ubiquitin C                                             345   2e-117   
ref|XP_004505453.1|  PREDICTED: polyubiquitin-A-like                    356   2e-117   
ref|XP_003675939.1|  hypothetical protein NCAS_0C05850                  351   2e-117   
ref|XP_009618235.1|  PREDICTED: polyubiquitin-like isoform X1           357   2e-117   
dbj|GAA27344.2|  polyubiquitin-A                                        347   2e-117   
ref|XP_009150698.1|  PREDICTED: polyubiquitin                           356   2e-117   
gb|EYU18101.1|  hypothetical protein MIMGU_mgv1a004289mg                356   2e-117   
ref|XP_567862.1|  ATP-dependent protein binding protein                 353   2e-117   
ref|XP_007861169.1|  polyubiquitin                                      353   2e-117   
gb|KFY10578.1|  hypothetical protein V492_04946                         352   2e-117   
ref|XP_008034069.1|  ubiquitin 10.1                                     353   2e-117   
ref|XP_003607670.1|  Ubiquitin                                          356   2e-117   
ref|XP_008645269.1|  PREDICTED: polyubiquitin                           356   2e-117   
ref|XP_003608276.1|  Ubiquitin                                          356   2e-117   
gb|AAF04147.1|  ubiquitin precursor                                     351   2e-117   
ref|XP_003542728.1|  PREDICTED: polyubiquitin-A-like isoform 1          356   2e-117   
ref|XP_003627151.1|  Ubiquitin                                          356   2e-117   
ref|XP_002267017.1|  PREDICTED: polyubiquitin-like                      356   2e-117   
ref|XP_007307433.1|  polyubiquitin                                      353   2e-117   
ref|XP_010553005.1|  PREDICTED: polyubiquitin-like                      356   2e-117   
dbj|GAA55031.1|  ubiquitin C                                            345   2e-117   
emb|CAN71997.1|  hypothetical protein VITISV_004025                     356   2e-117   
gb|EYU38681.1|  hypothetical protein MIMGU_mgv1a004304mg                356   2e-117   
ref|XP_006350990.1|  PREDICTED: polyubiquitin-A-like                    356   2e-117   
tpd|FAA00316.1|  TPA: polyubiquitin                                     350   2e-117   
ref|NP_013061.1|  ubiquitin                                             350   2e-117   
emb|CAX71218.1|  polyubiquitin                                          343   2e-117   
ref|XP_006480550.1|  PREDICTED: polyubiquitin-A-like                    356   2e-117   
gb|ELR08709.1|  polyubiquitin                                           350   2e-117   
ref|XP_453980.1|  hypothetical protein                                  350   2e-117   
gb|AGM32487.1|  polyubiquitin-B-like isoform 1                          345   2e-117   
ref|NP_983342.1|  ACL062Cp                                              350   2e-117   
gb|AEZ66647.1|  putative beta-1,6-glucanase                             350   2e-117   
gb|KFY77115.1|  hypothetical protein V499_03430                         350   2e-117   
ref|XP_002627625.1|  ubiquitin                                          350   2e-117   
gb|ETN78467.1|  ubiquitin family protein                                345   2e-117   
ref|XP_011275993.1|  ubiquitin C                                        350   2e-117   
ref|XP_008243902.1|  PREDICTED: polyubiquitin-like isoform X1           355   2e-117   
ref|NP_595409.1|  ubiquitin                                             350   2e-117   
dbj|BAH71115.1|  ACYPI006410                                            345   2e-117   
gb|AAL91103.1|  ubiquitin                                               346   3e-117   
emb|CCA40372.1|  Ubiquitin cross-reactive protein                       350   3e-117   
gb|KDR10312.1|  Ubiquitin                                               345   3e-117   
ref|XP_003402310.1|  PREDICTED: polyubiquitin-B-like isoform 1          345   3e-117   
gb|AAO43305.1|  putative polyubiquitin                                  348   3e-117   
dbj|BAO38900.1|  ubiquitin                                              350   3e-117   
ref|XP_002171731.1|  ubiquitin                                          350   3e-117   
gb|AAO43304.1|  putative polyubiquitin                                  348   3e-117   
gb|EYC42800.1|  hypothetical protein Y032_0517g2809                     345   3e-117   
emb|CDI53149.1|  probable Polyubiquitin protein                         347   3e-117   
dbj|BAN21697.1|  ubiquitin                                              343   3e-117   
gb|AAO43303.1|  putative polyubiquitin                                  348   3e-117   
ref|XP_001766873.1|  predicted protein                                  348   4e-117   
pir||T02358  ubiquitin homolog T8F5.13 - Arabidopsis thaliana           348   4e-117
ref|XP_002553736.1|  KLTH0E05852p                                       351   4e-117   
tpg|DAA34466.1|  TPA: ubiquitin                                         343   4e-117   
ref|XP_011203306.1|  PREDICTED: polyubiquitin-B                         343   5e-117   
ref|XP_002083532.1|  GD13313                                            343   5e-117   
gb|KDQ63803.1|  hypothetical protein JAAARDRAFT_29850                   352   5e-117   
ref|XP_011278194.1|  PREDICTED: polyubiquitin-B-like                    342   5e-117   
ref|NP_176714.4|  ubiquitin 13                                          347   6e-117   
gb|ACB87918.1|  polyubiquitin 3                                         342   6e-117   
gb|ADD24466.1|  Ubiquitin                                               343   6e-117   
dbj|BAK61744.1|  ubiquitin                                              343   7e-117   
gb|EXX74853.1|  ubiquitin                                               342   7e-117   
gb|AGH70140.1|  ubiquitin family protein                                342   7e-117   
ref|XP_002973843.1|  hypothetical protein SELMODRAFT_173723             352   7e-117   
gb|ABV22331.1|  ubiquitin                                               346   8e-117   
ref|XP_001774326.1|  predicted protein                                  352   8e-117   
ref|XP_003607659.1|  Ubiquitin                                          344   8e-117   
ref|XP_008632241.1|  PREDICTED: polyubiquitin-C isoform X10             342   9e-117   
gb|EGE85556.1|  hypothetical protein BDDG_08501                         347   9e-117   
sp|P0CH27.1|RL402_TRYCR  RecName: Full=Ubiquitin-60S ribosomal pr...    348   1e-116   
tpg|DAA34473.1|  TPA: ubiquitin                                         343   1e-116   
gb|AAC13691.1|  poly-ubiquitin                                          348   1e-116   
gb|AES89856.2|  polyubiquitin 3                                         343   1e-116   
ref|XP_003331105.1|  polyubiquitin-A                                    356   1e-116   
gb|KIZ01427.1|  ubiquitin C                                             348   1e-116   
gb|EMS54972.1|  Polyubiquitin-A                                         358   1e-116   
ref|XP_006352490.1|  PREDICTED: polyubiquitin-A-like isoform X1         356   1e-116   
ref|XP_008510526.1|  PREDICTED: polyubiquitin-B                         347   1e-116   
ref|XP_009620669.1|  PREDICTED: polyubiquitin-like                      356   1e-116   
ref|XP_009609090.1|  PREDICTED: polyubiquitin 11                        340   2e-116   
emb|CEL52635.1|  Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-...    353   2e-116   
gb|ACH45547.1|  putative ubiquitin C variant 1                          342   2e-116   
gb|ABO84843.1|  ubiquitin B                                             342   2e-116   
gb|AAL91109.1|  ubiquitin                                               345   2e-116   
gb|KHN45015.1|  Polyubiquitin-A                                         356   2e-116   
emb|CAJ41447.1|  polyubiquitin                                          345   2e-116   
ref|XP_004365491.1|  polyubiquitin 5                                    342   2e-116   
ref|XP_626192.1|  polyubiquitin with 3 Ub domains                       343   2e-116   
ref|XP_011302492.1|  PREDICTED: polyubiquitin-B                         345   2e-116   
ref|XP_008426285.1|  PREDICTED: polyubiquitin-B isoform X1              343   2e-116   
gb|ABI53721.1|  polyubiquitin                                           350   2e-116   
gb|EJD76734.1|  polyubiquitin, variant 2                                346   2e-116   
ref|XP_011094688.1|  PREDICTED: polyubiquitin-like                      356   2e-116   
ref|XP_460488.1|  DEHA2F02816p                                          350   2e-116   
gb|ABD78847.1|  ubiquitin C II                                          344   2e-116   
emb|CAA30815.1|  unnamed protein product                                342   2e-116   
ref|XP_008161896.1|  PREDICTED: polyubiquitin-C                         342   2e-116   
ref|XP_001486573.1|  ubiquitin                                          350   2e-116   
ref|XP_005831810.1|  ubiquitin                                          342   2e-116   
gb|ACL98140.1|  ubiquitin C variant                                     343   2e-116   
ref|XP_002498336.1|  ZYRO0G07854p                                       350   2e-116   
ref|XP_002723083.2|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    343   3e-116   
dbj|BAK61751.1|  ubiquitin                                              342   3e-116   
gb|KIJ26545.1|  hypothetical protein M422DRAFT_216245                   354   3e-116   
ref|XP_005525793.1|  PREDICTED: polyubiquitin-C-like isoform X2         342   3e-116   
gb|KHN74847.1|  Polyubiquitin-A                                         348   3e-116   
gb|EXX74854.1|  ubiquitin                                               341   3e-116   
ref|XP_003290908.1|  ubiquitin                                          342   3e-116   
gb|EFN76024.1|  Ubiquitin                                               342   3e-116   
gb|AAA28997.1|  ubiquitin                                               342   3e-116   
ref|XP_010177726.1|  PREDICTED: polyubiquitin-B isoform X5              343   3e-116   
ref|XP_010480024.1|  PREDICTED: polyubiquitin-like                      345   3e-116   
ref|XP_009901570.1|  PREDICTED: polyubiquitin-B isoform X1              342   3e-116   
ref|XP_008330590.1|  PREDICTED: polyubiquitin-B isoform X2              342   3e-116   
ref|NP_001133175.1|  polyubiquitin                                      342   3e-116   
emb|CAX72428.1|  ubiquitin C                                            342   3e-116   



>ref|XP_003619702.1| Ubiquitin-like protein [Medicago truncatula]
Length=245

 Score =   360 bits (924),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 181/187 (97%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +2

Query  26   RHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  205
            +H     KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  44   QHRSFQFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  103

Query  206  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  385
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  104  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  163

Query  386  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  565
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  164  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  223

Query  566  DTIDNVK  586
            DTIDNVK
Sbjct  224  DTIDNVK  230


 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 119/129 (92%), Gaps = 5/129 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  117  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  171

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  172  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  231

Query  362  KIQDKEGIP  388
            KIQDKEGIP
Sbjct  232  KIQDKEGIP  240



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   360 bits (923),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/186 (98%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  29   HSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  208
            HS    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  34   HSFKPFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  93

Query  209  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  388
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  94   RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  153

Query  389  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  568
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD
Sbjct  154  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  213

Query  569  TIDNVK  586
            TIDNVK
Sbjct  214  TIDNVK  219


 Score =   304 bits (779),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  106  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  160

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  161  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  220

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  221  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  269



>gb|ACA58351.1| ubiquitin-like protein [Sandersonia aurantiaca]
Length=189

 Score =   356 bits (913),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 119/129 (92%), Gaps = 5/129 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIP  388
            KIQDKEGIP
Sbjct  181  KIQDKEGIP  189



>gb|AFC36452.1| ubiquitin, partial [Anoectochilus roxburghii]
Length=214

 Score =   357 bits (915),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  21   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  75

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  76   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  135

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  136  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  195

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  196  ITLEVESSDTIDNVK  210


 Score =   267 bits (683),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/134 (100%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = +2

Query  185  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  364
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK
Sbjct  1    AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  60

Query  365  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI  544
            IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI
Sbjct  61   IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI  120

Query  545  TLEVESSDTIDNVK  586
            TLEVESSDTIDNVK
Sbjct  121  TLEVESSDTIDNVK  134


 Score =   211 bits (538),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 113/123 (92%), Gaps = 5/123 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  97   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  151

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  152  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  211

Query  362  KIQ  370
            KI+
Sbjct  212  KIR  214



>gb|ABI84246.1| polyubiquitin 10 [Arachis hypogaea]
Length=192

 Score =   355 bits (912),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   233 bits (595),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 122/132 (92%), Gaps = 5/132 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQ  397
            KIQDKEGIPPDQ
Sbjct  181  KIQDKEGIPPDQ  192



>emb|CBI22349.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   359 bits (922),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 185/195 (95%), Gaps = 1/195 (1%)
 Frame = +2

Query  5    LNLFYH-LRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            L LF   L H     KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  12   LALFVSVLVHQPFPFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  71

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  72   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  131

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  132  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  191

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  192  ITLEVESSDTIDNVK  206


 Score =   356 bits (913),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  93   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  147

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  148  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  207

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  208  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  267

