BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS053A06

Length=581
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU36508.1|  hypothetical protein MIMGU_mgv1a008665mg                243   8e-76   Erythranthe guttata [common monkey flower]
ref|XP_011074175.1|  PREDICTED: uncharacterized methyltransferase...    233   8e-72   Sesamum indicum [beniseed]
emb|CDP01043.1|  unnamed protein product                                226   6e-69   Coffea canephora [robusta coffee]
ref|XP_003522802.1|  PREDICTED: uncharacterized methyltransferase...    219   1e-66   Glycine max [soybeans]
ref|XP_008219673.1|  PREDICTED: uncharacterized methyltransferase...    219   1e-66   Prunus mume [ume]
ref|XP_002302290.2|  hypothetical protein POPTR_0002s09570g             219   2e-66   Populus trichocarpa [western balsam poplar]
ref|XP_006386404.1|  hypothetical protein POPTR_0002s09570g             219   3e-66   
gb|AFK47008.1|  unknown                                                 217   9e-66   Lotus japonicus
ref|XP_007222212.1|  hypothetical protein PRUPE_ppa007824mg             217   1e-65   Prunus persica
ref|XP_004500619.1|  PREDICTED: uncharacterized methyltransferase...    216   1e-65   Cicer arietinum [garbanzo]
ref|XP_007136240.1|  hypothetical protein PHAVU_009G030200g             216   5e-65   Phaseolus vulgaris [French bean]
gb|KHN19749.1|  Putative methyltransferase, chloroplastic               215   7e-65   Glycine soja [wild soybean]
ref|XP_011016296.1|  PREDICTED: uncharacterized methyltransferase...    215   1e-64   Populus euphratica
ref|XP_002285799.1|  PREDICTED: uncharacterized methyltransferase...    213   6e-64   Vitis vinifera
gb|KDO80936.1|  hypothetical protein CISIN_1g018003mg                   207   2e-63   Citrus sinensis [apfelsine]
ref|XP_006434006.1|  hypothetical protein CICLE_v10001682mg             208   5e-63   
gb|KEH34908.1|  S-adenosylmethionine-dependent methyltransferase        209   7e-63   Medicago truncatula
gb|KDO80930.1|  hypothetical protein CISIN_1g018003mg                   207   4e-62   Citrus sinensis [apfelsine]
gb|KDO80931.1|  hypothetical protein CISIN_1g018003mg                   207   6e-62   Citrus sinensis [apfelsine]
ref|XP_006434005.1|  hypothetical protein CICLE_v10001682mg             207   6e-62   
ref|XP_010269234.1|  PREDICTED: uncharacterized methyltransferase...    206   1e-61   Nelumbo nucifera [Indian lotus]
gb|KDO80933.1|  hypothetical protein CISIN_1g018003mg                   207   1e-61   Citrus sinensis [apfelsine]
ref|XP_006472620.1|  PREDICTED: uncharacterized methyltransferase...    206   1e-61   
ref|XP_010059991.1|  PREDICTED: uncharacterized methyltransferase...    206   2e-61   Eucalyptus grandis [rose gum]
ref|XP_008391080.1|  PREDICTED: uncharacterized methyltransferase...    199   2e-58   
ref|XP_008348560.1|  PREDICTED: uncharacterized methyltransferase...    200   3e-58   
ref|XP_004299641.1|  PREDICTED: uncharacterized methyltransferase...    197   4e-58   Fragaria vesca subsp. vesca
ref|XP_010064389.1|  PREDICTED: uncharacterized methyltransferase...    192   4e-56   
gb|KDP41368.1|  hypothetical protein JCGZ_15775                         189   5e-55   Jatropha curcas
ref|XP_002889176.1|  predicted protein                                  189   8e-55   
ref|XP_007018799.1|  S-adenosylmethionine-dependent methyltransfe...    189   1e-54   
ref|XP_002513908.1|  S-adenosylmethionine-dependent methyltransfe...    188   2e-54   
ref|XP_006390018.1|  hypothetical protein EUTSA_v10018789mg             187   2e-54   Eutrema salsugineum [saltwater cress]
ref|XP_006300528.1|  hypothetical protein CARUB_v10020572mg             186   1e-53   
ref|XP_010064206.1|  PREDICTED: uncharacterized methyltransferase...    185   2e-53   Eucalyptus grandis [rose gum]
ref|XP_009373157.1|  PREDICTED: uncharacterized methyltransferase...    184   4e-53   Pyrus x bretschneideri [bai li]
ref|XP_010472020.1|  PREDICTED: uncharacterized methyltransferase...    184   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010472019.1|  PREDICTED: uncharacterized methyltransferase...    184   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_009394965.1|  PREDICTED: uncharacterized methyltransferase...    183   2e-52   
ref|XP_009394966.1|  PREDICTED: uncharacterized methyltransferase...    181   2e-52   
ref|XP_010061813.1|  PREDICTED: uncharacterized methyltransferase...    182   2e-52   Eucalyptus grandis [rose gum]
ref|XP_008374425.1|  PREDICTED: uncharacterized methyltransferase...    182   2e-52   
ref|XP_008374562.1|  PREDICTED: uncharacterized methyltransferase...    182   3e-52   
ref|XP_010428929.1|  PREDICTED: uncharacterized methyltransferase...    182   3e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010428930.1|  PREDICTED: uncharacterized methyltransferase...    182   3e-52   Camelina sativa [gold-of-pleasure]
ref|NP_565170.1|  S-adenosyl-L-methionine-dependent methyltransfe...    182   5e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009128280.1|  PREDICTED: uncharacterized methyltransferase...    181   7e-52   Brassica rapa
gb|AAG52104.1|AC012680_15  hypothetical protein; 38642-36701            180   7e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416782.1|  PREDICTED: uncharacterized methyltransferase...    181   7e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010416783.1|  PREDICTED: uncharacterized methyltransferase...    181   8e-52   Camelina sativa [gold-of-pleasure]
ref|XP_009394964.1|  PREDICTED: uncharacterized methyltransferase...    181   8e-52   
emb|CDY26853.1|  BnaA02g18780D                                          181   1e-51   Brassica napus [oilseed rape]
gb|KCW67137.1|  hypothetical protein EUGRSUZ_F00926                     179   1e-51   Eucalyptus grandis [rose gum]
ref|XP_010534072.1|  PREDICTED: uncharacterized methyltransferase...    176   8e-51   
ref|XP_010534071.1|  PREDICTED: uncharacterized methyltransferase...    177   4e-50   
ref|XP_010534070.1|  PREDICTED: uncharacterized methyltransferase...    177   5e-50   Tarenaya hassleriana [spider flower]
emb|CDY14625.1|  BnaC02g24880D                                          176   5e-50   Brassica napus [oilseed rape]
ref|XP_006472621.1|  PREDICTED: uncharacterized methyltransferase...    174   3e-49   
ref|XP_008356589.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    171   5e-49   
gb|KJB59929.1|  hypothetical protein B456_009G281700                    174   6e-49   Gossypium raimondii
ref|XP_008374488.1|  PREDICTED: uncharacterized methyltransferase...    173   6e-49   
emb|CDX88421.1|  BnaC06g38650D                                          172   2e-48   
gb|KHG01878.1|  hypothetical protein F383_23026                         171   8e-48   Gossypium arboreum [tree cotton]
ref|XP_010937469.1|  PREDICTED: uncharacterized methyltransferase...    168   5e-47   Elaeis guineensis
ref|XP_009106463.1|  PREDICTED: uncharacterized methyltransferase...    167   1e-46   
ref|XP_008808068.1|  PREDICTED: uncharacterized methyltransferase...    167   2e-46   Phoenix dactylifera
gb|KJB59930.1|  hypothetical protein B456_009G281700                    164   2e-46   Gossypium raimondii
ref|XP_008391145.1|  PREDICTED: uncharacterized methyltransferase...    163   2e-45   
ref|XP_008466034.1|  PREDICTED: uncharacterized methyltransferase...    165   2e-45   Cucumis melo [Oriental melon]
ref|XP_009106462.1|  PREDICTED: uncharacterized methyltransferase...    164   2e-45   Brassica rapa
gb|KJB59931.1|  hypothetical protein B456_009G281700                    164   2e-45   Gossypium raimondii
emb|CDX87473.1|  BnaA07g34000D                                          164   4e-45   
ref|XP_010105909.1|  putative methyltransferase                         159   2e-44   
ref|XP_008790838.1|  PREDICTED: uncharacterized methyltransferase...    160   5e-44   Phoenix dactylifera
ref|XP_008790837.1|  PREDICTED: uncharacterized methyltransferase...    159   6e-44   
ref|XP_004136403.1|  PREDICTED: uncharacterized methyltransferase...    159   1e-43   
ref|XP_004161765.1|  PREDICTED: uncharacterized methyltransferase...    158   6e-43   
ref|XP_010667997.1|  PREDICTED: uncharacterized methyltransferase...    157   7e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002268200.1|  PREDICTED: uncharacterized methyltransferase...    157   1e-42   Vitis vinifera
emb|CBI25578.3|  unnamed protein product                                156   1e-42   Vitis vinifera
ref|XP_010656529.1|  PREDICTED: uncharacterized methyltransferase...    156   2e-42   Vitis vinifera
emb|CDP10502.1|  unnamed protein product                                155   4e-42   Coffea canephora [robusta coffee]
ref|XP_011017926.1|  PREDICTED: uncharacterized methyltransferase...    154   1e-41   Populus euphratica
gb|KJB53959.1|  hypothetical protein B456_009G013400                    152   1e-41   Gossypium raimondii
gb|KJB14720.1|  hypothetical protein B456_002G140100                    154   2e-41   Gossypium raimondii
ref|XP_009363912.1|  PREDICTED: uncharacterized methyltransferase...    153   3e-41   Pyrus x bretschneideri [bai li]
ref|XP_004973409.1|  PREDICTED: uncharacterized methyltransferase...    153   4e-41   Setaria italica
gb|KJB53958.1|  hypothetical protein B456_009G013400                    152   5e-41   Gossypium raimondii
ref|XP_006659389.1|  PREDICTED: uncharacterized methyltransferase...    152   8e-41   
ref|XP_008788786.1|  PREDICTED: uncharacterized methyltransferase...    152   8e-41   
gb|KJB27062.1|  hypothetical protein B456_004G275300                    151   1e-40   Gossypium raimondii
gb|KJB27061.1|  hypothetical protein B456_004G275300                    151   2e-40   Gossypium raimondii
ref|XP_006473930.1|  PREDICTED: uncharacterized methyltransferase...    150   2e-40   
ref|XP_010939635.1|  PREDICTED: uncharacterized methyltransferase...    149   6e-40   Elaeis guineensis
ref|XP_002324579.2|  methyltransferase-related family protein           149   8e-40   
ref|XP_006453728.1|  hypothetical protein CICLE_v10008875mg             149   8e-40   Citrus clementina [clementine]
gb|KDO59315.1|  hypothetical protein CISIN_1g019950mg                   148   9e-40   Citrus sinensis [apfelsine]
ref|XP_011470680.1|  PREDICTED: uncharacterized methyltransferase...    149   9e-40   Fragaria vesca subsp. vesca
gb|KHG26587.1|  hypothetical protein F383_01046                         149   1e-39   Gossypium arboreum [tree cotton]
gb|KDO59313.1|  hypothetical protein CISIN_1g019950mg                   149   1e-39   Citrus sinensis [apfelsine]
gb|AFK46366.1|  unknown                                                 149   1e-39   Medicago truncatula
gb|KDO59316.1|  hypothetical protein CISIN_1g019950mg                   148   1e-39   Citrus sinensis [apfelsine]
gb|ACJ84583.1|  unknown                                                 149   1e-39   Medicago truncatula
gb|KDO59317.1|  hypothetical protein CISIN_1g019950mg                   148   1e-39   Citrus sinensis [apfelsine]
ref|XP_006359517.1|  PREDICTED: uncharacterized methyltransferase...    149   1e-39   Solanum tuberosum [potatoes]
ref|XP_009802104.1|  PREDICTED: uncharacterized methyltransferase...    149   1e-39   Nicotiana sylvestris
ref|XP_008336951.1|  PREDICTED: uncharacterized methyltransferase...    149   2e-39   
gb|ABR16838.1|  unknown                                                 148   2e-39   Picea sitchensis
ref|XP_004974685.1|  PREDICTED: uncharacterized methyltransferase...    148   2e-39   
ref|XP_002445476.1|  hypothetical protein SORBIDRAFT_07g020130          148   2e-39   Sorghum bicolor [broomcorn]
ref|XP_003574470.1|  PREDICTED: uncharacterized methyltransferase...    148   3e-39   Brachypodium distachyon [annual false brome]
ref|XP_010687777.1|  PREDICTED: uncharacterized methyltransferase...    148   3e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011470644.1|  PREDICTED: uncharacterized methyltransferase...    147   3e-39   Fragaria vesca subsp. vesca
ref|XP_004287240.1|  PREDICTED: uncharacterized methyltransferase...    147   3e-39   Fragaria vesca subsp. vesca
ref|XP_011020252.1|  PREDICTED: uncharacterized methyltransferase...    147   4e-39   Populus euphratica
ref|XP_011078555.1|  PREDICTED: uncharacterized methyltransferase...    147   6e-39   Sesamum indicum [beniseed]
ref|XP_002531454.1|  phosphatidylethanolamine n-methyltransferase...    145   6e-39   
ref|XP_002268107.1|  PREDICTED: uncharacterized methyltransferase...    147   7e-39   Vitis vinifera
ref|XP_004488470.1|  PREDICTED: uncharacterized methyltransferase...    147   8e-39   Cicer arietinum [garbanzo]
ref|XP_004965743.1|  PREDICTED: uncharacterized methyltransferase...    145   8e-39   Setaria italica
ref|XP_004242718.1|  PREDICTED: uncharacterized methyltransferase...    147   8e-39   Solanum lycopersicum
ref|XP_008389527.1|  PREDICTED: uncharacterized methyltransferase...    145   1e-38   
ref|XP_006852799.1|  hypothetical protein AMTR_s00033p00159870          146   1e-38   
gb|EEC83568.1|  hypothetical protein OsI_29220                          146   1e-38   Oryza sativa Indica Group [Indian rice]
ref|NP_001061786.1|  Os08g0411200                                       146   2e-38   
gb|KJB53960.1|  hypothetical protein B456_009G013400                    145   2e-38   Gossypium raimondii
gb|KDP30197.1|  hypothetical protein JCGZ_16979                         146   2e-38   Jatropha curcas
ref|XP_004242719.1|  PREDICTED: uncharacterized methyltransferase...    145   2e-38   Solanum lycopersicum
ref|NP_001132053.1|  uncharacterized LOC100193465                       146   2e-38   Zea mays [maize]
ref|XP_004965742.1|  PREDICTED: uncharacterized methyltransferase...    146   2e-38   Setaria italica
gb|ACG27569.1|  S-adenosylmethionine-dependent methyltransferase        145   2e-38   Zea mays [maize]
gb|EMT07919.1|  Putative methyltransferase                              146   2e-38   
gb|EEE68668.1|  hypothetical protein OsJ_27281                          146   2e-38   Oryza sativa Japonica Group [Japonica rice]
gb|ACF85541.1|  unknown                                                 145   2e-38   Zea mays [maize]
ref|XP_006359516.1|  PREDICTED: uncharacterized methyltransferase...    145   3e-38   Solanum tuberosum [potatoes]
ref|XP_002438745.1|  hypothetical protein SORBIDRAFT_10g025400          145   3e-38   Sorghum bicolor [broomcorn]
dbj|BAF93193.1|  putative methyltransferase-like                        140   5e-38   Hordeum vulgare [barley]
ref|NP_001150427.1|  S-adenosylmethionine-dependent methyltransfe...    144   6e-38   Zea mays [maize]
gb|KHG21340.1|  hypothetical protein F383_03824                         145   8e-38   Gossypium arboreum [tree cotton]
ref|XP_010099510.1|  putative methyltransferase                         144   1e-37   Morus notabilis
ref|XP_002988667.1|  hypothetical protein SELMODRAFT_46133              142   1e-37   
ref|XP_010928269.1|  PREDICTED: uncharacterized methyltransferase...    143   1e-37   
ref|XP_010928267.1|  PREDICTED: uncharacterized methyltransferase...    144   1e-37   Elaeis guineensis
ref|XP_003546595.1|  PREDICTED: uncharacterized methyltransferase...    143   2e-37   Glycine max [soybeans]
ref|XP_009358530.1|  PREDICTED: uncharacterized methyltransferase...    143   2e-37   
ref|XP_007013645.1|  S-adenosyl-L-methionine-dependent methyltran...    143   2e-37   
ref|XP_003563313.1|  PREDICTED: uncharacterized methyltransferase...    143   2e-37   Brachypodium distachyon [annual false brome]
ref|XP_009338403.1|  PREDICTED: uncharacterized methyltransferase...    143   2e-37   Pyrus x bretschneideri [bai li]
ref|XP_009338401.1|  PREDICTED: uncharacterized methyltransferase...    143   3e-37   Pyrus x bretschneideri [bai li]
ref|XP_006381066.1|  methyltransferase-related family protein           142   3e-37   
ref|XP_010042876.1|  PREDICTED: uncharacterized methyltransferase...    138   3e-37   
gb|EYU34934.1|  hypothetical protein MIMGU_mgv1a009522mg                142   4e-37   Erythranthe guttata [common monkey flower]
dbj|BAJ94151.1|  predicted protein                                      142   5e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002986403.1|  hypothetical protein SELMODRAFT_235009             142   7e-37   Selaginella moellendorffii
dbj|BAJ91607.1|  predicted protein                                      142   7e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN28439.1|  Putative methyltransferase, chloroplastic               141   8e-37   Glycine soja [wild soybean]
ref|XP_009386973.1|  PREDICTED: uncharacterized methyltransferase...    141   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007202300.1|  hypothetical protein PRUPE_ppa007882mg             140   2e-36   Prunus persica
ref|XP_010533098.1|  PREDICTED: uncharacterized methyltransferase...    140   2e-36   Tarenaya hassleriana [spider flower]
ref|XP_010050326.1|  PREDICTED: uncharacterized methyltransferase...    140   3e-36   Eucalyptus grandis [rose gum]
ref|NP_001242875.1|  uncharacterized protein LOC100798970               140   3e-36   
ref|XP_010250394.1|  PREDICTED: uncharacterized protein LOC104592660    144   4e-36   
gb|EMT30153.1|  Putative methyltransferase                              140   4e-36   
gb|AEJ88263.1|  putative S-adenosylmethionine-dependent methyltra...    137   6e-36   Wolffia arrhiza
ref|XP_009141962.1|  PREDICTED: uncharacterized methyltransferase...    139   6e-36   Brassica rapa
ref|XP_001778776.1|  predicted protein                                  138   6e-36   
emb|CDY57579.1|  BnaC04g56820D                                          139   1e-35   Brassica napus [oilseed rape]
gb|KCW45297.1|  hypothetical protein EUGRSUZ_L01041                     136   1e-35   Eucalyptus grandis [rose gum]
ref|XP_010040339.1|  PREDICTED: uncharacterized methyltransferase...    135   3e-35   Eucalyptus grandis [rose gum]
ref|XP_010928270.1|  PREDICTED: uncharacterized methyltransferase...    137   3e-35   
gb|KDO59312.1|  hypothetical protein CISIN_1g019950mg                   137   3e-35   Citrus sinensis [apfelsine]
ref|XP_010928268.1|  PREDICTED: uncharacterized methyltransferase...    137   3e-35   
ref|XP_002306578.1|  methyltransferase-related family protein           135   3e-35   
gb|KCW79027.1|  hypothetical protein EUGRSUZ_C00449                     136   4e-35   Eucalyptus grandis [rose gum]
gb|KCW79026.1|  hypothetical protein EUGRSUZ_C00449                     136   5e-35   Eucalyptus grandis [rose gum]
ref|XP_010047200.1|  PREDICTED: uncharacterized methyltransferase...    136   6e-35   Eucalyptus grandis [rose gum]
ref|XP_006411367.1|  hypothetical protein EUTSA_v10016844mg             136   8e-35   Eutrema salsugineum [saltwater cress]
ref|NP_001058196.1|  Os06g0646000                                       136   9e-35   
ref|XP_006657188.1|  PREDICTED: uncharacterized methyltransferase...    136   9e-35   
ref|XP_006293382.1|  hypothetical protein CARUB_v10023510mg             136   1e-34   Capsella rubella
ref|XP_008456635.1|  PREDICTED: uncharacterized methyltransferase...    135   1e-34   Cucumis melo [Oriental melon]
ref|XP_004167998.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    135   1e-34   
ref|XP_008456627.1|  PREDICTED: uncharacterized methyltransferase...    135   1e-34   Cucumis melo [Oriental melon]
ref|XP_006586686.1|  PREDICTED: uncharacterized protein LOC100798...    135   2e-34   Glycine max [soybeans]
ref|XP_010505866.1|  PREDICTED: uncharacterized methyltransferase...    135   2e-34   Camelina sativa [gold-of-pleasure]
ref|NP_181637.2|  uncharacterized methyltransferase                     135   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508773.1|  PREDICTED: uncharacterized methyltransferase...    135   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_004287239.1|  PREDICTED: uncharacterized methyltransferase...    134   3e-34   Fragaria vesca subsp. vesca
gb|KFK36957.1|  hypothetical protein AALP_AA4G194500                    134   4e-34   Arabis alpina [alpine rockcress]
ref|XP_010517586.1|  PREDICTED: uncharacterized methyltransferase...    134   6e-34   Camelina sativa [gold-of-pleasure]
ref|XP_004139262.1|  PREDICTED: uncharacterized methyltransferase...    134   6e-34   Cucumis sativus [cucumbers]
gb|KGN60753.1|  hypothetical protein Csa_2G009410                       134   7e-34   Cucumis sativus [cucumbers]
emb|CDY06948.1|  BnaA04g23670D                                          137   2e-33   
ref|XP_002879904.1|  hypothetical protein ARALYDRAFT_903411             130   1e-32   
gb|KDO80932.1|  hypothetical protein CISIN_1g018003mg                   126   6e-32   Citrus sinensis [apfelsine]
ref|XP_006434004.1|  hypothetical protein CICLE_v10001682mg             126   6e-32   
ref|XP_006826926.1|  hypothetical protein AMTR_s00010p00172800          125   8e-32   
gb|EMT00494.1|  Putative methyltransferase                              128   3e-31   
ref|XP_008242913.1|  PREDICTED: uncharacterized methyltransferase...    122   4e-30   
gb|AAD12007.1|  hypothetical protein                                    119   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009595293.1|  PREDICTED: uncharacterized methyltransferase...    116   5e-29   Nicotiana tomentosiformis
ref|XP_009595292.1|  PREDICTED: uncharacterized methyltransferase...    116   7e-29   Nicotiana tomentosiformis
gb|EMT14235.1|  Putative methyltransferase                              121   7e-29   
gb|AFW76187.1|  hypothetical protein ZEAMMB73_680706                    116   9e-29   
gb|KEH37884.1|  S-adenosylmethionine-dependent methyltransferase        116   7e-28   Medicago truncatula
ref|XP_005643537.1|  S-adenosyl-L-methionine-dependent methyltran...    115   3e-27   Coccomyxa subellipsoidea C-169
gb|EPS57983.1|  hypothetical protein M569_16834                         108   2e-26   Genlisea aurea
gb|KHN03912.1|  Putative methyltransferase, chloroplastic               110   4e-26   Glycine soja [wild soybean]
ref|XP_003527908.1|  PREDICTED: uncharacterized methyltransferase...    110   8e-26   
ref|XP_008336947.1|  PREDICTED: uncharacterized methyltransferase...    111   1e-25   
ref|XP_008336950.1|  PREDICTED: uncharacterized methyltransferase...    111   1e-25   
dbj|BAC99645.1|  hypothetical protein                                   103   5e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008344066.1|  PREDICTED: uncharacterized methyltransferase...    103   7e-23   
gb|ACF86599.1|  unknown                                                 100   1e-22   Zea mays [maize]
ref|XP_002954755.1|  hypothetical protein VOLCADRAFT_106536             102   3e-22   Volvox carteri f. nagariensis
ref|XP_001694737.1|  predicted protein                                  100   5e-22   Chlamydomonas reinhardtii
emb|CDP12319.1|  unnamed protein product                              97.1    8e-22   Coffea canephora [robusta coffee]
ref|XP_002968407.1|  hypothetical protein SELMODRAFT_89857            98.2    5e-21   
gb|KGN60339.1|  hypothetical protein Csa_3G895850                     95.1    2e-20   Cucumis sativus [cucumbers]
gb|KGN60338.1|  hypothetical protein Csa_3G895840                     94.0    3e-20   Cucumis sativus [cucumbers]
emb|CAN77779.1|  hypothetical protein VITISV_004172                   95.1    5e-19   Vitis vinifera
ref|XP_005842697.1|  hypothetical protein CHLNCDRAFT_136276           89.0    2e-18   Chlorella variabilis
ref|XP_006473932.1|  PREDICTED: uncharacterized methyltransferase...  80.9    1e-15   Citrus sinensis [apfelsine]
ref|XP_006474605.1|  PREDICTED: uncharacterized methyltransferase...  80.5    2e-15   Citrus sinensis [apfelsine]
ref|XP_002960327.1|  hypothetical protein SELMODRAFT_402502           81.3    2e-14   
ref|XP_003056709.1|  predicted protein                                78.6    6e-14   Micromonas pusilla CCMP1545
ref|XP_002306577.1|  hypothetical protein POPTR_0005s17000g           74.7    1e-13   
ref|XP_007510827.1|  predicted protein                                76.3    4e-13   Bathycoccus prasinos
ref|XP_002967385.1|  hypothetical protein SELMODRAFT_408369           77.4    6e-13   
ref|XP_005824779.1|  hypothetical protein GUITHDRAFT_116106           75.1    9e-13   Guillardia theta CCMP2712
ref|XP_002500021.1|  predicted protein                                72.4    1e-11   Micromonas commoda
ref|XP_005713645.1|  unnamed protein product                          68.2    1e-10   Chondrus crispus [carageen]
ref|XP_005536724.1|  hypothetical protein, conserved                  68.6    3e-10   Cyanidioschyzon merolae strain 10D
ref|XP_003057905.1|  predicted protein                                66.2    4e-10   Micromonas pusilla CCMP1545
ref|XP_002992310.1|  hypothetical protein SELMODRAFT_430530           65.9    4e-10   
ref|XP_001418638.1|  predicted protein                                65.9    4e-10   Ostreococcus lucimarinus CCE9901
ref|XP_010040340.1|  PREDICTED: uncharacterized methyltransferase...  64.7    5e-10   
gb|EWM24600.1|  phosphatidylethanolamine n                            67.4    5e-10   Nannochloropsis gaditana
ref|XP_003080221.1|  methyltransferase-related (ISS)                  67.4    6e-10   Ostreococcus tauri
gb|KCW45298.1|  hypothetical protein EUGRSUZ_L01042                   63.9    8e-10   Eucalyptus grandis [rose gum]
ref|XP_005855405.1|  hypothetical protein NGA_2005920                 66.6    9e-10   Nannochloropsis gaditana CCMP526
ref|XP_002506188.1|  predicted protein                                66.2    1e-09   Micromonas commoda
ref|XP_005781281.1|  hypothetical protein EMIHUDRAFT_442892           66.2    2e-09   Emiliania huxleyi CCMP1516
ref|XP_002185698.1|  predicted protein                                65.9    2e-09   Phaeodactylum tricornutum CCAP 1055/1
gb|EJK66010.1|  hypothetical protein THAOC_13088                      64.3    7e-09   Thalassiosira oceanica
emb|CBJ26935.1|  S-adenosyl-L-methionine-dependent methyltransfer...  63.2    2e-08   Ectocarpus siliculosus
ref|XP_007514982.1|  predicted protein                                61.6    5e-08   Bathycoccus prasinos
gb|EMS47735.1|  hypothetical protein TRIUR3_02804                     60.5    5e-08   Triticum urartu
dbj|BAH19476.1|  AT2G41040                                            55.1    1e-06   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA49105.1|  TPA: hypothetical protein ZEAMMB73_519956            53.9    3e-06   
ref|XP_005705444.1|  phosphatidylethanolamine n-methyltransferase...  55.5    5e-06   Galdieria sulphuraria
ref|XP_007227385.1|  hypothetical protein PRUPE_ppb016862mg           53.1    1e-05   
ref|WP_006561654.1|  type 11 methyltransferase                        48.9    7e-04   Oscillochloris trichoides