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  268  ITLEVESSDTIDNVK  282


 Score =   221 bits (563),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 118/128 (92%), Gaps = 5/128 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  169  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  223

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  224  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  283

Query  362  KIQDKEGI  385
            KIQDKEG+
Sbjct  284  KIQDKEGM  291



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   359 bits (922),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   358 bits (920),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 116/126 (92%), Gaps = 5/126 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKE  379
            KIQDK+
Sbjct  257  KIQDKK  262



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   358 bits (919),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 182/186 (98%), Positives = 182/186 (98%), Gaps = 2/186 (1%)
 Frame = +2

Query  35   CSYL--KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  208
            C  L  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  14   CGRLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  73

Query  209  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  388
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  74   RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  133

Query  389  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  568
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD
Sbjct  134  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  193

Query  569  TIDNVK  586
            TIDNVK
Sbjct  194  TIDNVK  199


 Score =   354 bits (909),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  86   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  140

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  200

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  201  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  260

Query  542  ITLEVESSDTIDNVK  586
            ITLEV SSDTIDNVK
Sbjct  261  ITLEVASSDTIDNVK  275


 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 114/125 (91%), Gaps = 5/125 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  162  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV SSDTIDNVKA
Sbjct  217  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVASSDTIDNVKA  276

Query  362  KIQDK  376
            KIQDK
Sbjct  277  KIQDK  281



>gb|AFW66442.1| putative ubiquitin family protein, partial [Zea mays]
Length=216

 Score =   355 bits (912),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   282 bits (722),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 146/156 (94%), Gaps = 5/156 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  469
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   355 bits (912),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   301 bits (771),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 156/166 (94%), Gaps = 5/166 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  499
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  226



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   355 bits (912),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   355 bits (912),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_007154494.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26488.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=193

 Score =   354 bits (908),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  179


 Score =   234 bits (596),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 123/133 (92%), Gaps = 5/133 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQ  400
            KIQDKEGIPPDQQ
Sbjct  181  KIQDKEGIPPDQQ  193



>gb|AFP44113.1| ubiquitin, partial [Lycoris longituba]
Length=187

 Score =   353 bits (907),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  63

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  64   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  123

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIDNVK
Sbjct  124  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDTIDNVK  182


 Score =   213 bits (543),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 113/124 (91%), Gaps = 5/124 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  69   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  123

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIDNVKA
Sbjct  124  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDTIDNVKA  183

Query  362  KIQD  373
            KIQD
Sbjct  184  KIQD  187


 Score =   212 bits (539),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/106 (100%), Positives = 106/106 (100%), Gaps = 0/106 (0%)
 Frame = +2

Query  269  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  448
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  449  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  61   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  106



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   355 bits (911),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (785),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  229



>ref|XP_009412006.1| PREDICTED: polyubiquitin 11-like [Musa acuminata subsp. malaccensis]
Length=231

 Score =   355 bits (911),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/180 (99%), Positives = 180/180 (100%), Gaps = 0/180 (0%)
 Frame = +2

Query  44   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  223
            ++MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  1    MQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  60

Query  224  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  403
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  61   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  120

Query  404  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  583
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  121  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  180


 Score =   272 bits (696),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 145/168 (86%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  68   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  122

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  
Sbjct  123  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVXX  182

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
                       QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  183  XXXXXXXXXXXQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  230


 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/103 (100%), Positives = 103/103 (100%), Gaps = 0/103 (0%)
 Frame = +2

Query  278  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  457
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  62

Query  458  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  63   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  105



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   355 bits (911),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   307 bits (786),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  229



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   355 bits (911),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   301 bits (772),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  181  KIQDKEGIPLDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_010931017.1| PREDICTED: polyubiquitin 11 isoform X1 [Elaeis guineensis]
 ref|XP_010931026.1| PREDICTED: polyubiquitin 11 isoform X2 [Elaeis guineensis]
 ref|XP_010923942.1| PREDICTED: polyubiquitin 11 [Elaeis guineensis]
Length=229

 Score =   355 bits (911),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   308 bits (789),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   355 bits (911),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   356 bits (913),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  10   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  64

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  65   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  124

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  125  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  184

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  185  ITLEVESSDTIDNVK  199


 Score =   306 bits (783),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  86   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  140

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  200

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  201  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  248


 Score =   245 bits (626),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  218  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  397
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  398  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  577
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  578  NVK  586
            NVK
Sbjct  121  NVK  123



>ref|XP_006288299.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21197.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=230

 Score =   355 bits (911),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_002317213.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ABK95814.1| unknown [Populus trichocarpa]
 gb|EEE97825.1| polyubiquitin family protein [Populus trichocarpa]
Length=229

 Score =   355 bits (911),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  229



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   355 bits (910),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AAP31578.1| ubiquitin [Hevea brasiliensis]
Length=230

 Score =   355 bits (910),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   355 bits (910),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   305 bits (782),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>emb|CAH59739.1| polyubiquitin [Plantago major]
Length=232

 Score =   355 bits (911),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   307 bits (787),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 160/172 (93%), Gaps = 5/172 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  517
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+  F
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGLTGF  232



>ref|XP_003570150.1| PREDICTED: polyubiquitin 11 isoform X2 [Brachypodium distachyon]
Length=241

 Score =   355 bits (911),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|NP_567286.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_849291.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001031585.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_567247.2| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118936.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_002305607.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006370636.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_007157173.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 ref|XP_007211604.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211605.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211608.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008349294.1| PREDICTED: polyubiquitin 11 [Malus domestica]
 ref|XP_010437606.1| PREDICTED: polyubiquitin 11 isoform X1 [Camelina sativa]
 ref|XP_010437607.1| PREDICTED: polyubiquitin 11 isoform X2 [Camelina sativa]
 ref|XP_010491428.1| PREDICTED: polyubiquitin 11 [Camelina sativa]
 sp|P0CH33.1|UBQ11_ARATH RecName: Full=Polyubiquitin 11; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD48980.1|AF162444_12 contains similarity to Pfam family PF00240 - Ubiquitin family; 
score=526.5, E=1.9e-154, N=3 [Arabidopsis thaliana]
 emb|CAA10056.1| polyubiquitin [Vicia faba]
 emb|CAB81047.1| AT4g05050 [Arabidopsis thaliana]
 emb|CAC27335.1| putative polyubiquitin [Picea abies]
 gb|AAK96565.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL06940.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL09770.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAM19968.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAN65052.1| Unknown protein [Arabidopsis thaliana]
 gb|AAV92464.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92465.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92466.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92467.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92468.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92469.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92470.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92471.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92472.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92473.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92474.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92475.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92476.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92477.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92478.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92479.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92480.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92481.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92482.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92483.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92484.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92485.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92486.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92487.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92488.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92489.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92490.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 dbj|BAE98552.1| hypothetical protein [Arabidopsis thaliana]
 gb|EEE86118.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|AEE82244.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82245.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82468.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82469.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82470.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFP43343.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12803.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12804.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12807.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|AGV54265.1| ubiquitin 11 [Phaseolus vulgaris]
 gb|ERP67205.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESW29167.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 gb|AES82698.2| polyubiquitin 3 [Medicago truncatula]
 gb|AJA29686.1| polyubiquitin Ubi4 [Betula luminifera]
 gb|KJB67136.1| hypothetical protein B456_010G177000 [Gossypium raimondii]
 gb|KJB69250.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69251.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69252.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=229

 Score =   355 bits (910),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   357 bits (915),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 180/181 (99%), Positives = 181/181 (100%), Gaps = 0/181 (0%)
 Frame = +2

Query  44   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  223
            +KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  47   IKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  106

Query  224  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  403
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  107  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  166

Query  404  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  583
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  167  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  226

Query  584  K  586
            K
Sbjct  227  K  227


 Score =   305 bits (781),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  114  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  168

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  169  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  228

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  229  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  277



>gb|KDO51109.1| hypothetical protein CISIN_1g026973mg [Citrus sinensis]
Length=230

 Score =   355 bits (910),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   356 bits (913),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   353 bits (905),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 183/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT TGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTXTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLE ESSDTIDNVK
Sbjct  241  ITLEXESSDTIDNVK  255


 Score =   205 bits (522),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 109/121 (90%), Gaps = 5/121 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT TGKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTXTGKTITLEXESSDTIDNVKA  256

Query  362  K  364
            K
Sbjct  257  K  257



>ref|XP_006428822.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
 ref|XP_006480632.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 ref|XP_006480634.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 gb|ESR42062.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
Length=230

 Score =   355 bits (910),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   304 bits (778),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 157/168 (93%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGR LADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRNLADYNIQKESTLHLVLRLRGG  228



>gb|KDO51955.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
 gb|KDO51956.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
Length=230

 Score =   355 bits (910),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   305 bits (782),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_002438839.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
 gb|EER90206.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
Length=229

 Score =   355 bits (910),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   304 bits (778),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK+STLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKDSTLHLVLRLRGG  228



>ref|XP_007205619.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06818.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=232

 Score =   355 bits (910),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   298 bits (762),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/165 (92%), Positives = 154/165 (93%), Gaps = 5/165 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  496
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR 
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRF  225



>ref|XP_006428779.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 ref|XP_006594132.1| PREDICTED: polyubiquitin-like [Glycine max]
 gb|ESR42019.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 gb|KDO45140.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KDO45141.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KHN48309.1| Polyubiquitin [Glycine soja]
Length=230

 Score =   355 bits (910),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   305 bits (782),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_003607669.1| Multidrug resistance protein ABC transporter family [Medicago 
truncatula]
Length=448

 Score =   362 bits (930),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 184/192 (96%), Positives = 185/192 (96%), Gaps = 0/192 (0%)
 Frame = +2

Query  11   LFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  190
            LF+ LR      KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  207  LFFLLRQFYDSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  266

Query  191  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  370
            KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ
Sbjct  267  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  326

Query  371  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  550
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  327  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  386

Query  551  EVESSDTIDNVK  586
            EVESSDTIDNVK
Sbjct  387  EVESSDTIDNVK  398


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  296  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  355

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  356  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  415

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  416  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  447



>ref|NP_001147027.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|ACG25128.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=311

 Score =   357 bits (917),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 181/186 (97%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  29   HSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  208
             S    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  76   RSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  135

Query  209  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  388
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  136  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  195

Query  389  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  568
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD
Sbjct  196  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  255

Query  569  TIDNVK  586
            TIDNVK
Sbjct  256  TIDNVK  261


 Score =   306 bits (784),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  148  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  202

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  203  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  262

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  263  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  310


 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 162/185 (88%), Gaps = 6/185 (3%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL----  217
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L    
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSP  60

Query  218  --ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  391
               + +  +          R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  61   FARNAHTARSPISDPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  120

Query  392  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  571
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT
Sbjct  121  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  180

Query  572  IDNVK  586
            IDNVK
Sbjct  181  IDNVK  185



>gb|AIZ74335.1| polyubiquitin 3, partial [Pinus massoniana]
Length=244

 Score =   355 bits (911),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  55   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  109

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  110  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  169

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  170  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  229

Query  542  ITLEVESSDTIDNVK  586
            ITLEVE+SDTIDNVK
Sbjct  230  ITLEVENSDTIDNVK  244


 Score =   333 bits (854),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/168 (99%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = +2

Query  83   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  262
            TITLE+ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  1    TITLELESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  60

Query  263  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  442
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  120

Query  443  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  168



>gb|AFK41706.1| unknown [Medicago truncatula]
 gb|AES60745.2| pentameric polyubiquitin [Medicago truncatula]
Length=233

 Score =   355 bits (910),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   305 bits (782),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_010235843.1| PREDICTED: polyubiquitin 11 isoform X1 [Brachypodium distachyon]
Length=265

 Score =   356 bits (913),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  25   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  84

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  85   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  144

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  145  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  203


 Score =   306 bits (784),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  90   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  144

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  145  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  204

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  205  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  252


 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +2

Query  260  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  439
            L  R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  19   LECRKMMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  78

Query  440  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  79   TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  127



>gb|AAC35858.1| polyubiquitin [Capsicum chinense]
Length=265

 Score =   355 bits (912),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  26   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  80

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  81   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  140

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  141  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  200

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  201  ITLEVESSDTIDNVK  215


 Score =   303 bits (777),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  102  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  156

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  157  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  216

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  217  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  265


 Score =   277 bits (708),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/139 (100%), Positives = 139/139 (100%), Gaps = 0/139 (0%)
 Frame = +2

Query  170  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  349
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  350  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  529
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  120

Query  530  TGKTITLEVESSDTIDNVK  586
            TGKTITLEVESSDTIDNVK
Sbjct  121  TGKTITLEVESSDTIDNVK  139



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   355 bits (912),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   353 bits (905),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 181/193 (94%), Positives = 183/193 (95%), Gaps = 5/193 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDN  580
            ITLEVESSDTIDN
Sbjct  241  ITLEVESSDTIDN  253



>emb|CAD27944.1| polyubiquitin-like [Oryza sativa]
Length=219

 Score =   353 bits (907),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 178/178 (100%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = +2

Query  53   QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  232
            QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI
Sbjct  2    QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  61

Query  233  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  412
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  62   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  121

Query  413  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  122  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   273 bits (697),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 145/159 (91%), Gaps = 5/159 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  478
            KIQDKEGI    +RLIFAGKQLEDGRTLADYNIQKESTL
Sbjct  181  KIQDKEGIHQTSKRLIFAGKQLEDGRTLADYNIQKESTL  219



>ref|XP_003574865.1| PREDICTED: polyubiquitin-like [Brachypodium distachyon]
Length=341

 Score =   358 bits (919),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 181/185 (98%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = +2

Query  32   SCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  211
            S    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  31   SPRLPKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  90

Query  212  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  391
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  91   TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  150

Query  392  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  571
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT
Sbjct  151  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  210

Query  572  IDNVK  586
            IDNVK
Sbjct  211  IDNVK  215


 Score =   357 bits (917),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  102  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  156

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  157  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  216

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  217  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  276

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  277  ITLEVESSDTIDNVK  291


 Score =   307 bits (786),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  178  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  232

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  233  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  292

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  293  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  340



>ref|XP_010227188.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=339

 Score =   358 bits (919),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 4/194 (2%)
 Frame = +2

Query  5    LNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  184
            + LF+H +       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  24   VELFFHGQRGG----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  79

Query  185  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  364
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK
Sbjct  80   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  139

Query  365  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI  544
            IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI
Sbjct  140  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI  199

Query  545  TLEVESSDTIDNVK  586
            TLEVESSDTIDNVK
Sbjct  200  TLEVESSDTIDNVK  213


 Score =   356 bits (914),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  100  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  214

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  215  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  274

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  275  ITLEVESSDTIDNVK  289


 Score =   306 bits (784),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  176  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  230

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  231  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  290

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  291  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338



>gb|KJB62484.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=229

 Score =   354 bits (908),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>emb|CDP08567.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   359 bits (921),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = +2

Query  20   HLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  199
            +L    S  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL
Sbjct  44   YLVFCFSSHKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  103

Query  200  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  379
            EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE
Sbjct  104  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  163

Query  380  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  559
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  164  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  223

Query  560  SSDTIDNVK  586
            SSDTIDNVK
Sbjct  224  SSDTIDNVK  232


 Score =   357 bits (915),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  119  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  173

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  174  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  233

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  234  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  293

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  294  ITLEVESSDTIDNVK  308


 Score =   277 bits (708),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 141/153 (92%), Positives = 143/153 (93%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  195  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  249

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  250  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  309

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  460
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI
Sbjct  310  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  342



>gb|ABY60454.1| putative polyubiquitin [Adonis aestivalis var. palaestina]
Length=281

 Score =   356 bits (913),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  1    TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  55

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  56   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  115

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  116  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  175

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  176  ITLEVESSDTIDNVK  190


 Score =   356 bits (913),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  77   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  131

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  132  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  191

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  192  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  251

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  252  ITLEVESSDTIDNVK  266


 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 124/134 (93%), Gaps = 5/134 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  153  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  207

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  208  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  267

Query  362  KIQDKEGIPPDQQR  403
            KIQDKEGIPPDQQR
Sbjct  268  KIQDKEGIPPDQQR  281



>ref|XP_007154493.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
 gb|ESW26487.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
Length=429

 Score =   361 bits (927),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 186/197 (94%), Positives = 189/197 (96%), Gaps = 3/197 (2%)
 Frame = +2

Query  5    LNLFY--HLRHS-CSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  175
            + LF+  H+ H   S LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  31   IALFFISHIFHRFISPLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  90

Query  176  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  355
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  91   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  150

Query  356  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  535
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  151  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  210

Query  536  KTITLEVESSDTIDNVK  586
            KTITLEVESSDTIDNVK
Sbjct  211  KTITLEVESSDTIDNVK  227


 Score =   355 bits (910),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  114  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  168

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  169  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  228

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  229  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  288

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  289  ITLEVESSDTIDNVK  303


 Score =   355 bits (910),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  190  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  244

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  245  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  304

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  305  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  364

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  365  ITLEVESSDTIDNVK  379


 Score =   305 bits (781),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  266  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  320

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  321  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  380

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  381  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  429



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   355 bits (911),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   335 bits (860),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 174/184 (95%), Gaps = 5/184 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLE  553
            ITLE
Sbjct  241  ITLE  244


 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 82/134 (61%), Gaps = 46/134 (34%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQK-----------------------------------------  238
            FAGKQLEDGRTLADYNIQK                                         
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEDGRTLADYNIQK  256

Query  239  ESTLHLVLRLRGGM  280
            ESTLHLVLRLRGG 
Sbjct  257  ESTLHLVLRLRGGF  270



>ref|XP_006377830.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55627.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
Length=297

 Score =   356 bits (913),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (911),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   282 bits (722),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 147/158 (93%), Gaps = 5/158 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKEST  475
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE+ 
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKENA  294



>prf||1604470A poly-ubiquitin
Length=272

 Score =   355 bits (911),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  33   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  87

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  88   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  147

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  148  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  207

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  208  ITLEVESSDTIDNVK  222


 Score =   305 bits (781),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  109  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  163

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  164  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  223

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  224  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  271


 Score =   291 bits (745),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/145 (100%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +2

Query  152  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  331
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  2    GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  61

Query  332  SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  511
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ
Sbjct  62   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  121

Query  512  IFVKTLTGKTITLEVESSDTIDNVK  586
            IFVKTLTGKTITLEVESSDTIDNVK
Sbjct  122  IFVKTLTGKTITLEVESSDTIDNVK  146



>ref|XP_003607668.1| Multidrug resistance protein ABC transporter family [Medicago 
truncatula]
Length=497

 Score =   363 bits (932),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 184/192 (96%), Positives = 185/192 (96%), Gaps = 0/192 (0%)
 Frame = +2

Query  11   LFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  190
            LF+ LR      KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  207  LFFLLRQFYDSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  266

Query  191  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  370
            KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ
Sbjct  267  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  326

Query  371  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  550
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  327  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  386

Query  551  EVESSDTIDNVK  586
            EVESSDTIDNVK
Sbjct  387  EVESSDTIDNVK  398


 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  296  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  355

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  356  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  415

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  553
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  416  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  463



>gb|ABD96088.1| polyubiquitin [Malus domestica]
Length=270

 Score =   355 bits (911),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  31   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  85

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  86   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  145

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  146  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  205

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  206  ITLEVESSDTIDNVK  220


 Score =   305 bits (781),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  107  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  161

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  162  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  221

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  222  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  270


 Score =   289 bits (739),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 144/144 (100%), Positives = 144/144 (100%), Gaps = 0/144 (0%)
 Frame = +2

Query  155  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  334
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  60

Query  335  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  514
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  515  FVKTLTGKTITLEVESSDTIDNVK  586
            FVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVK  144



>ref|XP_002456845.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 ref|XP_002453347.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 ref|XP_003574869.1| PREDICTED: polyubiquitin [Brachypodium distachyon]
 ref|XP_007695807.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_009412665.1| PREDICTED: polyubiquitin isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412666.1| PREDICTED: polyubiquitin isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_010227192.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 sp|P69309.2|UBIQP_AVEFA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Avena fatua]
 pir||S28426 polyubiquitin 4 - wild oat
 emb|CAA49200.1| tetraubiquitin [Avena fatua]
 gb|AAC37466.1| polyubiquitin [Saccharum hybrid cultivar H65-7052]
 gb|AAM28291.1| tetrameric ubiquitin [Ananas comosus]
 gb|EES01965.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 gb|EES06323.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 gb|AEE65379.1| ubiquitin 1 [Panicum virgatum]
 gb|EMD68114.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93446.1| hypothetical protein COCHEDRAFT_1202381 [Bipolaris maydis C5]
 gb|EMS58836.1| Polyubiquitin [Triticum urartu]
 gb|ENI07106.1| hypothetical protein COCC4DRAFT_70576 [Bipolaris maydis ATCC 
48331]
 gb|AGT16802.1| polyubiquitin-like protein [Saccharum hybrid cultivar R570]
 gb|EUN28034.1| hypothetical protein COCVIDRAFT_96666 [Bipolaris victoriae FI3]
Length=305

 Score =   356 bits (914),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (912),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_007014924.1| Polyubiquitin 3 [Theobroma cacao]
 gb|EOY32543.1| Polyubiquitin 3 [Theobroma cacao]
Length=305

 Score =   356 bits (914),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (911),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   355 bits (910),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   354 bits (908),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  179


 Score =   234 bits (596),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 123/133 (92%), Gaps = 5/133 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQ  400
            KIQDKEGIPPDQQ
Sbjct  257  KIQDKEGIPPDQQ  269



>ref|XP_006396611.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 gb|AAL27563.1|AF429429_1 polyubiquitin OUB1 [Olea europaea]
 gb|ESQ38064.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=305

 Score =   356 bits (914),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (911),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   307 bits (786),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>emb|CAC94926.1| putative ubiquitin [Pleurotus sp. 'Florida']
Length=243

 Score =   354 bits (908),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  47   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  101

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  102  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  161

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  162  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  221

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  222  ITLEVESSDTIDNVK  236


 Score =   318 bits (815),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = +2

Query  107  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  286
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQI
Sbjct  1    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI  60

Query  287  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  466
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  61   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  120

Query  467  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  160


 Score =   207 bits (527),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 111/121 (92%), Gaps = 5/121 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  123  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  177

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  178  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  237

Query  362  K  364
            +
Sbjct  238  R  238



>ref|XP_007512209.1| polyubiquitin [Bathycoccus prasinos]
 emb|CCO66297.1| polyubiquitin [Bathycoccus prasinos]
Length=359

 Score =   358 bits (919),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  117  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  171

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  172  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  231

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  232  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  291

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  292  ITLEVESSDTIDNVK  306


 Score =   333 bits (855),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 179/230 (78%), Gaps = 51/230 (22%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG-------------------------  154
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG                         
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIES  60

Query  155  --------------------------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  256
                                      IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   SLALRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  257  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  436
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  180

Query  437  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  181  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  230


 Score =   308 bits (788),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  193  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  247

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  248  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  307

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  308  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  355



>gb|EPS72031.1| polyubiquitin, partial [Genlisea aurea]
Length=274

 Score =   355 bits (910),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  35   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  89

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  90   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  149

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  150  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  209

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  210  ITLEVESSDTIDNVK  224


 Score =   305 bits (781),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  111  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  165

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  166  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  225

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  226  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  274


 Score =   297 bits (760),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +2

Query  143  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  322
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  60

Query  323  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  502
            EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  61   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  120

Query  503  GMQIFVKTLTGKTITLEVESSDTIDNVK  586
            GMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  GMQIFVKTLTGKTITLEVESSDTIDNVK  148



>gb|EYU33609.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
 gb|EYU33612.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=305

 Score =   356 bits (913),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (911),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (785),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  305



>dbj|BAJ85978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   356 bits (913),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   354 bits (908),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   356 bits (913),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   351 bits (901),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>gb|AFK43392.1| unknown [Medicago truncatula]
Length=233

 Score =   353 bits (906),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>sp|P69315.2|UBIQP_LINUS RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Contains: RecName: Full=Ubiquitin-related; Flags: Precursor, 
partial [Linum usitatissimum]
 gb|AAA33401.1| ubiquitin, partial [Linum usitatissimum]
Length=305

 Score =   356 bits (913),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  107  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  161

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  162  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  221

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  222  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  281

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  282  ITLEVESSDTIDNVK  296


 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  31   TLHLVLRLRGG-----MQIFLKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  85

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  86   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  145

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  146  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  205

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  206  ITLEVESSDTIDNVK  220


 Score =   288 bits (738),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 144/144 (100%), Gaps = 0/144 (0%)
 Frame = +2

Query  155  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  334
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVES  60

Query  335  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  514
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  515  FVKTLTGKTITLEVESSDTIDNVK  586
            FVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVK  144


 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 118/128 (92%), Gaps = 5/128 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  183  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  237

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  238  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  297

Query  362  KIQDKEGI  385
            KIQDKEGI
Sbjct  298  KIQDKEGI  305



>ref|XP_008784557.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like [Phoenix 
dactylifera]
Length=229

 Score =   353 bits (906),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVXRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>emb|CAA40323.1| polyubiquitin protein [Helianthus annuus]
Length=334

 Score =   357 bits (916),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   357 bits (916),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   356 bits (913),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 112/122 (92%), Gaps = 5/122 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KI  367
            KI
Sbjct  333  KI  334



>gb|ACJ85643.1| unknown [Medicago truncatula]
Length=229

 Score =   353 bits (906),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_007211606.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12805.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
Length=309