>gb|EYU36508.1| hypothetical protein MIMGU_mgv1a008665mg [Erythranthe guttata]
Length=366

 Score =   243 bits (621),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 151/206 (73%), Gaps = 14/206 (7%)
 Frame = +1

Query  4    MATAGLG----YVSAVLVTRKLGYNS-----KFSFSPLTPKAN---RLFAVKIRALST--  141
            MA AG G     + A L+  +L +N      +   SPL+  A    RLF  K+RA S+  
Sbjct  5    MAIAGTGNNTSSLPAALLPSRLRFNPMPSCLRVVKSPLSIPARIRRRLFTDKVRASSSAA  64

Query  142  TFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYS  321
              +E  P  ++DEKK+ IR N+LACPIC++   WNGD  LSL S+A+S+LEC TC+K YS
Sbjct  65   VVIETTPDPIVDEKKLNIRKNVLACPICFERVIWNGDSNLSLESVARSSLECKTCKKLYS  124

Query  322  GNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFEL  501
            G ++H+DLTI GGGK YGE + ASTELFR PLVSFLYERGWR SFS+WGGFPGPEKEFEL
Sbjct  125  GKDSHLDLTITGGGKVYGEPMPASTELFRFPLVSFLYERGWRQSFSIWGGFPGPEKEFEL  184

Query  502  MQDYLKPVMGGNIIDASCGSGLFSRL  579
            ++DYLKPV+GG+IIDASCGSG+FSRL
Sbjct  185  IKDYLKPVLGGSIIDASCGSGMFSRL  210



>ref|XP_011074175.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Sesamum indicum]
Length=360

 Score =   233 bits (594),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 127/158 (80%), Gaps = 0/158 (0%)
 Frame = +1

Query  106  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  285
            RL   ++RA S   VE KP  ++ E K+ IR N+LACPICY+   WNGDP LSL S+A+S
Sbjct  48   RLLTHEVRASSAATVETKPDPVVKETKLNIRKNILACPICYERLIWNGDPDLSLESVARS  107

Query  286  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLW  465
             L+CSTCRK YSG  +H+DLTI G GK YG+ +AASTE+FR PLVSFLYERGWR SFS W
Sbjct  108  TLQCSTCRKTYSGEGSHLDLTITGRGKVYGDPVAASTEIFRSPLVSFLYERGWRQSFSFW  167

Query  466  GGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            GGFPGPEKE+ L+++YLKPV+GGNIIDASCGSG+FSRL
Sbjct  168  GGFPGPEKEYVLVKEYLKPVLGGNIIDASCGSGMFSRL  205



>emb|CDP01043.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   226 bits (575),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 122/167 (73%), Gaps = 1/167 (1%)
 Frame = +1

Query  79   FSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPG  258
            F P T K N   A +IRA ST  VE KP  ++DEKK++   N LACPICY    +  D  
Sbjct  38   FIPQTIK-NAFAATRIRATSTLLVETKPDTILDEKKLDSCKNTLACPICYTPLIYTADSS  96

Query  259  LSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYER  438
                S A+ NL C TCRK YSGN+TH+DLTI  G K YGEA+ ASTELFR P VSFLYER
Sbjct  97   FPADSAARPNLRCRTCRKAYSGNDTHLDLTITSGSKGYGEAMPASTELFRFPFVSFLYER  156

Query  439  GWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            GWR SFS+WGGFPGPEKEFEL++DYL PV+GG I+DASCGSG+FSRL
Sbjct  157  GWRQSFSIWGGFPGPEKEFELIKDYLNPVLGGTIVDASCGSGMFSRL  203



>ref|XP_003522802.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Glycine max]
Length=352

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 128/160 (80%), Gaps = 6/160 (4%)
 Frame = +1

Query  118  VKIRALSTTFV--EDKPVR---LIDEKKVEIRT-NLLACPICYDAFTWNGDPGLSLSSMA  279
            ++ RA ST+F+  E  P     ++ EK V  R+ N LACP+CYD+ TWNGDPG S+ ++ 
Sbjct  38   LQFRASSTSFIDTETNPRESNVVVVEKDVSSRSSNSLACPVCYDSLTWNGDPGFSVDTIT  97

Query  280  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFS  459
             S+ +CSTC+K Y GN+TH+DLT  GG K+YGE++ ASTELFR+PL+SFLYERGWR +FS
Sbjct  98   GSSFQCSTCQKTYIGNQTHLDLTATGGAKSYGESMPASTELFRVPLISFLYERGWRQTFS  157

Query  460  LWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            +WGGFPGPEKEFELM+ +LKP++GGNIIDASC SGLFSRL
Sbjct  158  VWGGFPGPEKEFELMKGFLKPILGGNIIDASCASGLFSRL  197



>ref|XP_008219673.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Prunus mume]
Length=354

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 141/201 (70%), Gaps = 11/201 (5%)
 Frame = +1

Query  4    MATAGLGYVSAVLVTRKLGYNSKFSFSPLTPKANRLF-----AVKIRALSTTFVE----D  156
            MAT  +G ++   +  +LG NS+     L P    +F     A+  RA ST F+E    D
Sbjct  1    MATV-IGNITPAFLLSRLG-NSRPCVVKLRPCTAPVFRRSFAAITARAASTAFIEVESTD  58

Query  157  KPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETH  336
                ++  +      N+LACPIC+D F+ + DPGLS++S + S+ +CSTC+K Y GN+TH
Sbjct  59   TNPIVVQNEVTTSSNNILACPICFDQFSSSADPGLSVNSASGSSFQCSTCKKTYFGNQTH  118

Query  337  VDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYL  516
            +DLT A G K YGE++  STELFR PLVSFLYERGWR SFS+WGGFPGPEKEFEL++D+L
Sbjct  119  IDLTTASGSKNYGESMPVSTELFRTPLVSFLYERGWRQSFSVWGGFPGPEKEFELIKDFL  178

Query  517  KPVMGGNIIDASCGSGLFSRL  579
            KPV+GGNIIDASCGSGLFSRL
Sbjct  179  KPVLGGNIIDASCGSGLFSRL  199



>ref|XP_002302290.2| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
 gb|EEE81563.2| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
Length=349

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 141/195 (72%), Gaps = 4/195 (2%)
 Frame = +1

Query  4    MATAGLGYVSAVLVTRKLGYNSKFSFSP-LTPKANRL-FAVKIRALSTTFVEDKPVR-LI  174
            MA+A L  +S+  +  +L  +S+  F+P  TP   R  FA KIRA ST FVE +P   ++
Sbjct  1    MASAILSNLSSAFLPSQLSKSSRALFTPHCTPTFKRTSFAAKIRASSTAFVETRPTDPVV  60

Query  175  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  354
             EK V    N+LACP+CY+  T  G   LS+ S   S+L+CSTC+K YSG ETH++LT+A
Sbjct  61   VEKDVSSSKNILACPVCYEPVTLIGANVLSVDSARGSSLQCSTCKKTYSGKETHLELTVA  120

Query  355  GGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGG  534
             G KAY +A+  +TE FR P +SFLYERGWR +F +WGGFPGPEKEFE+M+DYLKPV+GG
Sbjct  121  SGSKAYDDAMPMATEFFRTPFISFLYERGWRQNF-VWGGFPGPEKEFEMMKDYLKPVLGG  179

Query  535  NIIDASCGSGLFSRL  579
            NI+DASCGSGLFSRL
Sbjct  180  NILDASCGSGLFSRL  194



>ref|XP_006386404.1| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
 gb|ERP64201.1| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
Length=355

 Score =   219 bits (557),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 141/195 (72%), Gaps = 4/195 (2%)
 Frame = +1

Query  4    MATAGLGYVSAVLVTRKLGYNSKFSFSP-LTPKANRL-FAVKIRALSTTFVEDKPVR-LI  174
            MA+A L  +S+  +  +L  +S+  F+P  TP   R  FA KIRA ST FVE +P   ++
Sbjct  1    MASAILSNLSSAFLPSQLSKSSRALFTPHCTPTFKRTSFAAKIRASSTAFVETRPTDPVV  60

Query  175  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  354
             EK V    N+LACP+CY+  T  G   LS+ S   S+L+CSTC+K YSG ETH++LT+A
Sbjct  61   VEKDVSSSKNILACPVCYEPVTLIGANVLSVDSARGSSLQCSTCKKTYSGKETHLELTVA  120

Query  355  GGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGG  534
             G KAY +A+  +TE FR P +SFLYERGWR +F +WGGFPGPEKEFE+M+DYLKPV+GG
Sbjct  121  SGSKAYDDAMPMATEFFRTPFISFLYERGWRQNF-VWGGFPGPEKEFEMMKDYLKPVLGG  179

Query  535  NIIDASCGSGLFSRL  579
            NI+DASCGSGLFSRL
Sbjct  180  NILDASCGSGLFSRL  194



>gb|AFK47008.1| unknown [Lotus japonicus]
Length=352

 Score =   217 bits (553),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 139/197 (71%), Gaps = 5/197 (3%)
 Frame = +1

Query  4    MATAGLGYVSAVLVTRKLGYNSKFSFSPLTPKA-NRLFAVKIRALSTT--FVEDKPVR--  168
            MAT  +      L T  L   ++ +   L+P      F +++RA ST    V+ KP    
Sbjct  1    MATTRIAATGMYLRTPTLSSFTRTTRRRLSPTVFPSKFPLQLRAFSTASPIVDPKPTDSI  60

Query  169  LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLT  348
            ++D+K+V   +N LACP+C+D+ TW GD GLS+ S+  S+L+CSTC+K Y GN+TH+DLT
Sbjct  61   VVDDKEVRRSSNSLACPVCFDSLTWTGDSGLSVDSIPVSSLQCSTCQKTYVGNQTHLDLT  120

Query  349  IAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVM  528
               G K YG+ + ASTELFR+PL+SFLYERGWR +FS+WGGFPGPEKEFELM+ +L PV+
Sbjct  121  ATSGAKNYGDLMPASTELFRVPLISFLYERGWRQTFSVWGGFPGPEKEFELMKGFLNPVL  180

Query  529  GGNIIDASCGSGLFSRL  579
            GGNIIDASC SGLFSRL
Sbjct  181  GGNIIDASCASGLFSRL  197



>ref|XP_007222212.1| hypothetical protein PRUPE_ppa007824mg [Prunus persica]
 gb|EMJ23411.1| hypothetical protein PRUPE_ppa007824mg [Prunus persica]
Length=354

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 123/159 (77%), Gaps = 4/159 (3%)
 Frame = +1

Query  115  AVKIRALSTTFVEDKPVR----LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQ  282
            A+  RA ST F+E +P      ++  +      N+LACPIC+D F+ + DPGLS++S + 
Sbjct  41   AITARAASTAFIEVEPRDTNPIVVQNEVTTSSNNILACPICFDQFSSSADPGLSVNSASG  100

Query  283  SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSL  462
            S+ +CSTC+K Y GN+TH+DLT A G K YGE++  STELFR PLVSFLYERGWR SFS+
Sbjct  101  SSFQCSTCKKTYFGNQTHIDLTTASGSKNYGESMPVSTELFRTPLVSFLYERGWRQSFSV  160

Query  463  WGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            WGGFPGPEKEFEL +D+LKPV+GGNIIDASCGSGLFSRL
Sbjct  161  WGGFPGPEKEFELTKDFLKPVLGGNIIDASCGSGLFSRL  199



>ref|XP_004500619.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cicer arietinum]
Length=338

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 129/167 (77%), Gaps = 5/167 (3%)
 Frame = +1

Query  79   FSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPG  258
            F P T K    F ++++A S+T   D      D   V   +N LACPICY++  W  DPG
Sbjct  22   FFPATAK----FPLRLQASSSTAFIDT-TNQTDSVAVTRSSNPLACPICYNSLIWITDPG  76

Query  259  LSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYER  438
            LS+ ++ +S+L+CSTC+K Y+GN+TH+DLT+  G K+YGE++ ASTELFR+PL+SFLYER
Sbjct  77   LSVDTIPRSSLQCSTCQKTYNGNQTHLDLTVTSGAKSYGESMPASTELFRMPLISFLYER  136

Query  439  GWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            GWR +FS+WGGFPGPEKEFELM+ +LKPV+GGNIIDASCGSGLFSRL
Sbjct  137  GWRQTFSVWGGFPGPEKEFELMKSFLKPVLGGNIIDASCGSGLFSRL  183



>ref|XP_007136240.1| hypothetical protein PHAVU_009G030200g [Phaseolus vulgaris]
 gb|ESW08234.1| hypothetical protein PHAVU_009G030200g [Phaseolus vulgaris]
Length=376

 Score =   216 bits (550),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 138/195 (71%), Gaps = 4/195 (2%)
 Frame = +1

Query  4    MATAGLGYVSAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVE---DKPVRLI  174
            +A AG+  +S  L + K      FS S    K     ++++RA ST  +    +    ++
Sbjct  28   VAVAGMCTLSPTLSSFK-HPTRLFSASDFAAKLRFPPSIRLRASSTAVINTETNSTESVV  86

Query  175  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  354
             EK+V    N LACP+CYD+  WNG PGLS+ +++ S+ +C TC+K Y GN+TH+DLT  
Sbjct  87   VEKEVGNSCNSLACPVCYDSLAWNGGPGLSIDTISGSSFQCGTCQKTYVGNQTHIDLTAT  146

Query  355  GGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGG  534
            GG K+YGE + ASTELFR+PL+SFLYERGWR +FS+WGGFPGPEKEFELM+ +LKPV+GG
Sbjct  147  GGAKSYGETMPASTELFRVPLISFLYERGWRQTFSVWGGFPGPEKEFELMKGFLKPVLGG  206

Query  535  NIIDASCGSGLFSRL  579
            NI+DASC SGLFSRL
Sbjct  207  NIVDASCASGLFSRL  221



>gb|KHN19749.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=353

 Score =   215 bits (547),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 128/161 (80%), Gaps = 7/161 (4%)
 Frame = +1

Query  118  VKIRALSTTFV--EDKPVR---LIDEKKVEIRT-NLLACPICYDAFTWNGDPGLSLSSMA  279
            ++ RA ST+F+  E  P     ++ EK V  R+ N LACP+CYD+ TWNGDPG S+ ++ 
Sbjct  38   LQFRASSTSFIDTETNPRESNVVVVEKDVSSRSSNSLACPVCYDSLTWNGDPGFSVDTIT  97

Query  280  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFR-LPLVSFLYERGWRXSF  456
             S+ +CSTC+K Y GN+TH+DLT  GG K+YGE++ ASTELFR +PL+SFLYERGWR +F
Sbjct  98   GSSFQCSTCQKTYIGNQTHLDLTATGGAKSYGESMPASTELFRQVPLISFLYERGWRQTF  157

Query  457  SLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            S+WGGFPGPEKEFELM+ +LKP++GGNIIDASC SGLFSRL
Sbjct  158  SVWGGFPGPEKEFELMKGFLKPILGGNIIDASCASGLFSRL  198



>ref|XP_011016296.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Populus euphratica]
Length=379

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 141/195 (72%), Gaps = 4/195 (2%)
 Frame = +1

Query  4    MATAGLGYVSAVLVTRKLGYNSKFSFSP-LTPKANRL-FAVKIRALSTTFVEDKPVR-LI  174
            MA++ LG +S+  +  +L  +S+  F+P  TP   R  FA KIRA ST FVE +P   ++
Sbjct  31   MASSILGNLSSAFLPSQLSKSSRPLFTPHCTPTFKRTSFAAKIRASSTAFVETRPTDPVV  90

Query  175  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  354
             EK V    N++ACP+CY+  T  G   LS+ S   S+L CSTC+K YSG ETH++LT+A
Sbjct  91   VEKDVSSSKNIVACPVCYEPVTLIGANVLSVDSARGSSLLCSTCKKTYSGKETHLELTVA  150

Query  355  GGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGG  534
             G K+Y +A+  +TE FR P +SFLYERGWR +F +WGGFPGPEKEFE+M+DYLKPV+GG
Sbjct  151  SGSKSYDDAMPMATEFFRTPFISFLYERGWRQNF-VWGGFPGPEKEFEMMKDYLKPVLGG  209

Query  535  NIIDASCGSGLFSRL  579
            NI+DASCGSGLFSRL
Sbjct  210  NILDASCGSGLFSRL  224



>ref|XP_002285799.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Vitis vinifera]
 emb|CBI19149.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   213 bits (541),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 131/185 (71%), Gaps = 6/185 (3%)
 Frame = +1

Query  37   VLVTRKLGYNSKFSFSPL--TPKANRLFAVKIRALST---TFVEDKPVRLIDEKKVEIRT  201
            V V  +LG      F PL   P  N +FA K+RA ST     VE KP  +  EK++ I  
Sbjct  11   VFVPGQLGQPRDPFFKPLFSPPTVNFVFAAKLRASSTPAAVVVETKPDPISVEKEISIGK  70

Query  202  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  381
            ++LACPICY  FTWNGD GLS+ SM  S+  CS+C+K   GNETH+DLT+A G K Y E+
Sbjct  71   SILACPICYQPFTWNGDLGLSVESMPGSSFHCSSCKKACFGNETHLDLTVATGAKEYDES  130

Query  382  LAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGS  561
            + A+TE+FR PL+SFLYERGWR +F +WGGFPG EKEFEL + YLKPV+GG I+DASCGS
Sbjct  131  MPAATEIFRTPLISFLYERGWRQNF-IWGGFPGLEKEFELAKGYLKPVLGGTIVDASCGS  189

Query  562  GLFSR  576
            GLFSR
Sbjct  190  GLFSR  194



>gb|KDO80936.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=232

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 126/178 (71%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  225
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  226  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  405
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  406  RLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            R+P +SF+YERGWR +F +WGGFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRI  194



>ref|XP_006434006.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47246.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|KDO80934.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
 gb|KDO80935.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=288

 Score =   208 bits (529),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 126/178 (71%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  225
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  226  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  405
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  406  RLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            R+P +SF+YERGWR +F +WGGFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRI  194



>gb|KEH34908.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=342

 Score =   209 bits (533),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 133/172 (77%), Gaps = 3/172 (2%)
 Frame = +1