 Score =   356 bits (914),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (911),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (777),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 155/167 (93%), Positives = 157/167 (94%), Gaps = 5/167 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  502
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303



>gb|KDP39203.1| hypothetical protein JCGZ_00960 [Jatropha curcas]
Length=317

 Score =   356 bits (914),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (912),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   312 bits (800),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 161/172 (94%), Gaps = 5/172 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  517
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI 
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIL  308



>gb|AGV54228.1| polyubiquitin-like protein [Phaseolus vulgaris]
Length=381

 Score =   358 bits (920),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 2/188 (1%)
 Frame = +2

Query  29   HSCSYLK--MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  202
            H  S+L+  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE
Sbjct  144  HLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  203

Query  203  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  382
            DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG
Sbjct  204  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  263

Query  383  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  562
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  323

Query  563  SDTIDNVK  586
            SDTIDNVK
Sbjct  324  SDTIDNVK  331


 Score =   350 bits (899),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 183/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLV  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   350 bits (897),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLV  LRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (785),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>ref|XP_009112898.1| PREDICTED: polyubiquitin [Brassica rapa]
Length=305

 Score =   356 bits (913),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (911),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>gb|AES89865.2| polyubiquitin 3 [Medicago truncatula]
Length=278

 Score =   355 bits (910),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   335 bits (859),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 174/184 (95%), Gaps = 5/184 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLE  553
            ITLE
Sbjct  241  ITLE  244



>ref|NP_851029.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_568112.2| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_001031824.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|XP_006288303.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
 ref|XP_009122723.1| PREDICTED: polyubiquitin 3 [Brassica rapa]
 sp|Q1EC66.1|UBQ3_ARATH RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86091.1| polyubiquitin (ubq3) [Arabidopsis thaliana]
 dbj|BAB08384.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAO00780.1| polyubiquitin (UBQ3) [Arabidopsis thaliana]
 gb|ABF85770.1| At5g03240 [Arabidopsis thaliana]
 dbj|BAH19791.1| AT5G03240 [Arabidopsis thaliana]
 gb|AED90574.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90575.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90576.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|EOA21201.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
Length=306

 Score =   356 bits (913),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (911),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006302387.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35285.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=307

 Score =   356 bits (913),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (911),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AAQ84316.1| fiber polyubiquitin [Gossypium barbadense]
Length=229

 Score =   353 bits (905),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   302 bits (774),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL LVLRLRGG 
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLPLVLRLRGGF  229



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   356 bits (913),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   351 bits (901),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_011468094.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
Length=306

 Score =   356 bits (913),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   354 bits (909),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006428820.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
 gb|ESR42060.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
Length=306

 Score =   356 bits (913),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (903),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CDP08569.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   356 bits (913),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   353 bits (907),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>emb|CAA48140.1| ubiquitin [Antirrhinum majus]
Length=296

 Score =   355 bits (912),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  57   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  111

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  112  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  171

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  172  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  231

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  232  ITLEVESSDTIDNVK  246


 Score =   337 bits (865),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/170 (100%), Positives = 170/170 (100%), Gaps = 0/170 (0%)
 Frame = +2

Query  77   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  256
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  257  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  436
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  437  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  170


 Score =   305 bits (782),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  133  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  187

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  188  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  247

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  248  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  296



>ref|XP_006428821.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
 ref|XP_006480633.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42061.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
Length=306

 Score =   356 bits (913),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006654612.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
Length=305

 Score =   355 bits (912),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   304 bits (779),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQL+DGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLDDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_002873083.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49342.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   355 bits (912),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   353 bits (905),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CBY46745.1| polyubiquitin 10 protein, partial [Lepidium appelianum]
Length=308

 Score =   356 bits (913),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  69   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  123

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  124  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  183

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  184  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  243

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  244  ITLEVESSDTIDNVK  258


 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  63

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  64   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  123

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  124  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  182


 Score =   306 bits (783),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  145  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  200  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  259

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  260  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  308


 Score =   211 bits (538),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/106 (100%), Positives = 106/106 (100%), Gaps = 0/106 (0%)
 Frame = +2

Query  269  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  448
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  449  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  61   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  106



>emb|CAH59740.1| polyubiquitin [Plantago major]
Length=305

 Score =   355 bits (912),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AIS71924.1| polyubiquitin [Mangifera indica]
Length=229

 Score =   353 bits (905),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLH VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHRVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   262 bits (670),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 131/131 (100%), Positives = 131/131 (100%), Gaps = 0/131 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  410  FAGKQLEDGRT  442
            FAGKQLEDGRT
Sbjct  197  FAGKQLEDGRT  207



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   355 bits (912),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (910),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   305 bits (782),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006480631.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
Length=306

 Score =   355 bits (912),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KJB81823.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=305

 Score =   355 bits (912),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   353 bits (905),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_006428925.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
 gb|ESR42165.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
Length=306

 Score =   355 bits (912),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_003537278.1| PREDICTED: polyubiquitin-like [Glycine max]
 ref|XP_010454744.1| PREDICTED: polyubiquitin 3 [Camelina sativa]
 gb|KHN39094.1| Polyubiquitin [Glycine soja]
Length=306

 Score =   355 bits (912),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|NP_849292.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118922.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_974516.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002316978.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_002874829.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004146845.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004165599.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004293260.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_006383941.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006377831.1| polyubiquitin family protein [Populus trichocarpa]
 ref|XP_006377832.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377833.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372945.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 ref|XP_006396614.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396615.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006589609.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_006593990.1| PREDICTED: polyubiquitin 10-like isoform X2 [Glycine max]
 ref|XP_006606032.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_007211603.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008454542.1| PREDICTED: polyubiquitin [Cucumis melo]
 ref|XP_009134330.1| PREDICTED: polyubiquitin [Brassica rapa]
 ref|XP_010422419.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_011007895.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011010177.1| PREDICTED: polyubiquitin [Populus euphratica]
 sp|P69325.2|UBIQP_SOYBN RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Glycine max]
 sp|Q3E7T8.2|UBQ14_ARATH RecName: Full=Polyubiquitin 14; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 pir||S49332 polyubiquitin 4 - common sunflower
 pir||G85036 polyubiquitin [imported] - Arabidopsis thaliana
 dbj|BAA03764.1| ubiquitin [Glycine max]
 dbj|BAA05670.1| ubiquitin [Glycine max]
 emb|CAA84440.1| seed tetraubiquitin [Helianthus annuus]
 dbj|BAA05085.1| Ubiquitin [Glycine max]
 gb|AAD15340.1| putative polyubiquitin [Arabidopsis thaliana]
 emb|CAB77774.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAM65295.1| polyubiquitin (UBQ14) [Arabidopsis thaliana]
 emb|CAH59738.1| polyubiquitin [Plantago major]
 dbj|BAH19554.1| AT4G02890 [Arabidopsis thaliana]
 gb|EEE97590.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|EFH51088.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE82246.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82247.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82503.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AFP43341.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12802.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|ERP50742.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 gb|ERP55628.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP55629.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55630.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP61738.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|ESQ38067.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38068.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 dbj|BAO57270.1| ubiquitin 10 [Ipomoea nil]
 gb|KHN02680.1| Polyubiquitin [Glycine soja]
 gb|KHN15806.1| Polyubiquitin [Glycine soja]
 gb|KJB13594.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB69249.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 prf||2111434A tetraubiquitin
Length=305

 Score =   355 bits (912),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_006288300.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21198.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=306

 Score =   355 bits (912),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   305 bits (780),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_010258950.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=306

 Score =   355 bits (912),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>gb|KIM78989.1| hypothetical protein PILCRDRAFT_573034 [Piloderma croceum F 1598]
Length=229

 Score =   352 bits (904),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (777),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_007205620.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 ref|XP_007205621.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06819.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06820.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=306

 Score =   355 bits (912),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   354 bits (908),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   305 bits (782),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KDP38838.1| hypothetical protein JCGZ_04995 [Jatropha curcas]
Length=308

 Score =   355 bits (912),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   305 bits (782),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_003590494.1| Ubiquitin [Medicago truncatula]
Length=312

 Score =   356 bits (913),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AIY27743.1| polyubiquitin Ubi10, partial [Betula luminifera]
Length=330

 Score =   356 bits (914),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 186/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L + LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  64   TLHLVFRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  118

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVKA
Sbjct  119  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKA  178

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  179  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  238

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  239  ITLEVESSDTIDNVK  253


 Score =   354 bits (909),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  140  TLHLVLRLRGG-----MQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  194

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  195  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  254

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  255  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  314

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  315  ITLEVESSDTIDNVK  329


 Score =   325 bits (834),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 171/179 (96%), Gaps = 2/179 (1%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVK L  KTITLEV+    IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVK-LYSKTITLEVKLRH-IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  58

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  59   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  118

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVK
Sbjct  119  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVK  177


 Score =   207 bits (527),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 110/120 (92%), Gaps = 5/120 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  216  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  270

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  271  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  330



>gb|KIM78981.1| hypothetical protein PILCRDRAFT_10644 [Piloderma croceum F 1598]
Length=229

 Score =   352 bits (904),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (777),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV  229



>gb|EJU04700.1| polyubiquitin UbiD/Ubi4 [Dacryopinax sp. DJM-731 SS1]
Length=229

 Score =   352 bits (904),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (776),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_006685644.1| ubiquitin [Candida tenuis ATCC 10573]
 gb|EGV64838.1| ubiquitin [Candida tenuis ATCC 10573]
Length=229

 Score =   352 bits (904),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (776),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KJA26171.1| hypothetical protein HYPSUDRAFT_354705 [Hypholoma sublateritium 
FD-334 SS-4]
Length=229

 Score =   352 bits (904),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (776),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_011110054.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41950.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
Length=229

 Score =   352 bits (904),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (776),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|ACD31680.1| ubiquitin [Gossypium hirsutum]
Length=305

 Score =   355 bits (911),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (904),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (777),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG 
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLPDYNIQKESTLHLVLRLRGGF  305



>ref|XP_006287868.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
 gb|EOA20766.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
Length=407

 Score =   358 bits (920),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 187/195 (96%), Gaps = 4/195 (2%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            S NLF   R   S+ KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  14   SSNLF---RTILSF-KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  69

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  70   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  129

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  130  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  189

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  190  ITLEVESSDTIDNVK  204


 Score =   356 bits (914),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  91   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  145

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  146  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  205

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  206  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  265

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  266  ITLEVESSDTIDNVK  280


 Score =   356 bits (914),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  167  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  221

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  222  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  281

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  282  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  341

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  342  ITLEVESSDTIDNVK  356


 Score =   306 bits (784),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  243  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  297

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  298  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  357

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  358  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  405



>gb|AAO43308.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   353 bits (905),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  10   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  64

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  65   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  124

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  125  KIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  184

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  185  ITLEVESSDTIDNVK  199


 Score =   299 bits (766),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 156/168 (93%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  86   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLI  140

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  200

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLA YNIQKESTLHLVLRLRGG
Sbjct  201  KIQDKEGIPPDQQRLIFAGKQLEDGRTLAVYNIQKESTLHLVLRLRGG  248


 Score =   245 bits (626),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  218  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  397
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  398  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  577
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  578  NVK  586
            NVK
Sbjct  121  NVK  123



>gb|KIK28767.1| hypothetical protein PISMIDRAFT_672939, partial [Pisolithus microcarpus 
441]
Length=247

 Score =   353 bits (905),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  8    TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  62

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  63   FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  122

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  123  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  182

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  183  ITLEVESSDTIDNVK  197


 Score =   303 bits (777),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  84   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  138

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  139  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  198

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  199  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  247


 Score =   239 bits (611),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 120/121 (99%), Positives = 121/121 (100%), Gaps = 0/121 (0%)
 Frame = +2

Query  224  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  403
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  404  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  583
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  61   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  120

Query  584  K  586
            K
Sbjct  121  K  121



>emb|CDR41572.1| RHTO0S06e03070g1_1 [Rhodosporidium toruloides]
Length=230

 Score =   352 bits (903),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 176/179 (98%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYN+QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   302 bits (773),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 157/168 (93%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYN+QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLQDYNIQKESTLHLVLRLRGG  228



>gb|AFW66439.1| putative ubiquitin family protein [Zea mays]
Length=297

 Score =   355 bits (910),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   345 bits (884),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 178/192 (93%), Positives = 180/192 (94%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTID  577
            ITLEVESSD  D
Sbjct  241  ITLEVESSDIQD  252


 Score =   283 bits (724),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 150/168 (89%), Gaps = 13/168 (8%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD       
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD-------  249

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
             IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  250  -IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  296



>emb|CAA54603.1| pentameric polyubiquitin [Nicotiana tabacum]
Length=346

 Score =   356 bits (914),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (914),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (912),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 119/129 (92%), Gaps = 5/129 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIP  388
            KIQDKEGIP
Sbjct  333  KIQDKEGIP  341