Query  67   SKFSFSPLTPKANRLFAVKIRALSTTFVEDKPV-RLIDEKKVEIRTNLLACPICYDAFTW  243
            ++F FSP TPK  +L  ++  + STTF++  P   +I EK++   +N LACP+CY++ TW
Sbjct  18   TRFFFSP-TPKL-QLRLLRASSSSTTFLDTNPTDSVIVEKEITRSSNPLACPVCYNSLTW  75

Query  244  NGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVS  423
              +P LS+ +++ S+L+CSTC+K Y+ ++TH++LT       YGE++ ASTELFR PLVS
Sbjct  76   TTNPALSIDTISGSSLQCSTCQKTYTSDQTHLELTTISKANNYGESMPASTELFRTPLVS  135

Query  424  FLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            FLYERGWR +FS+WGGFPGPEKEFE M+ +LKPV+GGNIIDASCGSGLFSRL
Sbjct  136  FLYERGWRQTFSVWGGFPGPEKEFEQMKGFLKPVLGGNIIDASCGSGLFSRL  187



>gb|KDO80930.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=334

 Score =   207 bits (527),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 126/178 (71%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  225
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  226  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  405
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  406  RLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            R+P +SF+YERGWR +F +WGGFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRI  194



>gb|KDO80931.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=351

 Score =   207 bits (527),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 126/178 (71%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  225
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  226  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  405
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  406  RLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            R+P +SF+YERGWR +F +WGGFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRI  194



>ref|XP_006434005.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 ref|XP_006434007.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47245.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47247.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
Length=349

 Score =   207 bits (527),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 126/178 (71%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  225
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  226  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  405
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  406  RLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            R+P +SF+YERGWR +F +WGGFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRI  194



>ref|XP_010269234.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Nelumbo nucifera]
Length=349

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 124/192 (65%), Gaps = 3/192 (2%)
 Frame = +1

Query  13   AGLGYVSAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVED---KPVRLIDEK  183
            A +  VS V + R++G +      P+       FA  IRA ST    D   KP  ++D  
Sbjct  3    AIISRVSTVFLPRQIGDSRHCFLKPVKTTVRIPFAATIRASSTATSIDFEIKPDVIVDRM  62

Query  184  KVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  363
            +     ++ ACPICYD  TWNGDPGL +     S  +C TC K Y  N+ ++DLT A G 
Sbjct  63   ESSTSKDIFACPICYDPLTWNGDPGLPVKFTPGSRFQCRTCTKTYFNNKQYLDLTAASGA  122

Query  364  KAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNII  543
            K YGE+   STELFR PLVSFLYERGWR SFS +GGFPGP+KEFE+ +DYLKPV+GG I+
Sbjct  123  KEYGESTPPSTELFRTPLVSFLYERGWRQSFSFFGGFPGPDKEFEMAKDYLKPVLGGKIV  182

Query  544  DASCGSGLFSRL  579
            DASCGSGLFSRL
Sbjct  183  DASCGSGLFSRL  194



>gb|KDO80933.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=362

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 126/178 (71%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  225
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  226  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  405
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  406  RLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            R+P +SF+YERGWR +F +WGGFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRI  194



>ref|XP_006472620.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=351

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 125/178 (70%), Gaps = 3/178 (2%)
 Frame = +1

Query  52   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  225
            +LG + + S  P  +P   R F  KIRA ST F+E KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFIETKPSEPSFVENEASTSKNVLACPIC  77

Query  226  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  405
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE +  +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGMGTHFDMTAASGSKDYGELMTPTTEFF  137

Query  406  RLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            R+P +SF+YERGWR +F +WGGFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRI  194



>ref|XP_010059991.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW66499.1| hypothetical protein EUGRSUZ_F00306 [Eucalyptus grandis]
 gb|KCW66500.1| hypothetical protein EUGRSUZ_F00306 [Eucalyptus grandis]
Length=364

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 135/202 (67%), Gaps = 16/202 (8%)
 Frame = +1

Query  22   GYVSAVLVTRKLGYNSKFSFSP-LTPKANRLFAVKIRALST-------TFVEDKPVRL--  171
            G +++V   R+ G + +F+  P  T    +L A  +RA S+        FVE K      
Sbjct  8    GGLASVFAPRRRGSSRRFALKPGETSFQRQLLAPNVRASSSSSSSSSSAFVETKQPPSPP  67

Query  172  ------IDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNET  333
                  +D++K+    N+LACPICY+  T+ GD  LS+ S + S LEC TC+K Y GNET
Sbjct  68   SPPEATVDKEKLGSNQNVLACPICYEPLTFTGDLVLSVDSASGSTLECGTCKKTYVGNET  127

Query  334  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDY  513
            H DLT A G K YGE +A STELFR PLVS+LYERGWR SFS+WGGFPGPEKEFEL + +
Sbjct  128  HFDLTAASGTKEYGEPMALSTELFRTPLVSYLYERGWRQSFSVWGGFPGPEKEFELTKGF  187

Query  514  LKPVMGGNIIDASCGSGLFSRL  579
            LKPV+GGNI+DASCGSGLFSRL
Sbjct  188  LKPVLGGNIVDASCGSGLFSRL  209



>ref|XP_008391080.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=355

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 116/150 (77%), Gaps = 2/150 (1%)
 Frame = +1

Query  136  STTFVEDKPVRLIDEKKVEIRTN-LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRK  312
            S   VE +P   I  +   I +N +LACPICYD  + +GDPGLS+ S + S+ +C TC+K
Sbjct  51   SGALVEVEPTEPIVVQNDGISSNNILACPICYDPLSSSGDPGLSVESASGSSFQCGTCKK  110

Query  313  KYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKE  492
             Y GNETH+DLT A G K YGE++  +TE+FR PLVS+LYERGWR SF++WGGFPGPEKE
Sbjct  111  TYFGNETHIDLTTASGTKDYGESMPVTTEIFRTPLVSYLYERGWRQSFTVWGGFPGPEKE  170

Query  493  FELMQDYLKPVM-GGNIIDASCGSGLFSRL  579
            FEL +D+LKPV+ GGNIIDASCGSG+FSRL
Sbjct  171  FELTKDFLKPVLGGGNIIDASCGSGMFSRL  200



>ref|XP_008348560.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=433

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 118/150 (79%), Gaps = 2/150 (1%)
 Frame = +1

Query  136  STTFVEDKPVRLIDEKKVEIRTN-LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRK  312
            S   VE +P   I  +   I +N +LACPICYD F+ +GDPGLS+ S + S+ +C TC+K
Sbjct  51   SGAVVEVEPTEPIVVQNGGISSNNILACPICYDPFSSSGDPGLSVESASGSSFQCGTCKK  110

Query  313  KYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKE  492
             Y GNETH+DLT A G K YGE++  +TE+FR PLVS+LYERGWR SF++WGGFPGPEKE
Sbjct  111  TYFGNETHIDLTTASGTKDYGESMPVTTEIFRTPLVSYLYERGWRQSFTVWGGFPGPEKE  170

Query  493  FELMQDYLKPVM-GGNIIDASCGSGLFSRL  579
            FEL++D+LKPV+ GGNIIDASCGSG+FSRL
Sbjct  171  FELIKDFLKPVLGGGNIIDASCGSGMFSRL  200



>ref|XP_004299641.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=345

 Score =   197 bits (501),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 134/198 (68%), Gaps = 14/198 (7%)
 Frame = +1

Query  4    MATAGLGYVSAVLVTRKLGYNSKFSFSPLTP-----KANRLFAVKIRALSTTFVEDKPVR  168
            MAT  L   S + +  +LG +   SF    P     K +    + +RA ST FVE  P  
Sbjct  1    MATTKL--TSNLSLPSQLGNSRPDSFKLSNPFTVSFKRSSFPTITVRASSTAFVETTPSE  58

Query  169  LID-EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDL  345
             I+ + +  I  +LLACPIC+D F+          S + S+ ECSTC+K YS NETH+DL
Sbjct  59   PIEVQNEATICNDLLACPICFDRFS------SKGESGSGSSFECSTCKKTYSSNETHLDL  112

Query  346  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPV  525
            T+A G K YGE++ ASTE FR+PL+SFLYERGWR SFS+WGGFPGPEKEFEL++D +KPV
Sbjct  113  TLASGAKNYGESMPASTEFFRIPLISFLYERGWRQSFSVWGGFPGPEKEFELIKDCIKPV  172

Query  526  MGGNIIDASCGSGLFSRL  579
            +GG+IIDASCGSGLFSRL
Sbjct  173  LGGSIIDASCGSGLFSRL  190



>ref|XP_010064389.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
Length=354

 Score =   192 bits (489),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 128/192 (67%), Gaps = 6/192 (3%)
 Frame = +1

Query  22   GYVSAVLVTRKLGYNSKFSF-SPLTPKANRLFAVKIRALSTTFVEDKPV-----RLIDEK  183
            G + +V    +LG + +F   S  T    R+ A K+RA S+ ++E +P        + ++
Sbjct  8    GNLVSVFSASQLGSSRRFVLRSGETSFERRVLAPKLRASSSAYIETRPPPPPLESTVRQE  67

Query  184  KVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  363
            K+    N LACPIC++  T+ GDP LS++S + S L+C TC+K Y GNETH DLT  GG 
Sbjct  68   KLGGNQNALACPICFEPLTFTGDPVLSVNSASGSTLQCCTCKKAYVGNETHFDLTTTGGT  127

Query  364  KAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNII  543
            K YGE +  ++ELFR PLVS+LYERGWR  F    G PGPEKEFEL+  +LKPV+GGNI+
Sbjct  128  KEYGEPVPFASELFRTPLVSYLYERGWRQYFGSLAGSPGPEKEFELIMGFLKPVLGGNIV  187

Query  544  DASCGSGLFSRL  579
            DASCGSGLFSRL
Sbjct  188  DASCGSGLFSRL  199



>gb|KDP41368.1| hypothetical protein JCGZ_15775 [Jatropha curcas]
Length=350

 Score =   189 bits (481),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 119/161 (74%), Gaps = 4/161 (2%)
 Frame = +1

Query  103  NRLFAVKIRALSTT-FVEDKPVR-LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSM  276
            +R FA KIRA S T FVE KP   ++ EK+     N+LACPICY+  +  GD  LS+ + 
Sbjct  37   HRNFAAKIRASSATAFVETKPADPVVVEKEANTGKNILACPICYEPLSLIGDSVLSVDT-  95

Query  277  AQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSF  456
            A S L+C  C+K YSG ETH++LT+A G + Y +    +TE FR PL+SFLYERGWR SF
Sbjct  96   AGSILQCGCCKKSYSGKETHIELTVASGLRTYDDTKPLATEFFRTPLISFLYERGWRQSF  155

Query  457  SLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
             +WGGFPGPEKEF+L+++YLKPV+G NIIDASCGSGLFSRL
Sbjct  156  -IWGGFPGPEKEFDLIKNYLKPVLGKNIIDASCGSGLFSRL  195



>ref|XP_002889176.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65435.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=352

 Score =   189 bits (479),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = +1

Query  169  LIDEKKVEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNETHVDL  345
            +I+++K      +LACPICY++  W   P GL  S+ + + L+C+TC++ YSGNETH+DL
Sbjct  60   VIEKEKTRGEKKVLACPICYNSLAWISQPNGLIESATSGTQLQCNTCKRSYSGNETHLDL  119

Query  346  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPV  525
             +A G K Y E +  STELFR PLVSFLYERGWR +F +WGGFPGPEKEFE+ +DYLKPV
Sbjct  120  AVASGSKTYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPV  178

Query  526  MGGNIIDASCGSGLFSRL  579
            +GGNIIDASCGSG+FSRL
Sbjct  179  LGGNIIDASCGSGMFSRL  196



>ref|XP_007018799.1| S-adenosylmethionine-dependent methyltransferase, putative [Theobroma 
cacao]
 gb|EOY16024.1| S-adenosylmethionine-dependent methyltransferase, putative [Theobroma 
cacao]
Length=366

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 130/201 (65%), Gaps = 20/201 (10%)
 Frame = +1

Query  34   AVLVTRKLGYNSKFSFSPLT-PKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIR--TN  204
            A+  ++  G +++F F P T P   R    K+RA ST FVE KP   + E+K +    +N
Sbjct  12   AIFPSQLNGNSARFLFRPFTTPVFKRSLTAKVRAFSTAFVETKPTEPVVEEKEDTGGGSN  71

Query  205  LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEAL  384
             LACPICYD     G+    + S A SNL+C+TC+K Y GNETH+DL  + G K Y E++
Sbjct  72   GLACPICYDPLIRIGESTSYVGSTAGSNLQCNTCKKTYRGNETHLDLVASSGSKQYDESM  131

Query  385  AASTELF----------------RLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYL  516
              +TE+F                + P+VSFLYERGWR +F L+GGFPGPEKEF++ ++YL
Sbjct  132  PLATEVFSTTWIIYNVALTANVLKTPVVSFLYERGWRQNF-LFGGFPGPEKEFDMAKNYL  190

Query  517  KPVMGGNIIDASCGSGLFSRL  579
            KPV+GGNIIDASCGSGLFSRL
Sbjct  191  KPVLGGNIIDASCGSGLFSRL  211



>ref|XP_002513908.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF48491.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=351

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 135/202 (67%), Gaps = 16/202 (8%)
 Frame = +1

Query  4    MATAGLGYVSAVLVTRKLGYNSKFSFSPLT-PKANRL-FAVKIRALST-----TFVEDKP  162
            MA A + Y     +  + G + +F F+P T P   R  FA K+RA S+       +E KP
Sbjct  1    MAAATISY----YLPNQFGNSRQFLFNPYTRPIFKRSNFAAKVRASSSTSTSTALLESKP  56

Query  163  VRLIDEKKVEIR---TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNET  333
               +  +K E+    TN++ACPICY+  +  GD  LS+  + + +L C +C+K Y G ET
Sbjct  57   ADAVVVEKEEVSRSSTNIIACPICYEPLSLIGDRLLSVD-IGECSLRCGSCKKIYYGKET  115

Query  334  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDY  513
            H++LT+A G   Y +A+  +TE FRL L+SFLYERGWR +F +WGGFPGPEKEFEL++DY
Sbjct  116  HIELTVASGASKYDDAMPLATEFFRLSLISFLYERGWRQNF-IWGGFPGPEKEFELIKDY  174

Query  514  LKPVMGGNIIDASCGSGLFSRL  579
            LKPV+GGNIIDASCGSGLFSRL
Sbjct  175  LKPVLGGNIIDASCGSGLFSRL  196



>ref|XP_006390018.1| hypothetical protein EUTSA_v10018789mg [Eutrema salsugineum]
 gb|ESQ27304.1| hypothetical protein EUTSA_v10018789mg [Eutrema salsugineum]
Length=351

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 107/138 (78%), Gaps = 2/138 (1%)
 Frame = +1

Query  169  LIDEKKVEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNETHVDL  345
            +++++K     N+LACPICY++  W   P GL   + + + L+C+TC+K YSGNETH+DL
Sbjct  58   VVEKEKNRGEKNILACPICYNSLAWISQPNGLVEPTASGTQLQCNTCKKSYSGNETHLDL  117

Query  346  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPV  525
             +A G   Y E +  STELFR PLVSFLYERGWR +F +WGGFPGPEKEFE+ +DYLKPV
Sbjct  118  AVASGSNQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPV  176

Query  526  MGGNIIDASCGSGLFSRL  579
            +GGNIIDASCGSG+FSRL
Sbjct  177  LGGNIIDASCGSGMFSRL  194



>ref|XP_006300528.1| hypothetical protein CARUB_v10020572mg [Capsella rubella]
 gb|EOA33426.1| hypothetical protein CARUB_v10020572mg [Capsella rubella]
Length=348