>gb|KJB14874.1| hypothetical protein B456_002G147600, partial [Gossypium raimondii]
Length=344

 Score =   356 bits (914),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  31   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  85

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  86   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  145

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  146  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  205

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  206  ITLEVESSDTIDNVK  220


 Score =   356 bits (914),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  107  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  161

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  162  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  221

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  222  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  281

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  282  ITLEVESSDTIDNVK  296


 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/167 (93%), Positives = 157/167 (94%), Gaps = 5/167 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  183  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  237

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  238  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  297

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  502
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  298  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  344


 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 144/179 (80%), Gaps = 35/179 (20%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLE                                   DGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLE-----------------------------------DGRTLADYN  25

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  26   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  85

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  86   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  144



>gb|KJB62487.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   355 bits (910),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (904),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_010062974.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
Length=425

 Score =   359 bits (921),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+ F   + S   +KMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  29   ALSPFDLSKFSSLRVKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  88

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  89   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  148

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  149  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  208

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  209  ITLEVESSDTIDNVK  223


 Score =   355 bits (912),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  110  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  164

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  165  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  224

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  225  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  284

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDT+DNVK
Sbjct  285  ITLEVESSDTVDNVK  299


 Score =   355 bits (912),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  186  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  240

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKA
Sbjct  241  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKA  300

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  301  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  360

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  361  ITLEVESSDTIDNVK  375


 Score =   306 bits (783),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  262  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  316

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  317  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  376

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  377  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  425



>gb|AAB95250.1| ubiquitin [Arabidopsis thaliana]
Length=304

 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   354 bits (908),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   305 bits (782),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AAM64530.1| ubiquitin homolog [Arabidopsis thaliana]
Length=229

 Score =   352 bits (903),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   305 bits (781),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLXLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_011077812.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
 ref|XP_011077813.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
Length=334

 Score =   356 bits (913),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  18   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  72

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  73   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  132

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  133  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  192

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  193  ITLEVESSDTIDNVK  207


 Score =   356 bits (913),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  94   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  148

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  149  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  208

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  209  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  268

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  269  ITLEVESSDTIDNVK  283


 Score =   306 bits (783),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  170  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  224

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  225  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  284

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  285  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  332


 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/118 (100%), Positives = 118/118 (100%), Gaps = 0/118 (0%)
 Frame = +2

Query  233  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  412
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  73

Query  413  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  74   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  131



>gb|KDB11907.1| ubiquitin [Ustilaginoidea virens]
Length=305

 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   354 bits (908),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (777),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_007154496.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
 gb|ESW26490.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
Length=305

 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   354 bits (908),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  179


 Score =   305 bits (782),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>ref|XP_010938693.1| PREDICTED: polyubiquitin [Elaeis guineensis]
Length=307

 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   354 bits (908),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (777),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 157/168 (93%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_003082269.1| polyubiquitin (ISS) [Ostreococcus tauri]
Length=288

 Score =   354 bits (908),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  42   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  96

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  97   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  156

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  157  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  216

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  217  ITLEVESSDTIDNVK  231


 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/146 (99%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = +2

Query  149  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  328
            +GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
Sbjct  10   DGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  69

Query  329  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  70   ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  129

Query  509  QIFVKTLTGKTITLEVESSDTIDNVK  586
            QIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  130  QIFVKTLTGKTITLEVESSDTIDNVK  155


 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 135/145 (93%), Gaps = 5/145 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  118  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  173  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  232

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDG  436
            KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  233  KIQDKEGIPPDQQRLIFAGKQLEDG  257



>gb|KIL68862.1| hypothetical protein M378DRAFT_157997 [Amanita muscaria Koide 
BX008]
Length=305

 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   354 bits (908),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   304 bits (779),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>gb|AHC00631.1| polyubiquitin [Ganoderma lucidum]
Length=319

 Score =   355 bits (911),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 180/186 (97%), Positives = 182/186 (98%), Gaps = 2/186 (1%)
 Frame = +2

Query  35   CSYL--KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  208
            CS L   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  8    CSLLAYSMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  67

Query  209  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  388
            RTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  68   RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  127

Query  389  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  568
            PDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD
Sbjct  128  PDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  187

Query  569  TIDNVK  586
            TIDNVK
Sbjct  188  TIDNVK  193


 Score =   353 bits (907),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  80   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  134

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  135  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  194

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  195  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  254

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  255  ITLEVESSDTIDNVK  269


 Score =   304 bits (779),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  156  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  210

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  211  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  270

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  271  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  319



>dbj|BAF00213.1| polyubiquitin 4 UBQ4 [Arabidopsis thaliana]
Length=351

 Score =   356 bits (914),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   335 bits (860),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 183/240 (76%), Positives = 185/240 (77%), Gaps = 50/240 (21%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQ---------------------------------------------DKEGIPPDQQRL  406
            KIQ                                             DKEGIPPDQQRL
Sbjct  181  KIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  240

Query  407  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  241  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  300


 Score =   307 bits (786),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  187  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  241

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  242  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  301

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  302  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  349



>gb|AFY06654.1| polyubiquitin, partial [Carica papaya]
Length=264

 Score =   353 bits (905),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  36   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  95

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  96   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  155

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  156  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  214


 Score =   304 bits (778),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  101  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  155

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  156  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  215

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  216  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  264


 Score =   246 bits (627),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  206  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  385
            G TLADYNIQKESTL LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  12   GGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  71

Query  386  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  565
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  72   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  131

Query  566  DTIDNVK  586
            DTIDNVK
Sbjct  132  DTIDNVK  138



>ref|XP_008796945.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=309

 Score =   355 bits (910),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   353 bits (907),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (785),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_010453358.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   354 bits (909),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   353 bits (907),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>emb|CEF99839.1| Ubiquitin conserved site [Ostreococcus tauri]
Length=339

 Score =   355 bits (912),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  100  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  214

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  215  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  274

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  275  ITLEVESSDTIDNVK  289


 Score =   355 bits (910),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  213


 Score =   305 bits (782),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  176  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  230

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  231  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  290

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  291  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338



>gb|AFW66438.1| putative ubiquitin family protein, partial [Zea mays]
 gb|AFW66447.1| ubiquitin2, partial [Zea mays]
Length=349

 Score =   356 bits (913),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   335 bits (859),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 183/240 (76%), Positives = 185/240 (77%), Gaps = 50/240 (21%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQ---------------------------------------------DKEGIPPDQQRL  406
            KIQ                                             DKEGIPPDQQRL
Sbjct  181  KIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  240

Query  407  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  241  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  300


 Score =   306 bits (785),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  187  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  241

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  242  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  301

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  302  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  349



>gb|AGZ15412.1| fiber polyubiquitin [Phaseolus vulgaris]
Length=229

 Score =   351 bits (901),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESFDTIDNVK  179


 Score =   288 bits (738),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 152/169 (90%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESFDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDG TLADYNIQKE TL LVL  RGG 
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGCTLADYNIQKEFTLPLVLCFRGGF  229



>gb|EWZ40370.1| ubiquitin C [Fusarium oxysporum Fo47]
Length=229

 Score =   351 bits (901),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 176/179 (98%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   302 bits (773),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|KIY97324.1| ubiquitin C, partial [Monoraphidium neglectum]
Length=186

 Score =   349 bits (896),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 174/179 (97%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVK  179


 Score =   213 bits (543),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 116/126 (92%), Gaps = 5/126 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKS  180

Query  362  KIQDKE  379
            KIQDKE
Sbjct  181  KIQDKE  186



>ref|XP_002992988.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
 ref|XP_002994514.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ04422.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ05934.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
Length=229

 Score =   351 bits (900),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   304 bits (779),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229



>gb|AAO43309.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   352 bits (902),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  10   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQQRLI  64

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  65   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  124

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  125  KIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  184

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  185  ITLEVESSDTIDNVK  199


 Score =   298 bits (763),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  86   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLI  140

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  200

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQ+RLIFAGKQLEDGRTLA YNIQKESTLHLVLRLRGG+
Sbjct  201  KIQDKEGIPPDQKRLIFAGKQLEDGRTLAVYNIQKESTLHLVLRLRGGI  249


 Score =   244 bits (623),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  218  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  397
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQ  60

Query  398  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  577
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  578  NVK  586
            NVK
Sbjct  121  NVK  123



>ref|XP_001783045.1| predicted protein [Physcomitrella patens]
 gb|EDQ52114.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   351 bits (900),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   302 bits (773),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 156/168 (93%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_010454368.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (911),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002874006.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50265.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002508175.1| ubiquitin [Micromonas sp. RCC299]
 ref|XP_003061956.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|EEH53668.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|ACO69433.1| ubiquitin [Micromonas sp. RCC299]
 gb|KEH20642.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (912),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010911599.1| PREDICTED: polyubiquitin 4 [Elaeis guineensis]
Length=384

 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (912),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002872109.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48368.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  67   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  121

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  122  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  181

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  182  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  241

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  242  ITLEVESSDTIDNVK  256


 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  143  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  197

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  257

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  258  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  317

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  318  ITLEVESSDTIDNVK  332


 Score =   351 bits (900),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  2    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYN  61

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  121

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  122  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  180


 Score =   306 bits (783),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  219  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  273

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  274  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  333

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEG+PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  334  KIQDKEGVPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  381



>ref|XP_001755431.1| predicted protein [Physcomitrella patens]
 gb|EDQ79911.1| predicted protein [Physcomitrella patens]
Length=231

 Score =   351 bits (900),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/167 (92%), Positives = 155/167 (93%), Gaps = 5/167 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  502
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227



>ref|XP_006381473.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP59270.1| polyubiquitin family protein [Populus trichocarpa]
Length=306

 Score =   353 bits (907),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   350 bits (897),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 176/179 (98%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVE+SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVENSDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVK  179


 Score =   303 bits (777),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 157/168 (93%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_010240636.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
 ref|XP_010240784.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=383

 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 181/181 (100%), Gaps = 0/181 (0%)
 Frame = +2

Query  44   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  223
            ++MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  1    MQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  60

Query  224  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  403
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  61   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  120

Query  404  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  583
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  121  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  180

Query  584  K  586
            K
Sbjct  181  K  181


 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  68   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  122

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  123  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  182

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  183  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  242

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  243  ITLEVESSDTIDNVK  257


 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  144  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  198

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  199  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  258

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  259  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  318

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  319  ITLEVESSDTIDNVK  333


 Score =   306 bits (784),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  220  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  274

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  275  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  334

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  335  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  382



>gb|KIY53974.1| polyubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   353 bits (907),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   353 bits (905),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   302 bits (774),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY+IQKESTLHLVLRLRGG+
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYSIQKESTLHLVLRLRGGL  305



>gb|ADO60140.1| ubiquitin [Beauveria bassiana]
Length=215

 Score =   350 bits (898),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/179 (98%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   275 bits (703),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 145/155 (94%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  466
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  215



>gb|KIK92093.1| hypothetical protein PAXRUDRAFT_830299, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=229

 Score =   350 bits (899),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (775),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|KII93501.1| hypothetical protein PLICRDRAFT_694663 [Plicaturopsis crispa 
FD-325 SS-3]
Length=348

 Score =   355 bits (911),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/193 (94%), Positives = 184/193 (95%), Gaps = 3/193 (2%)
 Frame = +2

Query  8    NLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA  187
            N F    H+ S   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA
Sbjct  33   NPFKPTLHTPS---MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA  89

Query  188  GKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  367
            GKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  90   GKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  149

Query  368  QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  547
            QDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT
Sbjct  150  QDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  209

Query  548  LEVESSDTIDNVK  586
            LEVESSDTIDNVK
Sbjct  210  LEVESSDTIDNVK  222


 Score =   354 bits (908),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  109  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  163

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  164  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  223

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  224  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  283

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  284  ITLEVESSDTIDNVK  298


 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  185  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  239

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  240  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  299

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  300  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  347



>gb|KIY45417.1| ubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   353 bits (907),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (904),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (777),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|KJB62485.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   353 bits (907),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (904),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   305 bits (780),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006396612.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 ref|XP_010537979.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 emb|CAJ86369.1| OSIGBa0117N13.13 [Oryza sativa Indica Group]
 emb|CAJ86419.1| H0303G06.8 [Oryza sativa Indica Group]
 gb|EAY95663.1| hypothetical protein OsI_17529 [Oryza sativa Indica Group]
 gb|ESQ38065.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=381

 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   307 bits (786),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>ref|NP_001105376.1| polyubiquitin [Zea mays]
 gb|AAC49025.1| polyubiquitin [Zea mays]
Length=381

 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   355 bits (910),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV+RLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVVRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   305 bits (781),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLV+RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_001828882.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 ref|XP_001873268.1| ubiquitin [Laccaria bicolor S238N-H82]
 ref|XP_003037536.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 ref|XP_006454479.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 ref|XP_007316692.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 ref|XP_007325267.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 ref|XP_007378433.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 ref|XP_007842308.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 ref|XP_007879465.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|EAU92889.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 gb|EDR15060.1| ubiquitin [Laccaria bicolor S238N-H82]
 gb|EFJ02634.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 gb|EGO26519.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EIN13516.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 gb|EKM83733.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV51498.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 dbj|GAC72194.1| ubiquitin and ubiquitin-like proteins [Pseudozyma antarctica 
T-34]
 dbj|GAC93128.1| ubiquitin [Pseudozyma hubeiensis SY62]
 gb|EPQ28867.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|ESK98373.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 gb|AHA61591.1| ubiquitin [Volvariella volvacea]
 gb|KIK04252.1| hypothetical protein K443DRAFT_4723 [Laccaria amethystina LaAM-08-1]
 gb|KIO31281.1| hypothetical protein M407DRAFT_241831 [Tulasnella calospora MUT 
4182]
Length=305

 Score =   353 bits (906),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (904),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (777),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>sp|Q58G87.2|UBQ3_ORYSJ RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE04243.3| OSJNBa0089N06.4 [Oryza sativa Japonica Group]
 gb|EAZ32071.1| hypothetical protein OsJ_16259 [Oryza sativa Japonica Group]
Length=381

 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   353 bits (905),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   307 bits (786),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>emb|CCL99875.1| predicted protein [Fibroporia radiculosa]
Length=312

 Score =   353 bits (907),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  73   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  127

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  128  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  187

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  188  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  247

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  248  ITLEVESSDTIDNVK  262


 Score =   353 bits (907),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/185 (96%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = +2

Query  32   SCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  211
            + S   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  2    TISSSNMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  61

Query  212  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  391
            TL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  62   TLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  121

Query  392  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  571
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT
Sbjct  122  DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  181

Query  572  IDNVK  586
            IDNVK
Sbjct  182  IDNVK  186


 Score =   305 bits (780),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  149  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  203

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  204  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  263

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  264  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  312



>gb|EGO00904.1| hypothetical protein SERLA73DRAFT_178893 [Serpula lacrymans var. 
lacrymans S7.3]
Length=312

 Score =   353 bits (907),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   353 bits (905),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   291 bits (746),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 152/163 (93%), Gaps = 5/163 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  490
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV 
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVF  299



>ref|XP_011048569.1| PREDICTED: polyubiquitin 3-like [Populus euphratica]
Length=306

 Score =   353 bits (906),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQK+STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   352 bits (904),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQK+STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLE+GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   304 bits (778),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLE+GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|NP_001174480.1| Os05g0504766 [Oryza sativa Japonica Group]
 ref|XP_002438904.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 ref|XP_006656385.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 ref|XP_007027294.1| Ubiquitin 4 [Theobroma cacao]
 ref|XP_010240640.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 ref|XP_010240789.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 gb|AAD30173.1|AF148448_1 polyubiquitin [Sporobolus stapfianus]
 gb|AAW56906.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|EAY98614.1| hypothetical protein OsI_20535 [Oryza sativa Indica Group]
 gb|EEE64284.1| hypothetical protein OsJ_19121 [Oryza sativa Japonica Group]
 gb|EER90271.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 dbj|BAH93208.1| Os05g0504766 [Oryza sativa Japonica Group]
 dbj|BAJ91806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04112.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFH53939.1| polyubiquitin 4 [Brachypodium distachyon]
 gb|AFH53940.1| polyubiquitin 10 [Brachypodium distachyon]
 gb|EOY07796.1| Ubiquitin 4 [Theobroma cacao]
 gb|AGT16803.1| polyubiquitin [Saccharum hybrid cultivar R570]
Length=381

 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KIM67150.1| hypothetical protein SCLCIDRAFT_1210637 [Scleroderma citrinum 
Foug A]
Length=305

 Score =   353 bits (906),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   349 bits (895),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 176/179 (98%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQVKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (776),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_003030030.1| polyubiquitin [Schizophyllum commune H4-8]
 ref|XP_006678580.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 ref|XP_007396817.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|AAB94630.1| polyubiquitin [Schizophyllum commune]
 gb|EFI95127.1| polyubiquitin [Schizophyllum commune H4-8]
 gb|EGF80702.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 gb|EKM54116.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EPT04446.1| hypothetical protein FOMPIDRAFT_1021745 [Fomitopsis pinicola 
FP-58527 SS1]
 gb|KDQ24213.1| hypothetical protein PLEOSDRAFT_1058300 [Pleurotus ostreatus 
PC15]
 gb|KDQ28506.1| hypothetical protein PLEOSDRAFT_1089714 [Pleurotus ostreatus 
PC15]
 gb|KDQ53556.1| hypothetical protein JAAARDRAFT_72512 [Jaapia argillacea MUCL 
33604]
 gb|KIK09182.1| hypothetical protein K443DRAFT_671672 [Laccaria amethystina LaAM-08-1]
 gb|KIK44225.1| hypothetical protein CY34DRAFT_648259 [Suillus luteus UH-Slu-Lm8-n1]
 gb|KIM51102.1| hypothetical protein SCLCIDRAFT_144015 [Scleroderma citrinum 
Foug A]
 gb|KIN98337.1| hypothetical protein M404DRAFT_856969 [Pisolithus tinctorius 
Marx 270]
 gb|KIN98894.1| hypothetical protein M404DRAFT_966612 [Pisolithus tinctorius 
Marx 270]
Length=305

 Score =   353 bits (906),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (904),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   304 bits (779),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>ref|XP_010558157.1| PREDICTED: polyubiquitin-like [Tarenaya hassleriana]
Length=382

 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KIJ45725.1| hypothetical protein M422DRAFT_106821, partial [Sphaerobolus 
stellatus SS14]
Length=305

 Score =   353 bits (906),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (904),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGM
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305



>gb|EYU33608.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=381

 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (785),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  381



>gb|KJB81825.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
 gb|KJB81826.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=381

 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   353 bits (906),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_009763135.1| PREDICTED: polyubiquitin-like [Nicotiana sylvestris]
Length=381

 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (910),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (904),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|AAK68824.1| Unknown protein [Arabidopsis thaliana]
Length=229

 Score =   350 bits (899),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK L GKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVK  179


 Score =   301 bits (771),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK L GKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_002266370.1| PREDICTED: polyubiquitin 4-like [Vitis vinifera]
Length=383

 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_006302388.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35286.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=383

 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KEH31155.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   355 bits (910),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|AAX40652.1| polyubiquitin [Oryza sativa Japonica Group]
Length=381

 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (912),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRL+FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLVFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   352 bits (904),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL+
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLV  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>dbj|BAL61087.1| polyubiquitin [Dianthus caryophyllus]
Length=229

 Score =   350 bits (899),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   301 bits (772),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 156/168 (93%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|ACS68205.1| ubiquitin 10.2 [Brassica napus]
Length=381

 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (785),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381



>gb|AAB68045.1| polyubiquitin [Fragaria x ananassa]
Length=381

 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   353 bits (905),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_001555417.1| polyubiquitin [Botrytis cinerea B05.10]
 ref|XP_001906054.1| hypothetical protein [Podospora anserina S mat+]
 ref|XP_007336907.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 ref|XP_007390409.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 ref|XP_011121602.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 gb|AAC15225.1| polyubiquitin [Botrytis cinerea]
 emb|CAP66720.1| unnamed protein product [Podospora anserina S mat+]
 gb|EGX49548.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 emb|CCD51422.1| similar to polyubiquitin protein [Botrytis cinerea T4]
 gb|EJD55630.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EKM60970.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EMR84820.1| putative polyubiquitin protein [Botrytis cinerea BcDW1]
 emb|CDP28455.1| Putative Ubiquitin [Podospora anserina S mat+]
 gb|KIP12035.1| hypothetical protein PHLGIDRAFT_17814 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=305

 Score =   353 bits (906),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (904),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (776),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_008020911.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
 gb|EOA91885.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
Length=305

 Score =   353 bits (906),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (904),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (776),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|NP_568397.1| ubiquitin 4 [Arabidopsis thaliana]
 ref|XP_002881273.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010420904.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 ref|XP_010493166.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 sp|P0CH32.1|UBQ4_ARATH RecName: Full=Polyubiquitin 4; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA31331.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAB53929.1| polyubiquitin [Arabidopsis thaliana]
 gb|EFH57532.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED92867.1| ubiquitin 4 [Arabidopsis thaliana]
 prf||1515347A poly-ubiquitin
Length=382

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>emb|CDP05795.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   354 bits (908),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   353 bits (906),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|KIR63773.1| polyubiquitin [Cryptococcus gattii CA1873]
 gb|KIR98208.1| polyubiquitin [Cryptococcus gattii 2001/935-1]
Length=305

 Score =   353 bits (906),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   351 bits (900),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/179 (98%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (776),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_001598085.1| polyubiquitin [Sclerotinia sclerotiorum 1980]
 gb|EDN90771.1| polyubiquitin [Sclerotinia sclerotiorum 1980 UF-70]
Length=305

 Score =   353 bits (906),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (904),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 157/168 (93%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYNIQKESTLHLVLRLRGG  304



>ref|XP_010421267.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   355 bits (910),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE+TLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKETTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKE+TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKETTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAB95252.1| ubiquitin [Arabidopsis thaliana]
Length=380

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   353 bits (906),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (903),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   304 bits (778),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY+IQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYDIQKESTLHLVLRLRGG  380



>gb|ACJ85658.1| unknown [Medicago truncatula]
Length=228

 Score =   350 bits (898),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/179 (98%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTI LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTIILEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL+
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLV  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKALTGKTITLEVESSDTIDNVK  179


 Score =   259 bits (663),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 141/162 (87%), Gaps = 6/162 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL+
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLV  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKALTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  487
            KIQDKEGIPPDQQRLIFAG  L  G  L+   IQKESTLHLV
Sbjct  181  KIQDKEGIPPDQQRLIFAGNNLRMG-GLSLIYIQKESTLHLV  221



>gb|ADD52202.1| ubiquitin [Catharanthus roseus]
 gb|AEK98798.1| ubiquitin [Carthamus tinctorius]
Length=381

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   350 bits (898),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 183/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADCNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   347 bits (891),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 176/179 (98%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAK QDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADCNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (777),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLI AGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  333  KIQDKEGIPPDQQRLILAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>sp|P0CG84.1|UBI4P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Nicotiana sylvestris]
 gb|AAA34124.1| pentameric polyubiquitin, partial [Nicotiana sylvestris]
Length=377

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  62   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  116

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  117  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  176

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  177  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  236

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  237  ITLEVESSDTIDNVK  251


 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  138  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  192

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  193  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  252

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  253  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  312

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  313  ITLEVESSDTIDNVK  327


 Score =   346 bits (887),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/175 (100%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +2

Query  62   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  241
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  242  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  421
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  61   STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  120

Query  422  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  175


 Score =   306 bits (783),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  214  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  268

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  269  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  328

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  329  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  377



>ref|XP_010492041.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   353 bits (906),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAG QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGTQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (904),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAG QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGTQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   305 bits (782),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_007366816.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
 gb|EJF60398.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
Length=305

 Score =   353 bits (906),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   350 bits (899),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/179 (98%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRPLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   304 bits (778),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>gb|AAY86773.1| polyubiquitin [Noccaea caerulescens]
Length=382

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010240921.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=381

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   354 bits (909),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|NP_001148453.1| LOC100282068 [Zea mays]
 ref|XP_002299930.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_003607671.1| Ubiquitin [Medicago truncatula]
 gb|AAC49014.1| ubiquitin [Zea mays]
 gb|ACG31521.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|EEE84735.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ACR37911.1| unknown [Zea mays]
 gb|AES89868.1| polyubiquitin 3 [Medicago truncatula]
 gb|AFW66440.1| putative ubiquitin family protein isoform 1 [Zea mays]
 gb|AFW66441.1| putative ubiquitin family protein isoform 2 [Zea mays]
Length=381

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_006593989.1| PREDICTED: polyubiquitin 10-like isoform X1 [Glycine max]
Length=381

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            +TLEVESSDTIDNVK
Sbjct  317  VTLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   305 bits (782),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>emb|CBY46746.1| polyubiquitin 10 protein, partial [Lepidium campestre]
Length=381

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   354 bits (909),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|KIR29996.1| polyubiquitin [Cryptococcus gattii LA55]
 gb|KIR37417.1| polyubiquitin [Cryptococcus gattii MMRL2647]
 gb|KIR43885.1| polyubiquitin [Cryptococcus gattii Ram5]
 gb|KIR92886.1| polyubiquitin [Cryptococcus gattii CBS 10090]
 gb|KIY60273.1| polyubiquitin [Cryptococcus gattii 99/473]
Length=315