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 105/136 (77%), Gaps = 2/136 (1%)
 Frame = +1

Query  175  DEKKVEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  351
            + +K      +LACPICY++F W   P GL  S  + + L+C+TC++ YSGNETH+DL +
Sbjct  56   NNEKNRGEKKILACPICYNSFAWISQPNGLVESGASGAQLQCNTCKRSYSGNETHLDLAV  115

Query  352  AGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMG  531
            A G K Y E +  +TELFR PLVSFLYERGWR +F +WGGFPGPEKEFE+ +DYLKPV+G
Sbjct  116  ASGSKQYSEPMPLATELFRTPLVSFLYERGWRQNF-VWGGFPGPEKEFEMAKDYLKPVLG  174

Query  532  GNIIDASCGSGLFSRL  579
            GNIIDASCGSG+FSRL
Sbjct  175  GNIIDASCGSGMFSRL  190



>ref|XP_010064206.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW66498.1| hypothetical protein EUGRSUZ_F00305 [Eucalyptus grandis]
Length=354

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 125/192 (65%), Gaps = 6/192 (3%)
 Frame = +1

Query  22   GYVSAVLVTRKLGYNSKFSF-SPLTPKANRLFAVKIRALSTTFVEDKPV-----RLIDEK  183
            G   +V    +LG + +F   S  T    R+ A K+RA  + +VE +P        + ++
Sbjct  8    GNSVSVFGASQLGSSRQFVLRSGETSFERRVLAPKLRASYSAYVETRPPPPPLESTVRQE  67

Query  184  KVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  363
            K+    N LACPIC++   + GDP LS++S + S L+C TC+K Y GNETH DLT  GG 
Sbjct  68   KLGGNQNALACPICFEPLRFTGDPVLSVNSASGSTLQCGTCKKAYVGNETHFDLTTTGGT  127

Query  364  KAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNII  543
            K YGE +  ++ELFR PLVS+LYERGWR  F    G PGPEKEFEL+  +LKPV+GGNI+
Sbjct  128  KEYGEPVPFASELFRTPLVSYLYERGWRQYFESLLGSPGPEKEFELIMGFLKPVLGGNIV  187

Query  544  DASCGSGLFSRL  579
            DASCGSGLFSRL
Sbjct  188  DASCGSGLFSRL  199



>ref|XP_009373157.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Pyrus x bretschneideri]
Length=348

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 102/127 (80%), Gaps = 8/127 (6%)
 Frame = +1

Query  202  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  381
            N+LACPICYD F+ +GD GLS+        +C TC+K Y GNETH+DLT A G K YGE+
Sbjct  74   NILACPICYDPFSSSGDLGLSI-------FQCRTCKKTYFGNETHIDLTTASGAKDYGES  126

Query  382  LAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVM-GGNIIDASCG  558
               STE+FR PLVS+LYERGWR SF++WGGFPGPEKEFEL++D+ KPV+ GGN+IDASCG
Sbjct  127  KPISTEMFRTPLVSYLYERGWRQSFNVWGGFPGPEKEFELIKDFFKPVLGGGNVIDASCG  186

Query  559  SGLFSRL  579
            SG+FSRL
Sbjct  187  SGMFSRL  193



>ref|XP_010472020.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Camelina sativa]
Length=356

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 102/136 (75%), Gaps = 3/136 (2%)
 Frame = +1

Query  178  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  351
            E K      +LACPICY++  W   P   + S A S   L+C+TC++ YSGNETH+DL +
Sbjct  66   ETKNRGEKKILACPICYNSLAWISQPNGFVESTASSGTQLQCNTCKRGYSGNETHLDLAV  125

Query  352  AGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMG  531
            A G K Y E +  STELFR PLVSFLYERGWR +F +WGGFPGPEKEFE+ +DYLKPV+G
Sbjct  126  ASGTKQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVLG  184

Query  532  GNIIDASCGSGLFSRL  579
            GNIIDASCGSG+FSRL
Sbjct  185  GNIIDASCGSGMFSRL  200



>ref|XP_010472019.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Camelina sativa]
Length=357

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 102/136 (75%), Gaps = 3/136 (2%)
 Frame = +1

Query  178  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  351
            E K      +LACPICY++  W   P   + S A S   L+C+TC++ YSGNETH+DL +
Sbjct  67   ETKNRGEKKILACPICYNSLAWISQPNGFVESTASSGTQLQCNTCKRGYSGNETHLDLAV  126

Query  352  AGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMG  531
            A G K Y E +  STELFR PLVSFLYERGWR +F +WGGFPGPEKEFE+ +DYLKPV+G
Sbjct  127  ASGTKQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVLG  185

Query  532  GNIIDASCGSGLFSRL  579
            GNIIDASCGSG+FSRL
Sbjct  186  GNIIDASCGSGMFSRL  201



>ref|XP_009394965.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=352

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 124/201 (62%), Gaps = 15/201 (7%)
 Frame = +1

Query  10   TAGLGYVSAVLVTRKLGYNSKFSFSP---LTPKANRLF-AVKIRALST-------TFVED  156
            T  LG V  VL+   L +   F F+P   L PK + L   V IRA +T       T   D
Sbjct  2    TTALGNVGGVLLHLPLRH---FLFNPRRSLIPKPHLLARGVVIRAATTSSSSPPGTATGD  58

Query  157  KPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETH  336
                L ++ KV     +LACPICY++      PGL L+  + SNLEC TC+K Y  N  +
Sbjct  59   SNPDLTEDAKVSTGIPILACPICYNSLISKNGPGLKLAFQSASNLECHTCKKDYQNNGIY  118

Query  337  VDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYL  516
            +DL +A G K Y E + A TELFR PLVSFLYERGWR +F +WGGFPGPE+EFE+ + YL
Sbjct  119  LDLAVASGSKDYAETMPAMTELFRSPLVSFLYERGWRQNF-VWGGFPGPEREFEMAKGYL  177

Query  517  KPVMGGNIIDASCGSGLFSRL  579
            KP  GG IIDASCGSGLFSRL
Sbjct  178  KPSTGGTIIDASCGSGLFSRL  198



>ref|XP_009394966.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=312

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 126/204 (62%), Gaps = 18/204 (9%)
 Frame = +1

Query  10   TAGLGYVSAVLVTRKLGYNSKFSFSP---LTPKANRLF-AVKIRALSTTFV--------E  153
            T  LG V  VL+   L +   F F+P   L PK + L   V IRA +T+          +
Sbjct  2    TTALGNVGGVLLHLPLRH---FLFNPRRSLIPKPHLLARGVVIRAATTSSSSPPGTATGD  58

Query  154  DKPVR--LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN  327
              PV   L ++ KV     +LACPICY++      PGL L+  + SNLEC TC+K Y  N
Sbjct  59   SNPVTQDLTEDAKVSTGIPILACPICYNSLISKNGPGLKLAFQSASNLECHTCKKDYQNN  118

Query  328  ETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQ  507
              ++DL +A G K Y E + A TELFR PLVSFLYERGWR +F +WGGFPGPE+EFE+ +
Sbjct  119  GIYLDLAVASGSKDYAETMPAMTELFRSPLVSFLYERGWRQNF-VWGGFPGPEREFEMAK  177

Query  508  DYLKPVMGGNIIDASCGSGLFSRL  579
             YLKP  GG IIDASCGSGLFSRL
Sbjct  178  GYLKPSTGGTIIDASCGSGLFSRL  201



>ref|XP_010061813.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW68836.1| hypothetical protein EUGRSUZ_F02436 [Eucalyptus grandis]
Length=346

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 131/195 (67%), Gaps = 7/195 (4%)
 Frame = +1

Query  4    MATAGLGYVSAVLVTRKLGYNSKFSFSPLTPKA---NRLFAVKIRALSTTFVEDKPVRLI  174
            MAT       AV    +LG   + +F+ +   +    R+ A ++RA   T   D P+ ++
Sbjct  1    MATLAGSNFLAVARPSQLGPRRRVAFTSVPGSSIFSRRVHAARVRAAVQTATPD-PI-VV  58

Query  175  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  354
            DEK V  +  +LACPICY   T  G P LS+ ++++S L CSTC+K Y GN+TH++L  +
Sbjct  59   DEK-VASKKGILACPICYHPLTHAG-PALSMDNLSESTLLCSTCKKTYLGNKTHLELVAS  116

Query  355  GGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGG  534
             G K Y EA+A +TE FRLPL+S++YERGWR  FS  GG+PGP+KEFEL++ YL+PV+GG
Sbjct  117  SGAKEYTEAMAPATEFFRLPLISYIYERGWRQGFSAVGGWPGPQKEFELIKGYLEPVLGG  176

Query  535  NIIDASCGSGLFSRL  579
            NIIDASCGSG F+RL
Sbjct  177  NIIDASCGSGPFTRL  191



>ref|XP_008374425.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Malus domestica]
Length=355

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 101/126 (80%), Gaps = 1/126 (1%)
 Frame = +1

Query  202  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  381
            N+LACPICYD F+ +GDPGLS+ S + S+  CSTC+K Y GNETH+DLT A G K YGE+
Sbjct  74   NILACPICYDPFSSSGDPGLSVESASGSSFHCSTCKKTYFGNETHIDLTTASGAKXYGES  133

Query  382  LAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVM-GGNIIDASCG  558
            +   TE+FR PL+S+LYERGWR SF+   G PGPEKEFE  +++LKPV+ GGNIIDASCG
Sbjct  134  MPVITEMFRTPLISYLYERGWRQSFTGLIGLPGPEKEFEWTKNFLKPVLGGGNIIDASCG  193

Query  559  SGLFSR  576
            SGLFSR
Sbjct  194  SGLFSR  199



>ref|XP_008374562.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X3 [Malus domestica]
Length=334

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 101/127 (80%), Gaps = 1/127 (1%)
 Frame = +1

Query  199  TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGE  378
             N+LACPICYD F+ +GDPGLS+ S + S+  CSTC+K Y GNETH+DLT A G K YGE
Sbjct  73   NNILACPICYDPFSSSGDPGLSVESASGSSFHCSTCKKTYFGNETHIDLTTASGAKXYGE  132

Query  379  ALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVM-GGNIIDASC  555
            ++   TE+FR PL+S+LYERGWR SF+   G PGPEKEFE  +++LKPV+ GGNIIDASC
Sbjct  133  SMPVITEMFRTPLISYLYERGWRQSFTGLIGLPGPEKEFEWTKNFLKPVLGGGNIIDASC  192

Query  556  GSGLFSR  576
            GSGLFSR
Sbjct  193  GSGLFSR  199



>ref|XP_010428929.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Camelina sativa]
Length=356

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 101/136 (74%), Gaps = 3/136 (2%)
 Frame = +1

Query  178  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  351
            E K      +LACPICY++  W   P   + S   S   L+C+TC++ YSGNETH+DL +
Sbjct  66   ENKNSGEKKILACPICYNSLAWISPPNGFVESTVSSGTQLQCNTCKRSYSGNETHLDLAV  125

Query  352  AGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMG  531
            A G K Y E +  STELFR PLVSFLYERGWR +F +WGGFPGPEKEFE+ +DYLKPV+G
Sbjct  126  ASGTKHYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVLG  184

Query  532  GNIIDASCGSGLFSRL  579
            GNIIDASCGSG+FSRL
Sbjct  185  GNIIDASCGSGMFSRL  200



>ref|XP_010428930.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Camelina sativa]
Length=355

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 101/136 (74%), Gaps = 3/136 (2%)
 Frame = +1

Query  178  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  351
            E K      +LACPICY++  W   P   + S   S   L+C+TC++ YSGNETH+DL +
Sbjct  65   ENKNSGEKKILACPICYNSLAWISPPNGFVESTVSSGTQLQCNTCKRSYSGNETHLDLAV  124

Query  352  AGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMG  531
            A G K Y E +  STELFR PLVSFLYERGWR +F +WGGFPGPEKEFE+ +DYLKPV+G
Sbjct  125  ASGTKHYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVLG  183

Query  532  GNIIDASCGSGLFSRL  579
            GNIIDASCGSG+FSRL
Sbjct  184  GNIIDASCGSGMFSRL  199



>ref|NP_565170.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 sp|Q8LBV4.1|Y1814_ARATH RecName: Full=Uncharacterized methyltransferase At1g78140, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAM64539.1| unknown [Arabidopsis thaliana]
 gb|AAO42148.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50518.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36071.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
Length=355

 Score =   182 bits (461),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 107/142 (75%), Gaps = 4/142 (3%)
 Frame = +1

Query  163  VRLIDEKKVEIR--TNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNET  333
            V  + EKK + R    +LACPICY++  W   P GL  S+ +   ++C+TC++ YSGNET
Sbjct  59   VDFVIEKKDKNRGEKKILACPICYNSLAWISQPNGLIESAASGIQVQCNTCKRSYSGNET  118

Query  334  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDY  513
            H+DL +A G K Y E +  STELFR PLVSFLYERGWR +F +WGGFPGPEKEFE+ + Y
Sbjct  119  HLDLAVASGSKRYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKAY  177

Query  514  LKPVMGGNIIDASCGSGLFSRL  579
            LKPV+GGNIIDASCGSG+FSRL
Sbjct  178  LKPVLGGNIIDASCGSGMFSRL  199



>ref|XP_009128280.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Brassica rapa]
Length=341

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 102/132 (77%), Gaps = 2/132 (2%)
 Frame = +1

Query  187  VEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  363
            VE   ++LACPICY++      P GL  S+ + + L+C+TC+K YSGNETH+DL +A G 
Sbjct  54   VEKEKDILACPICYNSLALISKPNGLVGSAASGTQLQCNTCKKSYSGNETHLDLAVASGS  113

Query  364  KAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNII  543
              Y E +  STE+FR PLVSFLYERGWR +F +WGGFPGPEKEFE+ +DYLKPV GGNII
Sbjct  114  NQYTEPMPLSTEIFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVFGGNII  172

Query  544  DASCGSGLFSRL  579
            DASCGSG+FSRL
Sbjct  173  DASCGSGMFSRL  184



>gb|AAG52104.1|AC012680_15 hypothetical protein; 38642-36701 [Arabidopsis thaliana]
Length=317

 Score =   180 bits (457),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 106/141 (75%), Gaps = 4/141 (3%)
 Frame = +1

Query  163  VRLIDEKKVEIR--TNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNET  333
            V  + EKK + R    +LACPICY++  W   P GL  S+ +   ++C+TC++ YSGNET
Sbjct  59   VDFVIEKKDKNRGEKKILACPICYNSLAWISQPNGLIESAASGIQVQCNTCKRSYSGNET  118

Query  334  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDY  513
            H+DL +A G K Y E +  STELFR PLVSFLYERGWR +F +WGGFPGPEKEFE+ + Y
Sbjct  119  HLDLAVASGSKRYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKAY  177

Query  514  LKPVMGGNIIDASCGSGLFSR  576
            LKPV+GGNIIDASCGSG+FSR
Sbjct  178  LKPVLGGNIIDASCGSGMFSR  198



>ref|XP_010416782.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=360

 Score =   181 bits (460),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 102/136 (75%), Gaps = 3/136 (2%)
 Frame = +1

Query  178  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  351
            E K      +LACPICY++  W   P   + S A S   L+C+TC++ YSGNETH+DL +
Sbjct  70   ETKNRGEKKILACPICYNSLAWISPPNGFVESTASSGTQLQCNTCKRGYSGNETHLDLAV  129

Query  352  AGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMG  531
            A G + Y E +  STELFR PLVSFLYERGWR +F +WGGFPGPEKEFE+ +DYLKPV+G
Sbjct  130  ASGTEQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVLG  188