 Score =   353 bits (907),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   351 bits (901),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/179 (98%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   317 bits (813),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 165/175 (94%), Gaps = 5/175 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT  526
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKT  311



>gb|EYU18102.1| hypothetical protein MIMGU_mgv1a008166mg [Erythranthe guttata]
Length=383

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   353 bits (906),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDT+DNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|NP_849300.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_567291.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_001078353.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_004134747.1| PREDICTED: polyubiquitin-like isoform 1 [Cucumis sativus]
 ref|XP_004134748.1| PREDICTED: polyubiquitin-like isoform 2 [Cucumis sativus]
 ref|XP_004496773.1| PREDICTED: polyubiquitin-like [Cicer arietinum]
 ref|XP_006360087.1| PREDICTED: polyubiquitin-like isoform X2 [Solanum tuberosum]
 ref|XP_006287939.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 ref|XP_006370633.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370635.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370637.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006380307.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 ref|XP_006377834.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377835.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372946.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_006396616.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396617.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006452184.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 ref|XP_007021032.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021033.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021035.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007025987.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007143204.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 ref|XP_007211430.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 ref|XP_007211607.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008244360.1| PREDICTED: polyubiquitin isoform X2 [Prunus mume]
 ref|XP_009365167.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358097.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009358098.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343085.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343086.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009611794.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792849.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_009793738.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010267760.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
 ref|XP_010423137.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010447068.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010455857.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010644407.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011026350.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011030849.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011048300.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011460984.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_011460993.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 sp|P69322.2|UBIQP_PEA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Pisum sativum]
 emb|CAA34886.1| unnamed protein product [Pisum sativum]
 gb|AAD03344.1| ubiquitin [Pisum sativum]
 gb|AAK96602.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
 dbj|BAD26592.1| polyubiquitin [Populus nigra]
 gb|ABB73307.1| ubiquitin [Lotus japonicus]
 gb|ABK92512.1| unknown [Populus trichocarpa]
 gb|ABK93264.1| unknown [Populus trichocarpa]
 gb|ABK95903.1| unknown [Populus trichocarpa]
 gb|ABK96012.1| unknown [Populus trichocarpa]
 gb|ABK96127.1| unknown [Populus trichocarpa]
 gb|ACK56276.1| ubiquitin [Populus trichocarpa]
 gb|AEE82501.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82504.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82505.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12629.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 gb|EMJ12806.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA20837.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 gb|EOY12557.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12558.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12560.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOY28609.1| Polyubiquitin 10 [Theobroma cacao]
 gb|ERP50743.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ERP55631.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55632.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP58104.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 gb|ERP67202.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67204.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67206.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESQ38069.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38070.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESR65424.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 gb|ESW15198.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 gb|KDO52961.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDP20793.1| hypothetical protein JCGZ_21264 [Jatropha curcas]
 gb|AET01628.2| polyubiquitin 3 [Medicago truncatula]
 gb|KEH30745.1| polyubiquitin 3 [Medicago truncatula]
 gb|KJB13593.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB62633.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 prf||1603402A poly-ubiquitin
Length=381

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|ABU40645.1| polyubiquitin [Triticum aestivum]
Length=380

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (910),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010696408.1| PREDICTED: polyubiquitin 4 [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   304 bits (778),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 157/168 (93%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_009596689.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=382

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_006428816.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
 gb|ESR42056.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
Length=382

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_009591312.1| PREDICTED: polyubiquitin 4 [Nicotiana tomentosiformis]
 ref|XP_011468093.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 4-like [Fragaria 
vesca subsp. vesca]
Length=382

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_009108753.1| PREDICTED: polyubiquitin 11-like [Brassica rapa]
Length=229

 Score =   350 bits (898),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 176/179 (98%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKE+ LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKETNLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVK  179


 Score =   301 bits (770),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   NLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  181  KIQDKEDIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>gb|KDQ20365.1| hypothetical protein BOTBODRAFT_123907 [Botryobasidium botryosum 
FD-172 SS1]
Length=305

 Score =   353 bits (905),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (903),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_007339454.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EJD52725.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|KIM81538.1| hypothetical protein PILCRDRAFT_821319 [Piloderma croceum F 1598]
Length=305

 Score =   353 bits (905),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (903),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (776),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305



>gb|KJB13592.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=385

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (785),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 160/171 (94%), Gaps = 5/171 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  514
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG ++
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGFRM  383



>ref|XP_001420612.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98905.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|KHN17791.1| Polyubiquitin 4 [Glycine soja]
Length=381

 Score =   355 bits (912),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (912),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (910),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAB36545.1| ubiquitin-like protein [Phaseolus vulgaris]
Length=407

 Score =   357 bits (915),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  92   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  146

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  147  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  206

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  207  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  266

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  267  ITLEVESSDTIDNVK  281


 Score =   357 bits (915),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  168  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  222

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  223  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  282

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  283  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  342

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  343  ITLEVESSDTIDNVK  357


 Score =   306 bits (785),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  244  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  298

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  299  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  358

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  359  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  407


 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/135 (99%), Positives = 134/135 (99%), Gaps = 1/135 (1%)
 Frame = +2

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FA KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  72   FA-KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  130

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  131  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  190

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  191  ITLEVESSDTIDNVK  205



>ref|XP_007763327.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EIW86558.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EUC62408.1| polyubiquitin [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KDQ12738.1| hypothetical protein BOTBODRAFT_34195 [Botryobasidium botryosum 
FD-172 SS1]
 gb|KEP53373.1| polyubiquitin [Rhizoctonia solani 123E]
 gb|KIJ12827.1| hypothetical protein PAXINDRAFT_82237 [Paxillus involutus ATCC 
200175]
 gb|KIK47355.1| hypothetical protein CY34DRAFT_799527 [Suillus luteus UH-Slu-Lm8-n1]
Length=305

 Score =   353 bits (905),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (903),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_001931824.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 ref|XP_003305664.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 ref|XP_003854274.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 ref|XP_007275950.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 ref|XP_007376605.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 ref|XP_007674454.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 ref|XP_007741026.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 ref|XP_009261437.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 ref|XP_009650785.1| ubiquitin [Verticillium dahliae VdLs.17]
 ref|XP_011319955.1| ubiquitin [Fusarium graminearum PH-1]
 gb|EDU40929.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EFQ86204.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 gb|EGP89250.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 gb|EGW31827.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 gb|EGY14431.1| ubiquitin [Verticillium dahliae VdLs.17]
 gb|EHK44351.1| hypothetical protein TRIATDRAFT_300588 [Trichoderma atroviride 
IMI 206040]
 gb|EJT46666.1| hypothetical protein A1Q1_04737 [Trichosporon asahii var. asahii 
CBS 2479]
 gb|EKJ69797.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 gb|ELA35078.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 gb|EMC98317.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 gb|EME45125.1| hypothetical protein DOTSEDRAFT_70987 [Dothistroma septosporum 
NZE10]
 gb|ENH81500.1| ubiquitin [Colletotrichum orbiculare MAFF 240422]
 gb|ESU14530.1| ubiquitin [Fusarium graminearum PH-1]
 emb|CDK27817.1| unnamed protein product [Kuraishia capsulata CBS 1993]
 gb|EXJ73926.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 gb|EYB28525.1| hypothetical protein FG05_08768 [Fusarium graminearum]
 gb|KEQ58801.1| ubiquitin [Aureobasidium melanogenum CBS 110374]
 gb|KEQ70291.1| ubiquitin [Aureobasidium pullulans var. namibiae CBS 147.97]
 gb|KEQ87814.1| ubiquitin [Aureobasidium pullulans EXF-150]
 gb|KER00813.1| hypothetical protein AUEXF2481DRAFT_25097 [Aureobasidium subglaciale 
EXF-2481]
 emb|CEF77191.1| unnamed protein product [Fusarium graminearum]
 gb|KIV95571.1| polyubiquitin [Exophiala mesophila]
 gb|KIW22916.1| polyubiquitin [Cladophialophora immunda]
 gb|KIW83318.1| polyubiquitin [Fonsecaea pedrosoi CBS 271.37]
 gb|KIW87781.1| polyubiquitin [Cladophialophora bantiana CBS 173.52]
 gb|KIX98997.1| polyubiquitin [Fonsecaea multimorphosa CBS 102226]
Length=229

 Score =   350 bits (898),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/179 (98%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   301 bits (770),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_010452435.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   353 bits (905),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR I
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (903),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR I
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>gb|KJB81824.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=393

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   353 bits (906),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   283 bits (725),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 148/159 (93%), Gaps = 5/159 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  478
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE+ L
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKENPL  371



>gb|AAL09741.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
Length=381

 Score =   355 bits (912),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLSLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   353 bits (906),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (904),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>emb|CCT70325.1| UBI4-Ubiquitin [Fusarium fujikuroi IMI 58289]
Length=281

 Score =   352 bits (903),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/195 (92%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  42   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  96

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  97   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  156

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  157  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  216

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  217  ITLEVESSDTIDNVK  231


 Score =   301 bits (770),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  118  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  172

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  173  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  232

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  233  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  280


 Score =   289 bits (740),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 155/179 (87%), Gaps = 24/179 (13%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDN                        LEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDN------------------------LEDGRTLSDYN  36

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  37   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  96

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  97   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  155



>ref|XP_001764949.1| predicted protein [Physcomitrella patens]
 gb|EDQ70165.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   353 bits (906),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   352 bits (903),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 183/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   313 bits (801),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 164/182 (90%), Gaps = 5/182 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM+I   TL  K 
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMEIIEDTLASKI  316

Query  542  IT  547
            IT
Sbjct  317  IT  318



>emb|CEP60563.1| LALA0S01e13784g1_1 [Lachancea lanzarotensis]
Length=229

 Score =   350 bits (897),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/179 (98%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   301 bits (771),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGI  229



>ref|XP_009358096.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
 ref|XP_009343084.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
Length=401

 Score =   356 bits (913),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  86   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  140

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  200

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  201  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  260

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  261  ITLEVESSDTIDNVK  275


 Score =   356 bits (913),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  162  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  217  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  276

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  277  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  336

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  337  ITLEVESSDTIDNVK  351


 Score =   356 bits (913),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 187/198 (94%), Gaps = 4/198 (2%)
 Frame = +2

Query  5    LNLFYHLRHSCSYLK----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  172
            L  +  ++   +YL+    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  2    LAYWVLIKFERNYLESSTSMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  61

Query  173  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  352
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
Sbjct  62   RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  121

Query  353  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  532
            VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  122  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  181

Query  533  GKTITLEVESSDTIDNVK  586
            GKTITLEVESSDTIDNVK
Sbjct  182  GKTITLEVESSDTIDNVK  199


 Score =   306 bits (784),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  238  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  292

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  293  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  352

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  353  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  401



>ref|XP_010270791.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=382

 Score =   355 bits (912),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            +TLEVESSDTIDNVK
Sbjct  241  VTLEVESSDTIDNVK  255


 Score =   355 bits (912),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381



>ref|XP_007924320.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EHN05782.1| Ubi4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EME83800.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EWH17145.1| Ubi4p [Saccharomyces cerevisiae P283]
Length=229

 Score =   350 bits (897),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 175/179 (98%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   300 bits (769),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_003670049.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 ref|XP_003959063.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 ref|XP_004181533.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
 emb|CCD24806.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 emb|CCF59928.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 emb|CCH62014.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
Length=229

 Score =   350 bits (897),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 175/179 (98%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (775),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGM
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229



>ref|XP_010324327.1| PREDICTED: polyubiquitin isoform X2 [Solanum lycopersicum]
Length=381

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   352 bits (904),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPSDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (904),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   306 bits (784),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_009605659.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
Length=305

 Score =   352 bits (904),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLED RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDERTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (902),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLED RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDERTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|NP_001053957.1| Os04g0628100 [Oryza sativa Japonica Group]
 dbj|BAF15871.1| Os04g0628100 [Oryza sativa Japonica Group]
Length=392

 Score =   355 bits (912),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  77   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  131

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  132  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  191

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  192  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  251

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  252  ITLEVESSDTIDNVK  266


 Score =   355 bits (912),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  153  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  207

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  208  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  267

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  268  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  327

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  328  ITLEVESSDTIDNVK  342


 Score =   355 bits (910),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 180/185 (97%), Positives = 182/185 (98%), Gaps = 1/185 (1%)
 Frame = +2

Query  32   SCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  211
            SC + +MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  7    SCLF-QMQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  65

Query  212  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  391
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  66   TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  125

Query  392  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  571
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT
Sbjct  126  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  185

Query  572  IDNVK  586
            IDNVK
Sbjct  186  IDNVK  190


 Score =   306 bits (784),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  229  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  283

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  284  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  343

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  344  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  392