Query  532  GNIIDASCGSGLFSRL  579
            GNIIDASCGSG+FSRL
Sbjct  189  GNIIDASCGSGMFSRL  204



>ref|XP_010416783.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=359

 Score =   181 bits (460),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 102/136 (75%), Gaps = 3/136 (2%)
 Frame = +1

Query  178  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  351
            E K      +LACPICY++  W   P   + S A S   L+C+TC++ YSGNETH+DL +
Sbjct  69   ETKNRGEKKILACPICYNSLAWISPPNGFVESTASSGTQLQCNTCKRGYSGNETHLDLAV  128

Query  352  AGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMG  531
            A G + Y E +  STELFR PLVSFLYERGWR +F +WGGFPGPEKEFE+ +DYLKPV+G
Sbjct  129  ASGTEQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVLG  187

Query  532  GNIIDASCGSGLFSRL  579
            GNIIDASCGSG+FSRL
Sbjct  188  GNIIDASCGSGMFSRL  203



>ref|XP_009394964.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=355

 Score =   181 bits (459),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 126/204 (62%), Gaps = 18/204 (9%)
 Frame = +1

Query  10   TAGLGYVSAVLVTRKLGYNSKFSFSP---LTPKANRLF-AVKIRALSTTFV--------E  153
            T  LG V  VL+   L +   F F+P   L PK + L   V IRA +T+          +
Sbjct  2    TTALGNVGGVLLHLPLRH---FLFNPRRSLIPKPHLLARGVVIRAATTSSSSPPGTATGD  58

Query  154  DKPVR--LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN  327
              PV   L ++ KV     +LACPICY++      PGL L+  + SNLEC TC+K Y  N
Sbjct  59   SNPVTQDLTEDAKVSTGIPILACPICYNSLISKNGPGLKLAFQSASNLECHTCKKDYQNN  118

Query  328  ETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQ  507
              ++DL +A G K Y E + A TELFR PLVSFLYERGWR +F +WGGFPGPE+EFE+ +
Sbjct  119  GIYLDLAVASGSKDYAETMPAMTELFRSPLVSFLYERGWRQNF-VWGGFPGPEREFEMAK  177

Query  508  DYLKPVMGGNIIDASCGSGLFSRL  579
             YLKP  GG IIDASCGSGLFSRL
Sbjct  178  GYLKPSTGGTIIDASCGSGLFSRL  201



>emb|CDY26853.1| BnaA02g18780D [Brassica napus]
Length=341

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 102/132 (77%), Gaps = 2/132 (2%)
 Frame = +1

Query  187  VEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  363
            VE   ++LACPICY++      P GL  S+ + + L+C+TC+K YSGN+TH+DL +A G 
Sbjct  54   VEKEKDILACPICYNSLALISKPNGLVGSAASGTQLQCNTCKKSYSGNDTHLDLAVASGS  113

Query  364  KAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNII  543
              Y E +  STELFR PLVSFLYERGWR +F +WGGFPGPEKEFE+ +DYLKPV GGNII
Sbjct  114  NQYTEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVFGGNII  172

Query  544  DASCGSGLFSRL  579
            DASCGSG+FSRL
Sbjct  173  DASCGSGMFSRL  184



>gb|KCW67137.1| hypothetical protein EUGRSUZ_F00926, partial [Eucalyptus grandis]
Length=294

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = +1

Query  172  IDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  351
            + ++K+    N LACPIC++  T+ GDP LS++S + S L+C TC+K Y GNETH DLT 
Sbjct  4    VRQEKLGGNQNALACPICFEPLTFTGDPVLSVNSASGSTLQCCTCKKAYVGNETHFDLTT  63

Query  352  AGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMG  531
             GG K YGE +  ++ELFR PLVS+LYERGWR  F    G PGPEKEFEL+  +LKPV+G
Sbjct  64   TGGTKEYGEPVPFASELFRTPLVSYLYERGWRQYFGSLAGSPGPEKEFELIMGFLKPVLG  123

Query  532  GNIIDASCGSGLFSRL  579
            GNI+DASCGSGLFSRL
Sbjct  124  GNIVDASCGSGLFSRL  139



>ref|XP_010534072.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X3 [Tarenaya hassleriana]
Length=283

 Score =   176 bits (447),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 129/201 (64%), Gaps = 10/201 (5%)
 Frame = +1

Query  4    MATAGLGYVSAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTF-VEDKPVR---L  171
            M T   G  S VL+   +  +   SF+ +  +     +  IRA S    +E KP      
Sbjct  3    MLTVIAGRFSPVLLPPGISSSRFSSFNSVARRRTLFVSRSIRASSAAVSIETKPKEDPVP  62

Query  172  IDEKKVEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQS----NLECSTCRKKYSGNETH  336
            + EK+     N+LACPIC+++      P G+ +  + +S    +L+C TC+K YSG ETH
Sbjct  63   VAEKENIGEKNVLACPICFNSLARVNQPNGIEIWHIRESTLGTSLQCVTCKKNYSGCETH  122

Query  337  VDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYL  516
            +DLT+AG  K YGE +  STELFRLPLVSFLYERGWR SF +WGGFPGPE+EFE+ +DYL
Sbjct  123  LDLTVAGETKQYGEQMPLSTELFRLPLVSFLYERGWRQSF-IWGGFPGPEREFEMAKDYL  181

Query  517  KPVMGGNIIDASCGSGLFSRL  579
            KP +GG IIDASCGSG+FSRL
Sbjct  182  KPALGGKIIDASCGSGMFSRL  202



>ref|XP_010534071.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=349

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 111/156 (71%), Gaps = 7/156 (4%)
 Frame = +1

Query  124  IRALSTTF-VEDKPVR---LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  291
            IRA S    +E KP      + EK+     N+LACPIC+++      P  +  S   ++L
Sbjct  43   IRASSAAVSIETKPKEDPVPVAEKENIGEKNVLACPICFNSLARVNQP--NGESTLGTSL  100

Query  292  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGG  471
            +C TC+K YSG ETH+DLT+AG  K YGE +  STELFRLPLVSFLYERGWR SF +WGG
Sbjct  101  QCVTCKKNYSGCETHLDLTVAGETKQYGEQMPLSTELFRLPLVSFLYERGWRQSF-IWGG  159

Query  472  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            FPGPE+EFE+ +DYLKP +GG IIDASCGSG+FSRL
Sbjct  160  FPGPEREFEMAKDYLKPALGGKIIDASCGSGMFSRL  195



>ref|XP_010534070.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=356

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 114/161 (71%), Gaps = 10/161 (6%)
 Frame = +1

Query  124  IRALSTTF-VEDKPVR---LIDEKKVEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQS-  285
            IRA S    +E KP      + EK+     N+LACPIC+++      P G+ +  + +S 
Sbjct  43   IRASSAAVSIETKPKEDPVPVAEKENIGEKNVLACPICFNSLARVNQPNGIEIWHIREST  102

Query  286  ---NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSF  456
               +L+C TC+K YSG ETH+DLT+AG  K YGE +  STELFRLPLVSFLYERGWR SF
Sbjct  103  LGTSLQCVTCKKNYSGCETHLDLTVAGETKQYGEQMPLSTELFRLPLVSFLYERGWRQSF  162

Query  457  SLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
             +WGGFPGPE+EFE+ +DYLKP +GG IIDASCGSG+FSRL
Sbjct  163  -IWGGFPGPEREFEMAKDYLKPALGGKIIDASCGSGMFSRL  202



>emb|CDY14625.1| BnaC02g24880D [Brassica napus]
Length=339

 Score =   176 bits (446),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 99/131 (76%), Gaps = 2/131 (2%)
 Frame = +1

Query  187  VEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGK  366
            VE   ++LACPICY++      P   L   A + L+C+TC+  YSGNETH+DL +A G  
Sbjct  54   VEKEKDILACPICYNSLALISQPN-GLVGSAGTQLQCNTCKGSYSGNETHLDLAVASGSN  112

Query  367  AYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIID  546
             Y E +  STELFR PLVSFLYERGWR +F +WGGFPGPEKEFE+ ++YLKPV+GGNIID
Sbjct  113  QYTEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAREYLKPVLGGNIID  171

Query  547  ASCGSGLFSRL  579
            ASCGSG+FSRL
Sbjct  172  ASCGSGMFSRL  182



>ref|XP_006472621.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=333

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 111/178 (62%), Gaps = 21/178 (12%)
 Frame = +1

Query  52   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVRL-IDEKKVEIRTNLLACPIC  225
            +LG + + S  P  +P   R F  KIRA ST F+E KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFIETKPSEPSFVENEASTSKNVLACPIC  77

Query  226  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  405
            Y   TW GD  LS+                  G  TH D+T A G K YGE +  +TE F
Sbjct  78   YKPLTWIGDSSLSI------------------GMGTHFDMTAASGSKDYGELMTPTTEFF  119

Query  406  RLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            R+P +SF+YERGWR +F +WGGFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+
Sbjct  120  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRI  176



>ref|XP_008356589.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized methyltransferase 
At1g78140, chloroplastic-like [Malus domestica]
Length=259

 Score =   171 bits (433),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 98/128 (77%), Gaps = 1/128 (1%)
 Frame = +1

Query  199  TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGE  378
            TN+LA PICYD F+   DPGL + S + S+ +C TC+K Y GNETH+ LT A   K YGE
Sbjct  43   TNILAGPICYDPFSSXXDPGLFVESASGSSFQCGTCKKTYFGNETHIXLTTASSAKNYGE  102

Query  379  ALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVM-GGNIIDASC  555
            ++  + E+FR PLV +LYE+GWR SF++WGGFPG EKEFEL +D+LKPV+ GGNIIDASC
Sbjct  103  SMPVAXEMFRTPLVLYLYEKGWRQSFTVWGGFPGLEKEFELTKDFLKPVLGGGNIIDASC  162

Query  556  GSGLFSRL  579
             SG+F RL
Sbjct  163  WSGMFXRL  170



>gb|KJB59929.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=349

 Score =   174 bits (440),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 119/182 (65%), Gaps = 11/182 (6%)
 Frame = +1

Query  52   KLGYNS-KFSFSPLTPKA-NRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNL----LA  213
            +L  NS +F F P T     R    K+RA    FVE KP   I  +K E         LA
Sbjct  17   QLSKNSARFLFRPFTTLVFTRSLTAKVRA----FVETKPTAPIAVEKEESGGGGGSCGLA  72

Query  214  CPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAAS  393
            CPICY+  T   D  + + S   SNL+C+TC+K YSG +TH+DL  + G K Y E++  +
Sbjct  73   CPICYNPLTVISDSPIYVGSTVGSNLQCNTCKKTYSGTQTHLDLVASSGSKQYDESMPLA  132

Query  394  TELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFS  573
            TELFR P+VSFLYERGWR +F ++GGFPGPEKEF++ ++YLK V+GG I+DASCGSG+F+
Sbjct  133  TELFRTPVVSFLYERGWRQNF-VFGGFPGPEKEFDMAKNYLKRVLGGKIVDASCGSGMFT  191

Query  574  RL  579
            RL
Sbjct  192  RL  193



>ref|XP_008374488.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Malus domestica]
Length=348

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 97/126 (77%), Gaps = 8/126 (6%)
 Frame = +1

Query  202  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  381
            N+LACPICYD F+ +GDPGLS+         CSTC+K Y GNETH+DLT A G K YGE+
Sbjct  74   NILACPICYDPFSSSGDPGLSV-------FHCSTCKKTYFGNETHIDLTTASGAKXYGES  126

Query  382  LAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVM-GGNIIDASCG  558
            +   TE+FR PL+S+LYERGWR SF+   G PGPEKEFE  +++LKPV+ GGNIIDASCG
Sbjct  127  MPVITEMFRTPLISYLYERGWRQSFTGLIGLPGPEKEFEWTKNFLKPVLGGGNIIDASCG  186

Query  559  SGLFSR  576
            SGLFSR
Sbjct  187  SGLFSR  192



>emb|CDX88421.1| BnaC06g38650D [Brassica napus]
Length=353

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 108/156 (69%), Gaps = 6/156 (4%)
 Frame = +1

Query  118  VKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFT-WNGDPGLSLSSMAQ-SNL  291
            +  RA S +      V  + EK+   + N+LACPICY++       P  S  S A  ++L
Sbjct  40   ISARASSASVETKSSVDYVVEKE---KKNILACPICYNSLAALISQPHESAESPASGTHL  96

Query  292  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGG  471
            +C TC K YS NETH+DLT+A G K Y E L  S EL+R PLVSFLYERGWR +F +WGG
Sbjct  97   QCKTCNKSYSANETHLDLTVASGTKQYTEPLPLSIELYRNPLVSFLYERGWRQNF-MWGG  155

Query  472  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            FPGPEKEFE+ ++YLK V+GGNIIDASCGSG+FSRL
Sbjct  156  FPGPEKEFEMAKEYLKHVLGGNIIDASCGSGIFSRL  191



>gb|KHG01878.1| hypothetical protein F383_23026 [Gossypium arboreum]
Length=349

 Score =   171 bits (432),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 118/182 (65%), Gaps = 11/182 (6%)
 Frame = +1

Query  52   KLGYNS-KFSFSPLTPKA-NRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNL----LA  213
            +L  NS +F F P T     R    K+RA    FVE KP   I  +K E         LA
Sbjct  17   QLSKNSAQFLFRPFTTLVFTRSLTAKVRA----FVETKPTAPIAVEKEESGGGSGSCGLA  72

Query  214  CPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAAS  393
            CPICY+      D  + + S   +NL+C+TC+K YSG +TH+DL  + G K Y E++  +
Sbjct  73   CPICYNLLMVITDSPIYVGSTVGTNLQCNTCKKTYSGTQTHLDLVASSGSKQYDESMPLA  132

Query  394  TELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFS  573
            TELFR P+VSFLYERGWR +F ++GGFPGPEKEF++ ++YLK V+GG IIDASCGSG+F+
Sbjct  133  TELFRTPVVSFLYERGWRQNF-VFGGFPGPEKEFDMAKNYLKRVLGGKIIDASCGSGMFT  191

Query  574  RL  579
            RL
Sbjct  192  RL  193



>ref|XP_010937469.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Elaeis guineensis]
Length=345

 Score =   168 bits (426),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = +1

Query  112  FAVKIRALS--TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  285
             + +IRA S  T  VE  PV LI + KV    N L CP+CY       +   ++ S A S
Sbjct  31   LSARIRASSSATASVEADPVALIPDAKVSTGINNLGCPVCYYPLISQSNASQTIESTAGS  90

Query  286  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLW  465
             +EC  C+K Y  N T++DLT+AGG K Y E +   TELFR  LVSFLYERGWR +F +W
Sbjct  91   YVECHICKKAYFSNGTYLDLTVAGGSKEYTETMPGGTELFRSQLVSFLYERGWRQNF-IW  149

Query  466  GGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            GGFPGP++EFE+ + YL P +GG I+DASCGSGLFSRL
Sbjct  150  GGFPGPQREFEMAKVYLTPTIGGTIVDASCGSGLFSRL  187



>ref|XP_009106463.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Brassica rapa]
Length=337

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 112/169 (66%), Gaps = 8/169 (5%)
 Frame = +1

Query  85   PLTPKANRLFAVKIRA--LSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFT-WNGDP  255
            P+    +RL +VK  A  L  + +    V  + EK+   +  +LACPICY++       P
Sbjct  16   PIGLSVSRLLSVKYAAQRLPVSVLISARVDYVVEKE---KKKILACPICYNSLAALISQP  72

Query  256  GLSLSSMAQ-SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLY  432
              S    A  ++L+C  C+K YS NETH+DLT+A G K Y E L  S EL+R PLVSFLY
Sbjct  73   HESAEYPASGTHLQCKYCKKSYSANETHLDLTVASGTKQYTEPLPLSIELYRNPLVSFLY  132

Query  433  ERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            ERGWR +F +WGGFPGPEKEFE+  +YLK V+GGNIIDASCGSGLFSRL
Sbjct  133  ERGWRQNF-MWGGFPGPEKEFEMASEYLKHVLGGNIIDASCGSGLFSRL  180



>ref|XP_008808068.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Phoenix dactylifera]
Length=339

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 107/164 (65%), Gaps = 3/164 (2%)
 Frame = +1

Query  94   PKANRLFAVKIRALS--TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSL  267
            P A    +V+IRA S  T  VE  PV  I + KV    N L CP+CY       +   ++
Sbjct  23   PSAKPPLSVRIRASSSVTASVEANPVDPIPDAKVSTGMNNLGCPVCYYPLISKSNASQTV  82

Query  268  SSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWR  447
            +S A S++EC  C+K Y  N  ++DLT++ G K Y E + A TELFR  LVSFLYERGWR
Sbjct  83   ASPAGSDVECHICKKDYFNNGIYLDLTVSSGSKEYTETVPAGTELFRSQLVSFLYERGWR  142

Query  448  XSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
             +F +WGGFPGP++EFE+ + YL P +GG I+DASCGSGLFSRL
Sbjct  143  QNF-IWGGFPGPQREFEMAKVYLTPTIGGTIVDASCGSGLFSRL  185



>gb|KJB59930.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=258

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 115/177 (65%), Gaps = 11/177 (6%)
 Frame = +1

Query  52   KLGYNS-KFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICY  228
            +L  NS +F F P T     +F   + A +   VE       +E      +  LACPICY
Sbjct  17   QLSKNSARFLFRPFT---TLVFTRSLTAKAPIAVEK------EESGGGGGSCGLACPICY  67

Query  229  DAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFR  408
            +  T   D  + + S   SNL+C+TC+K YSG +TH+DL  + G K Y E++  +TELFR
Sbjct  68   NPLTVISDSPIYVGSTVGSNLQCNTCKKTYSGTQTHLDLVASSGSKQYDESMPLATELFR  127

Query  409  LPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
             P+VSFLYERGWR +F ++GGFPGPEKEF++ ++YLK V+GG I+DASCGSG+F+RL
Sbjct  128  TPVVSFLYERGWRQNF-VFGGFPGPEKEFDMAKNYLKRVLGGKIVDASCGSGMFTRL  183



>ref|XP_008391145.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=291

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = +1

Query  271  SMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRX  450
            S++ S+ +C TC+K Y GNETH+DLT A G K YGE+   STE+FR PLVS+LYERGWR 
Sbjct  33   SVSGSSFQCRTCKKTYFGNETHIDLTTASGAKDYGESKPVSTEMFRTPLVSYLYERGWRQ  92

Query  451  SFSLWGGFPGPEKEFELMQDYLKPVM-GGNIIDASCGSGLFSRL  579
            SF++WGGFPGPEKEFEL++D+LKPV+ GGNIIDASCGSG+FSRL
Sbjct  93   SFTVWGGFPGPEKEFELIKDFLKPVLGGGNIIDASCGSGMFSRL  136



>ref|XP_008466034.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Cucumis melo]
Length=356

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 106/137 (77%), Gaps = 2/137 (1%)
 Frame = +1

Query  169  LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLT  348
            +ID++  +I+ N+LAC IC    T   D GLS+ S     LEC TC+K ++G+E+H+DLT
Sbjct  67   MIDKEVNKIK-NILACSICRGPLTAAADSGLSVESTNGYQLECGTCKKSFTGSESHLDLT  125

Query  349  IAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVM  528
            I GG  + GE++ A+TE+FR  LVSFLYERGWR SFS+  GFPGPEKEFEL+++++ PV+
Sbjct  126  ITGGINS-GESMPAATEIFRTRLVSFLYERGWRQSFSVLLGFPGPEKEFELIKNFITPVL  184

Query  529  GGNIIDASCGSGLFSRL  579
            GG+IIDASCGSG+FSR+
Sbjct  185  GGSIIDASCGSGMFSRI  201



>ref|XP_009106462.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Brassica rapa]
Length=348

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 112/165 (68%), Gaps = 9/165 (5%)
 Frame = +1

Query  100  ANRL-FAVKIRALSTTF-VEDKP-VRLIDEKKVEIRTNLLACPICYDAFT-WNGDPGLSL  267
            A RL  +V I A   +F VE K  V  + EK+   +  +LACPICY++       P  S 
Sbjct  31   AQRLPVSVLISARVCSFAVETKSSVDYVVEKE---KKKILACPICYNSLAALISQPHESA  87

Query  268  SSMAQ-SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGW  444
               A  ++L+C  C+K YS NETH+DLT+A G K Y E L  S EL+R PLVSFLYERGW
Sbjct  88   EYPASGTHLQCKYCKKSYSANETHLDLTVASGTKQYTEPLPLSIELYRNPLVSFLYERGW  147

Query  445  RXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            R +F +WGGFPGPEKEFE+  +YLK V+GGNIIDASCGSGLFSRL
Sbjct  148  RQNF-MWGGFPGPEKEFEMASEYLKHVLGGNIIDASCGSGLFSRL  191



>gb|KJB59931.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=339

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 115/177 (65%), Gaps = 11/177 (6%)
 Frame = +1

Query  52   KLGYNS-KFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICY  228
            +L  NS +F F P T     +F   + A +   VE       +E      +  LACPICY
Sbjct  17   QLSKNSARFLFRPFT---TLVFTRSLTAKAPIAVEK------EESGGGGGSCGLACPICY  67

Query  229  DAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFR  408
            +  T   D  + + S   SNL+C+TC+K YSG +TH+DL  + G K Y E++  +TELFR
Sbjct  68   NPLTVISDSPIYVGSTVGSNLQCNTCKKTYSGTQTHLDLVASSGSKQYDESMPLATELFR  127

Query  409  LPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
             P+VSFLYERGWR +F ++GGFPGPEKEF++ ++YLK V+GG I+DASCGSG+F+RL
Sbjct  128  TPVVSFLYERGWRQNF-VFGGFPGPEKEFDMAKNYLKRVLGGKIVDASCGSGMFTRL  183



>emb|CDX87473.1| BnaA07g34000D [Brassica napus]
Length=356

 Score =   164 bits (414),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 113/165 (68%), Gaps = 9/165 (5%)
 Frame = +1

Query  100  ANRL-FAVKIRALSTTF-VEDKP-VRLIDEKKVEIRTNLLACPICYDAFT-WNGDPGLSL  267
            A RL  +V I A   +F VE K  V  + EK+   +  +LACPICY++       P  S 
Sbjct  31   AQRLPVSVLISARVCSFAVETKSSVDYVVEKE---KKKILACPICYNSLAALISQPHESA  87

Query  268  SSMAQ-SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGW  444
               A  ++L+C  C+K YS NETH+DLT+A G K Y E L  S EL+R PLVSFLYERGW
Sbjct  88   EYPASATHLQCKYCKKSYSANETHLDLTVASGTKQYTEPLPLSIELYRNPLVSFLYERGW  147

Query  445  RXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            R +F +WGGFPGPEKEFE+ +++LK V+GGNIIDASCGSGLFSRL
Sbjct  148  RQNF-MWGGFPGPEKEFEMAKEHLKHVLGGNIIDASCGSGLFSRL  191



>ref|XP_010105909.1| putative methyltransferase [Morus notabilis]
 gb|EXC06728.1| putative methyltransferase [Morus notabilis]
Length=266

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +1

Query  262  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  441
            S  S++ S+L+CSTCRK Y G ETH++LT A G K YGE +  +TELFR  LVSFLYERG
Sbjct  6    SRESVSGSSLQCSTCRKTYFGIETHLELTAASGAKNYGEPMPIATELFRTQLVSFLYERG  65

Query  442  WRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            WR SFS+WGGFPGPEKEFEL + +L+PV GGNI+DASCGSGLFSRL
Sbjct  66   WRQSFSVWGGFPGPEKEFELTKKFLEPVFGGNIVDASCGSGLFSRL  111



>ref|XP_008790838.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Phoenix dactylifera]
Length=313

 Score =   160 bits (404),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 96/144 (67%), Gaps = 1/144 (1%)
 Frame = +1

Query  148  VEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN  327
            VE  P  LI + KV    N+ ACP+CY +F    D  LS++S A S  EC  C+K Y  N
Sbjct  17   VEANPEDLIPDTKVGTGLNIFACPVCYHSFIDQSDSSLSITSPAGSCFECHACKKAYLNN  76

Query  328  ETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQ  507
              ++DLTIAGG + Y + L   T+ FR  L+S+LYERGWR SF  WGGFPGPE+E E+ +
Sbjct  77   GIYLDLTIAGGLREYDQTLPFLTKFFRGALISYLYERGWRQSFR-WGGFPGPERELEMAK  135

Query  508  DYLKPVMGGNIIDASCGSGLFSRL  579
             YL+P  GG I+DASCGSGLFSRL
Sbjct  136  YYLRPAKGGTIVDASCGSGLFSRL  159



>ref|XP_008790837.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Phoenix dactylifera]
Length=315

 Score =   159 bits (403),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 96/144 (67%), Gaps = 1/144 (1%)
 Frame = +1

Query  148  VEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN  327
            VE  P  LI + KV    N+ ACP+CY +F    D  LS++S A S  EC  C+K Y  N
Sbjct  17   VEANPEDLIPDTKVGTGLNIFACPVCYHSFIDQSDSSLSITSPAGSCFECHACKKAYLNN  76

Query  328  ETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQ  507
              ++DLTIAGG + Y + L   T+ FR  L+S+LYERGWR SF  WGGFPGPE+E E+ +
Sbjct  77   GIYLDLTIAGGLREYDQTLPFLTKFFRGALISYLYERGWRQSFR-WGGFPGPERELEMAK  135

Query  508  DYLKPVMGGNIIDASCGSGLFSRL  579
             YL+P  GG I+DASCGSGLFSRL
Sbjct  136  YYLRPAKGGTIVDASCGSGLFSRL  159



>ref|XP_004136403.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cucumis sativus]
Length=313

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 97/126 (77%), Gaps = 1/126 (1%)
 Frame = +1

Query  202  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  381
            N+LAC IC+   T     GL + S     LEC TC+K ++G+E+H+DLTI GG  + GE+
Sbjct  34   NILACSICHGPLTAAAGSGLPVESTNGYQLECGTCKKSFTGSESHLDLTITGGTDS-GES  92

Query  382  LAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGS  561
            + A+TE+FR  LVSFLYERGWR SFS+  GFPGPEKEFEL+++++ PV+GG+IIDASCGS
Sbjct  93   MPAATEIFRTRLVSFLYERGWRQSFSVLLGFPGPEKEFELIKNFITPVLGGSIIDASCGS  152

Query  562  GLFSRL  579
            G+FSR+
Sbjct  153  GMFSRI  158



>ref|XP_004161765.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cucumis sativus]
Length=376

 Score =   158 bits (400),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +1

Query  175  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  354
            D +  +I+ N+LAC IC+   T     GL + S     LEC TC+K ++G+E+H+DLTI 
Sbjct  89   DNEDNKIK-NILACSICHGPLTAAAGSGLPVESTNGYQLECGTCKKSFTGSESHLDLTIT  147

Query  355  GGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGG  534
            GG  + GE++ A+TE+FR  LVSFLYERGWR SFS+  GFPGPEKEFEL+++++ PV+GG
Sbjct  148  GGTDS-GESMPAATEIFRTRLVSFLYERGWRQSFSVLLGFPGPEKEFELIKNFITPVLGG  206

Query  535  NIIDASCGSGLFSRL  579
            +IIDASCGSG+FSR+
Sbjct  207  SIIDASCGSGMFSRI  221



>ref|XP_010667997.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=349

 Score =   157 bits (398),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 103/154 (67%), Gaps = 1/154 (1%)
 Frame = +1

Query  118  VKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLEC  297
            +++R  S   +E  P  +  +K  +   ++L CPICY+  TW+GD  LS+ +++ + L+ 
Sbjct  42   LRLRVSSIAVIETTPESVTTDKNSDTNKSILGCPICYEPLTWSGDSTLSIETVSGTTLQS  101

Query  298  STCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFP  477
             T +K Y  N+   DLT + G K Y E++   TE F  P +S+LYERGWR +F L GG+P
Sbjct  102  QTSKKTYYENKFIFDLTTSSGAKDYVESMPLVTEFFSTPFMSYLYERGWRQNFGL-GGYP  160

Query  478  GPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            G +KEFE+ ++Y KPV+GGNI+DASCGSGLFSRL
Sbjct  161  GADKEFEMAKEYFKPVLGGNIVDASCGSGLFSRL  194



>ref|XP_002268200.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Vitis vinifera]
Length=340

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 102/155 (66%), Gaps = 4/155 (3%)
 Frame = +1

Query  112  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  291
            F  + RA S   +E +    ++    ++  +L +CP+CY+     G PGL+L ++ +S  
Sbjct  36   FPSRFRASSAVALEPESSPQLNN---DMDFDLFSCPVCYEPLIRKGPPGLNLPAIYRSGF  92

Query  292  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGG  471
            +C TC K YS  + ++DLTI  G KAY EA    TELFR PLVSFLYERGWR +F+L  G
Sbjct  93   KCKTCNKSYSSKDMYLDLTITAGSKAYNEAQPVRTELFRSPLVSFLYERGWRQNFNLR-G  151

Query  472  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            FPGP++EF++ Q+Y KP  GG ++D SCGSGLFSR
Sbjct  152  FPGPDEEFKMAQEYFKPAAGGLLVDVSCGSGLFSR  186



>emb|CBI25578.3| unnamed protein product [Vitis vinifera]
Length=338

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 102/155 (66%), Gaps = 4/155 (3%)
 Frame = +1

Query  112  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  291
            F  + RA S   +E +    ++    ++  +L +CP+CY+     G PGL+L ++ +S  
Sbjct  34   FPSRFRASSAVALEPESSPQLNN---DMDFDLFSCPVCYEPLIRKGPPGLNLPAIYRSGF  90

Query  292  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGG  471
            +C TC K YS  + ++DLTI  G KAY EA    TELFR PLVSFLYERGWR +F+L  G
Sbjct  91   KCKTCNKSYSSKDMYLDLTITAGSKAYNEAQPVRTELFRSPLVSFLYERGWRQNFNLR-G  149

Query  472  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            FPGP++EF++ Q+Y KP  GG ++D SCGSGLFSR
Sbjct  150  FPGPDEEFKMAQEYFKPAAGGLLVDVSCGSGLFSR  184



>ref|XP_010656529.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Vitis vinifera]
Length=343

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 102/155 (66%), Gaps = 4/155 (3%)
 Frame = +1

Query  112  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  291
            F  + RA S   +E +    ++    ++  +L +CP+CY+     G PGL+L ++ +S  
Sbjct  36   FPSRFRASSAVALEPESSPQLNN---DMDFDLFSCPVCYEPLIRKGPPGLNLPAIYRSGF  92

Query  292  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGG  471
            +C TC K YS  + ++DLTI  G KAY EA    TELFR PLVSFLYERGWR +F+L  G
Sbjct  93   KCKTCNKSYSSKDMYLDLTITAGSKAYNEAQPVRTELFRSPLVSFLYERGWRQNFNLR-G  151

Query  472  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            FPGP++EF++ Q+Y KP  GG ++D SCGSGLFSR
Sbjct  152  FPGPDEEFKMAQEYFKPAAGGLLVDVSCGSGLFSR  186