>ref|XP_719867.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 ref|XP_719750.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 emb|CAA76783.1| polyubiquitin [Candida albicans]
 gb|EAL00878.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 gb|EAL01003.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 gb|EEQ44747.1| hypothetical protein CAWG_03035 [Candida albicans WO-1]
 emb|CCE42351.1| hypothetical protein CPAR2_809000 [Candida parapsilosis]
 gb|EMG49099.1| hypothetical protein G210_0209 [Candida maltosa Xu316]
 gb|KHC79264.1| polyubiquitin [Candida albicans SC5314]
Length=229

 Score =   349 bits (896),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 175/179 (98%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   300 bits (769),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  229



>gb|KIM48035.1| hypothetical protein M413DRAFT_16078 [Hebeloma cylindrosporum 
h7]
Length=381

 Score =   355 bits (911),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 186/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L + LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVFRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   353 bits (906),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   351 bits (900),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/179 (98%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (776),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  380



>ref|XP_009631616.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=381

 Score =   355 bits (910),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   350 bits (898),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 180/195 (92%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+KA
Sbjct  121  FAGKQLEDGCTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   349 bits (896),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 176/179 (98%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+K
Sbjct  121  FAGKQLEDGCTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIK  179


 Score =   306 bits (783),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|AAQ07453.1| ubiquitin [Musa acuminata AAA Group]
Length=381

 Score =   355 bits (910),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   354 bits (908),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITL+VESSDTIDNVK
Sbjct  241  ITLKVESSDTIDNVK  255


 Score =   354 bits (908),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL+VESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   304 bits (778),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|EMS65864.1| Polyubiquitin [Triticum urartu]
Length=405

 Score =   355 bits (912),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   355 bits (912),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   355 bits (911),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (783),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 163/179 (91%), Gaps = 7/179 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--MQIFVKTLT  532
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  M  +V+  +
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGHVMHRYVRLFS  391



>gb|EPX74297.1| ubiquitin [Schizosaccharomyces octosporus yFS286]
Length=230

 Score =   349 bits (896),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 175/179 (98%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   300 bits (768),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_001797032.1| hypothetical protein SNOG_06667 [Phaeosphaeria nodorum SN15]
 gb|EAT86498.1| hypothetical protein SNOG_06667 [Phaeosphaeria nodorum SN15]
Length=234

 Score =   349 bits (896),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 175/179 (98%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   300 bits (768),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_010275241.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=383

 Score =   355 bits (910),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   353 bits (905),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KI DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KILDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   353 bits (905),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKILDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   306 bits (783),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_003052575.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU46862.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|ENH62031.1| Polyubiquitin [Fusarium oxysporum f. sp. cubense race 1]
 gb|EWG38736.1| polyubiquitin [Fusarium verticillioides 7600]
 gb|EWY88137.1| ubiquitin C [Fusarium oxysporum FOSC 3-a]
 gb|EWZ87537.1| ubiquitin C [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXA41161.1| ubiquitin C [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK33938.1| ubiquitin C [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK99281.1| ubiquitin C [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL44710.1| ubiquitin C [Fusarium oxysporum f. sp. radicis-lycopersici 26381]
 gb|EXL88175.1| ubiquitin C [Fusarium oxysporum f. sp. conglutinans race 2 54008]
 gb|EXM08998.1| ubiquitin C [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
 gb|EXM34538.1| ubiquitin C [Fusarium oxysporum f. sp. vasinfectum 25433]
 gb|KIL89583.1| polyubiquitin [Fusarium avenaceum]
Length=305

 Score =   352 bits (903),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 180/195 (92%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   351 bits (901),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 176/179 (98%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   301 bits (770),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|KJB62483.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=381

 Score =   355 bits (910),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   353 bits (906),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   352 bits (904),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   306 bits (784),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002980153.1| hypothetical protein SELMODRAFT_271419 [Selaginella moellendorffii]
 ref|XP_002991828.1| hypothetical protein SELMODRAFT_162003 [Selaginella moellendorffii]
 gb|EFJ07090.1| hypothetical protein SELMODRAFT_162003 [Selaginella moellendorffii]
 gb|EFJ19023.1| hypothetical protein SELMODRAFT_271419 [Selaginella moellendorffii]
Length=306

 Score =   352 bits (903),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 183/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   351 bits (900),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 156/168 (93%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CAB81074.1| polyubiquitin (ubq10) [Arabidopsis thaliana]
Length=464

 Score =   357 bits (917),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   357 bits (917),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   357 bits (917),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  392

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  393  ITLEVESSDTIDNVK  407


 Score =   357 bits (916),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 116/126 (92%), Gaps = 5/126 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  294  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  362  KIQDKE  379
            KIQDKE
Sbjct  409  KIQDKE  414



>ref|XP_010493589.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=430

 Score =   356 bits (914),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  189  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  243

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  244  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  303

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  304  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  363

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  364  ITLEVESSDTIDNVK  378


 Score =   355 bits (912),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +2

Query  44   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  223
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  46   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  105

Query  224  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  403
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  106  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  165

Query  404  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  583
            LIFAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  166  LIFAGKQLEDGHTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  225

Query  584  K  586
            K
Sbjct  226  K  226


 Score =   354 bits (908),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  113  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  167

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  168  FAGKQLEDGHTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  227

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  228  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  287

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  288  ITLEVESSDTIDNVK  302


 Score =   306 bits (784),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  265  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  319

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  320  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  379

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  380  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  427



>dbj|GAK65396.1| ubiquitin [Pseudozyma antarctica]
Length=334

 Score =   353 bits (905),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  95   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  149

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  150  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  209

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  210  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  269

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  270  ITLEVESSDTIDNVK  284


 Score =   352 bits (903),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  30   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  89

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  90   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  149

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  150  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  208


 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  171  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  225

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  226  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  285

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  286  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  333



>ref|XP_001755307.1| predicted protein [Physcomitrella patens]
 gb|EDQ79787.1| predicted protein [Physcomitrella patens]
Length=305

 Score =   352 bits (902),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 183/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   350 bits (899),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 156/168 (93%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_002953480.1| polyubiquitin [Volvox carteri f. nagariensis]
 gb|EFJ45453.1| polyubiquitin [Volvox carteri f. nagariensis]
Length=305

 Score =   352 bits (902),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 180/195 (92%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTI+NVK
Sbjct  241  ITLEVESSDTIENVK  255


 Score =   351 bits (900),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/179 (98%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVK  179


 Score =   304 bits (778),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 159/169 (94%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>gb|AAN31845.1| putative polyubiquitin (UBQ10) [Arabidopsis thaliana]
Length=464

 Score =   357 bits (916),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   357 bits (916),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   357 bits (916),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  392

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  393  ITLEVESSDTIDNVK  407


 Score =   356 bits (914),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 122/132 (92%), Gaps = 5/132 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  294  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  362  KIQDKEGIPPDQ  397
            KIQDKEGIPPDQ
Sbjct  409  KIQDKEGIPPDQ  420



>gb|ACX46987.1| ubiquitin [Guzmania wittmackii x Guzmania lingulata]
Length=441

 Score =   356 bits (914),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  392

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  393  ITLEVESSDTIDNVK  407


 Score =   355 bits (911),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   354 bits (909),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPP+QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPEQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   354 bits (909),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP+QQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPEQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   259 bits (663),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 135/145 (93%), Gaps = 5/145 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  294  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDG  436
            KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  409  KIQDKEGIPPDQQRLIFAGKQLEDG  433



>ref|XP_006372519.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP50316.1| polyubiquitin family protein [Populus trichocarpa]
Length=305

 Score =   351 bits (901),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 183/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   350 bits (899),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  508
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>gb|EMS60894.1| Polyubiquitin [Triticum urartu]
Length=458

 Score =   357 bits (915),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  230  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  289

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  290  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  349

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  350  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  408


 Score =   306 bits (784),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  295  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  349

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  350  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  409

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  410  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  457


 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/108 (97%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +2

Query  263  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  442
            RL   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  225  RLEKTMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  284

Query  443  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  285  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  332



>emb|CBY16339.1| unnamed protein product [Oikopleura dioica]
Length=188

 Score =   347 bits (889),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVK  179


 Score =   213 bits (543),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 116/127 (91%), Gaps = 5/127 (4%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180

Query  362  KIQDKEG  382
            KIQDKE 
Sbjct  181  KIQDKEA  187



>gb|AFK47245.1| unknown [Medicago truncatula]
Length=233

 Score =   348 bits (894),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 175/179 (98%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTI LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTIILEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL+
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLV  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKALTGKTITLEVESSDTIDNVK  179


 Score =   298 bits (763),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 155/168 (92%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL+
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLV  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKALTGKTITLEVESSDTIDNVKA  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLAD NIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADNNIQKESTLHLVLRLRGG  228



>ref|XP_002551324.1| ubiquitin [Candida tropicalis MYA-3404]
 gb|EER30626.1| ubiquitin [Candida tropicalis MYA-3404]
Length=299

 Score =   351 bits (900),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/195 (92%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   350 bits (898),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 175/179 (98%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 147/159 (92%), Gaps = 5/159 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  478
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNI K++ L
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNISKKNLL  295



>ref|XP_009784908.1| PREDICTED: polyubiquitin-like isoform X2 [Nicotiana sylvestris]
Length=449

 Score =   356 bits (914),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  392

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  393  ITLEVESSDTIDNVK  407


 Score =   355 bits (911),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   354 bits (909),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  241  ITLEVESSDTIDNVK  255


 Score =   354 bits (909),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 184/195 (94%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  317  ITLEVESSDTIDNVK  331


 Score =   292 bits (747),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/161 (93%), Positives = 151/161 (94%), Gaps = 5/161 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  294  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  484
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  409  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  449



>gb|AIS40894.1| polyubiquitin [Kalanchoe fedtschenkoi]
Length=470

 Score =   357 bits (915),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 180/180 (100%), Positives = 180/180 (100%), Gaps = 0/180 (0%)
 Frame = +2

Query  47   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  226
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  13   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  72

Query  227  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  406
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  73   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  132

Query  407  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  133  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  192


 Score =   356 bits (913),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  79   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  133

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  134  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  193

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  194  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  253

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  254  ITLEVESSDTIDNVK  268


 Score =   356 bits (913),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  155  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  209

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  210  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  269

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  270  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  329

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  330  ITLEVESSDTIDNVK  344


 Score =   356 bits (913),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 185/195 (95%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  231  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  285

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  286  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  345

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  541
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  346  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  405

Query  542  ITLEVESSDTIDNVK  586
            ITLEVESSDTIDNVK
Sbjct  406  ITLEVESSDTIDNVK  420


 Score =   306 bits (783),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  307  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  361

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  362  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  421

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  422  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  469



>gb|KIM22018.1| hypothetical protein M408DRAFT_333137 [Serendipita vermifera 
MAFF 305830]
Length=229

 Score =   348 bits (893),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 175/179 (98%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 156/168 (93%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_003010029.1| polyubiquitin UbiD/Ubi4, putative [Arthroderma benhamiae CBS 
112371]
 ref|XP_003170928.1| ubiquitin [Microsporum gypseum CBS 118893]
 ref|XP_003232289.1| polyubiquitin [Trichophyton rubrum CBS 118892]
 gb|EFE29389.1| polyubiquitin UbiD/Ubi4, putative [Arthroderma benhamiae CBS 
112371]
 gb|EFR03920.1| ubiquitin [Microsporum gypseum CBS 118893]
 gb|EGD90914.1| polyubiquitin [Trichophyton rubrum CBS 118892]
 gb|EGD97992.1| polyubiquitin [Trichophyton tonsurans CBS 112818]
 gb|EGE04992.1| ubiquitin [Trichophyton equinum CBS 127.97]
 gb|EZF26278.1| polyubiquitin [Trichophyton rubrum MR850]
 gb|EZF31874.1| polyubiquitin [Trichophyton interdigitale H6]
 gb|EZF45312.1| polyubiquitin [Trichophyton rubrum CBS 100081]
 gb|EZF56062.1| polyubiquitin [Trichophyton rubrum CBS 288.86]
 gb|EZF66560.1| polyubiquitin [Trichophyton rubrum CBS 289.86]
 gb|EZF77169.1| polyubiquitin [Trichophyton soudanense CBS 452.61]
 gb|EZF87859.1| polyubiquitin [Trichophyton rubrum MR1448]
 gb|EZG09817.1| polyubiquitin [Trichophyton rubrum CBS 735.88]
 gb|EZG20358.1| polyubiquitin [Trichophyton rubrum CBS 202.88]
 gb|KDB20983.1| polyubiquitin [Trichophyton interdigitale MR816]
 gb|KDB37038.1| polyubiquitin [Trichophyton rubrum D6]
Length=229

 Score =   348 bits (893),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 175/179 (98%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +2

Query  50   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  229
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  230  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  409
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  410  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  586
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 156/168 (93%), Gaps = 5/168 (3%)
 Frame = +2

Query  2    SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  181
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  182  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  361
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  362  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  505
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737611932690