>emb|CDP10502.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 106/172 (62%), Gaps = 5/172 (3%)
 Frame = +1

Query  61   YNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFT  240
            YNS  S  PL   + + F   IRA S   +E  P   I E K  ++ +L ACPICYD   
Sbjct  19   YNS-LSHPPLRCSSPQQFRQIIRATSAVALE--PEAQI-ESKEGLKIDLFACPICYDPLV  74

Query  241  WNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLV  420
              G  G +L ++ +S  +C TC K YS    ++DLT+  G K Y E   A TELFR PLV
Sbjct  75   RKGPSGFNLPAIYRSGFKCRTCNKTYSSKNIYLDLTVTAGSKDYNEFKPAGTELFRSPLV  134

Query  421  SFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            SFLYERGWR +F+   GFPGP+ EF++ Q+Y +PV GG ++D SCGSGLFSR
Sbjct  135  SFLYERGWRQNFN-RSGFPGPDDEFKMAQEYFQPVEGGVLVDVSCGSGLFSR  185



>ref|XP_011017926.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
 ref|XP_011017927.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
 ref|XP_011017928.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
Length=336

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 104/175 (59%), Gaps = 9/175 (5%)
 Frame = +1

Query  52   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  231
             L +NS FS S L   + R F   IRA S   +E        E   +    + ACP+CY+
Sbjct  20   HLSHNSLFSPSRLRFTSLR-FPSTIRATSAVVLEP-------ELSTQQNQAIFACPVCYE  71

Query  232  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  411
                 G PG +L ++ QS+ +C  C K YS  + ++DLTI  G K Y E     TELFR 
Sbjct  72   PLIRKGPPGFNLPAIYQSSFKCKKCTKTYSSKDNYLDLTITAGMKDYTEINPVRTELFRS  131

Query  412  PLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            PLVSFLYERGWR SF+   GFPGP++EFE+ Q+Y KP  GG ++D SCGSGLFSR
Sbjct  132  PLVSFLYERGWRQSFN-QSGFPGPDEEFEMAQEYFKPAGGGLLVDVSCGSGLFSR  185



>gb|KJB53959.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=269

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 101/168 (60%), Gaps = 4/168 (2%)
 Frame = +1

Query  82   SPLTPK---ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGD  252
            SP  P    ++R F + +RA S   +E        ++   + T L +CP+CY+     G 
Sbjct  26   SPFRPSLYFSSRPFRLTVRASSAVALEQDLRTQATQQNQTVETELFSCPVCYEPLIRKGP  85

Query  253  PGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLY  432
            PGL+L ++ +S  +C  C K YS  +  +DLT+  G + Y E     TELFR PLVSFLY
Sbjct  86   PGLNLDAIYRSGFKCKKCNKSYSSKDVFLDLTVTTGLRNYTEVKPVRTELFRSPLVSFLY  145

Query  433  ERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            ERGWR +F+L  GFPG ++EF + Q+Y KP  GG ++D SCGSGLFSR
Sbjct  146  ERGWRQNFNL-SGFPGADEEFRMAQEYFKPAEGGTLVDVSCGSGLFSR  192



>gb|KJB14720.1| hypothetical protein B456_002G140100, partial [Gossypium raimondii]
Length=386

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 110/196 (56%), Gaps = 41/196 (21%)
 Frame = +1

Query  112  FAVKIRALSTTFVEDKPV-----------RLIDEKKVEIRTNLLACPICYDAFTWNGDPG  258
             A K+   ST FVE  P             ++ EK+     N+LACPICYD  TW     
Sbjct  40   LAAKVLVSSTAFVETHPTICKQQNLYQWEPVVVEKEDSGSDNVLACPICYDPLTWTVGSP  99

Query  259  LSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYER  438
              + S + SNL+  TC+K Y GN+TH+DL  +GG K Y  ++  +TELFR P+VSFLYER
Sbjct  100  SYVGSKSGSNLQSKTCKKSYFGNQTHLDLVASGGSKQYDNSMPLATELFRTPVVSFLYER  159

Query  439  GWRXSFSLWGGFPG----------------------PEKE-------FELMQDYLKPVMG  531
            GWR +F ++GGFPG                      P+ E       FE+ + YLKPV+G
Sbjct  160  GWRQNF-IFGGFPGSIMKLFWNIYQNIRIFEASSSYPKVEGRSACLDFEMAKKYLKPVLG  218

Query  532  GNIIDASCGSGLFSRL  579
            GNI+DASCGSGLFSRL
Sbjct  219  GNIVDASCGSGLFSRL  234



>ref|XP_009363912.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Pyrus x bretschneideri]
Length=344

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 114/195 (58%), Gaps = 6/195 (3%)
 Frame = +1

Query  4    MATAGLGYVSAVLVTRK---LGYNSKFSFSPLTPKANRLFAVKIRALST-TFVEDKPVRL  171
            MAT     +    ++R    L  NS+F   P     +R  +  IRA ST T   ++  R 
Sbjct  1    MATTPSSALHQTFLSRNYSPLRRNSQFGH-PRLRLPSRHHSHPIRATSTVTLPPERRSRA  59

Query  172  IDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  351
             + +   +   LLACP+CY+     G PGL+L ++ +S  +C  C K YS  + ++DLT+
Sbjct  60   EEIQSSGVDLELLACPVCYEPLIRKGPPGLNLRAIYRSGFKCRKCDKSYSSKDVYLDLTV  119

Query  352  AGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMG  531
              G K Y E     TELFR PLVSFLYERGWR +F+L  GFPGP++EF++ QDY K   G
Sbjct  120  TAGLKEYVEVQPIQTELFRSPLVSFLYERGWRQNFNL-SGFPGPDEEFKMAQDYFKSAEG  178

Query  532  GNIIDASCGSGLFSR  576
            G ++D SCGSGLFSR
Sbjct  179  GVLVDVSCGSGLFSR  193



>ref|XP_004973409.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Setaria italica]
Length=350

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 92/134 (69%), Gaps = 6/134 (4%)
 Frame = +1

Query  178  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  357
            E   E + + LACPICY  F    DP     S   S+LECSTC+K Y   + + DLT+A 
Sbjct  69   EPAPETKLSKLACPICYYPFVSASDP-----SGDASSLECSTCKKVYPNKQDYWDLTVAV  123

Query  358  GGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGN  537
            G   Y E+  A+TE+FR PLVSFLYERGWR +F +WGGFPG E+EFE+ + YL P +GG 
Sbjct  124  GSTEYSESKPAATEIFRTPLVSFLYERGWRQNF-IWGGFPGLEREFEMAKTYLNPTIGGT  182

Query  538  IIDASCGSGLFSRL  579
            I+DASCGSGLFSRL
Sbjct  183  IVDASCGSGLFSRL  196



>gb|KJB53958.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=343

 Score =   152 bits (385),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 101/168 (60%), Gaps = 4/168 (2%)
 Frame = +1

Query  82   SPLTPK---ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGD  252
            SP  P    ++R F + +RA S   +E        ++   + T L +CP+CY+     G 
Sbjct  26   SPFRPSLYFSSRPFRLTVRASSAVALEQDLRTQATQQNQTVETELFSCPVCYEPLIRKGP  85

Query  253  PGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLY  432
            PGL+L ++ +S  +C  C K YS  +  +DLT+  G + Y E     TELFR PLVSFLY
Sbjct  86   PGLNLDAIYRSGFKCKKCNKSYSSKDVFLDLTVTTGLRNYTEVKPVRTELFRSPLVSFLY  145

Query  433  ERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            ERGWR +F+L  GFPG ++EF + Q+Y KP  GG ++D SCGSGLFSR
Sbjct  146  ERGWRQNFNL-SGFPGADEEFRMAQEYFKPAEGGTLVDVSCGSGLFSR  192



>ref|XP_006659389.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Oryza brachyantha]
Length=358

 Score =   152 bits (385),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 103/165 (62%), Gaps = 8/165 (5%)
 Frame = +1

Query  100  ANRLFAVKIRA-LSTTFVEDKPVRLIDEKKVEI----RTNLLACPICYDAFTWNGDPGLS  264
            A R+    +RA  S   V   P  ++ E  VE     + + LACPICY     + D  L 
Sbjct  43   AKRVLRSSLRASASPDVVSTVPDEVVAEPSVEPEAEKKLSKLACPICYYPLASSSDQSLP  102

Query  265  LSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGW  444
            L+    S+L+CSTC+K Y     + D+T+A G   Y E+   STELFR PLVSFLYERGW
Sbjct  103  LN--VASSLQCSTCKKFYPNRGDYWDMTVAVGSTVYSESTTVSTELFRTPLVSFLYERGW  160

Query  445  RXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            R +F +WGGFPGPE+E+E  + YLKP  GG I+DASCGSGLFSRL
Sbjct  161  RQNF-IWGGFPGPEREYETAKAYLKPTAGGIIVDASCGSGLFSRL  204



>ref|XP_008788786.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Phoenix dactylifera]
Length=348

 Score =   152 bits (384),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 103/163 (63%), Gaps = 6/163 (4%)
 Frame = +1

Query  88   LTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSL  267
            L+P + R F ++  A + T   D  V     K+  +  +LLACPICY+  T  G  GL+L
Sbjct  35   LSPPSLRGFRLRATAAALTVEPDTQV-----KQDSLELDLLACPICYEPLTRKGPSGLNL  89

Query  268  SSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWR  447
             ++ +S  +C  C K +S  + ++DLTI  G K Y E     TELFR P+VSFLYERGWR
Sbjct  90   PAIYRSGFKCLKCNKSFSSKDVYLDLTITSGTKEYNEFKPTRTELFRSPIVSFLYERGWR  149

Query  448  XSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
             +F+   GFPGP++EF + Q+Y KPV GG ++D SCGSGLFSR
Sbjct  150  QNFN-RSGFPGPDEEFNMAQEYFKPVAGGLLVDVSCGSGLFSR  191



>gb|KJB27062.1| hypothetical protein B456_004G275300 [Gossypium raimondii]
Length=337

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = +1

Query  106  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  285
            R F    RA ST  +E     L  +K     T+L +CP+CY+     G PGL+L+++ +S
Sbjct  34   RPFRFTARASSTVSLETD---LSIQKNQTEETDLFSCPVCYEPLIRKGPPGLNLAAIYRS  90

Query  286  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLW  465
              +C  C K YS  +T++DLT+  G + Y E   A TELFR P VSF+YERGWR +F+  
Sbjct  91   GFKCKQCDKSYSSKDTYLDLTVTAGLRDYTEVKPAGTELFRSPFVSFVYERGWRQNFN-R  149

Query  466  GGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
             GFPGP++EF + Q+Y KPV GG ++D SCGSGLFSR
Sbjct  150  RGFPGPDEEFRMAQEYFKPVEGGILVDVSCGSGLFSR  186



>gb|KJB27061.1| hypothetical protein B456_004G275300 [Gossypium raimondii]
Length=332

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = +1

Query  106  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  285
            R F    RA ST  +E     L  +K     T+L +CP+CY+     G PGL+L+++ +S
Sbjct  34   RPFRFTARASSTVSLETD---LSIQKNQTEETDLFSCPVCYEPLIRKGPPGLNLAAIYRS  90

Query  286  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLW  465
              +C  C K YS  +T++DLT+  G + Y E   A TELFR P VSF+YERGWR +F+  
Sbjct  91   GFKCKQCDKSYSSKDTYLDLTVTAGLRDYTEVKPAGTELFRSPFVSFVYERGWRQNFN-R  149

Query  466  GGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
             GFPGP++EF + Q+Y KPV GG ++D SCGSGLFSR
Sbjct  150  RGFPGPDEEFRMAQEYFKPVEGGILVDVSCGSGLFSR  186



>ref|XP_006473930.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Citrus sinensis]
Length=333

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 106/165 (64%), Gaps = 7/165 (4%)
 Frame = +1

Query  82   SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  261
            SP  P++ R F+  IRA++      +PV+    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPVKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  262  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  441
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  442  WRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            WR +F+   GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR
Sbjct  139  WRQNFN-RSGFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSR  182



>ref|XP_010939635.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Elaeis guineensis]
Length=313

 Score =   149 bits (376),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 95/147 (65%), Gaps = 1/147 (1%)
 Frame = +1

Query  136  STTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKK  315
            S+  VE  P  LI + KV    N+LACPICY +F    +  LS++S   S +EC  C+K 
Sbjct  13   SSPAVEANPEDLIPDTKVGTGLNILACPICYRSFIDQNNSSLSITSPDGSCIECHGCKKA  72

Query  316  YSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEF  495
            Y  N  ++DLTI GG K Y + L   T  FR   +S+LYERGWR SF  WGGFPG ++E 
Sbjct  73   YLNNGIYLDLTITGGLKEYDQTLPFLTGFFRSSWISYLYERGWRQSFR-WGGFPGLQREI  131

Query  496  ELMQDYLKPVMGGNIIDASCGSGLFSR  576
            E+ ++YL+P  GG I+DASCGSGLFSR
Sbjct  132  EMAKNYLRPAKGGTIVDASCGSGLFSR  158



>ref|XP_002324579.2| methyltransferase-related family protein [Populus trichocarpa]
 gb|EEF03144.2| methyltransferase-related family protein [Populus trichocarpa]
Length=332

 Score =   149 bits (376),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 89/138 (64%), Gaps = 1/138 (1%)
 Frame = +1

Query  163  VRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVD  342
            +R      +E    + ACP+CY+     G PG +L ++ +S+ +C  C K YS  + ++D
Sbjct  45   IRATSAVALEPNQAIFACPVCYEPLIRKGPPGFNLPAIYRSSFKCKKCTKTYSSKDNYLD  104

Query  343  LTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKP  522
            LTI  G K Y E     TELFR PLVSFLYERGWR SF+   GFPGP++EFE+ Q+Y KP
Sbjct  105  LTITAGMKDYTEINPVRTELFRSPLVSFLYERGWRQSFN-QSGFPGPDEEFEMAQEYFKP  163

Query  523  VMGGNIIDASCGSGLFSR  576
              GG ++D SCGSGLFSR
Sbjct  164  ARGGLLVDVSCGSGLFSR  181



>ref|XP_006453728.1| hypothetical protein CICLE_v10008875mg [Citrus clementina]
 gb|ESR66968.1| hypothetical protein CICLE_v10008875mg [Citrus clementina]
Length=333

 Score =   149 bits (376),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 105/165 (64%), Gaps = 7/165 (4%)
 Frame = +1

Query  82   SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  261
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  262  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  441
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCNKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  442  WRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            WR +F+   GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR
Sbjct  139  WRQNFN-RSGFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSR  182



>gb|KDO59315.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=304

 Score =   148 bits (374),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 105/165 (64%), Gaps = 7/165 (4%)
 Frame = +1

Query  82   SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  261
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  262  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  441
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  442  WRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            WR +F+   GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR
Sbjct  139  WRQNFN-RSGFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSR  182



>ref|XP_011470680.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=336

 Score =   149 bits (376),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 105/175 (60%), Gaps = 10/175 (6%)
 Frame = +1

Query  52   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  231
            +L +NS      L+P   R  ++ IRA + T  +    +      +E     L+CP+CY+
Sbjct  20   RLHHNSH-----LSPPRLRFHSLPIRATTITLQQSSSTQKSQSSGIE----FLSCPVCYE  70

Query  232  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  411
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  71   PLIRKGPTGLNLEAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKQYVEVNPARTELFRS  130

Query  412  PLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            PLVSFLYERGWR +FS   GFPGP++EF++ QDY KP  GG ++D SCGSGLFSR
Sbjct  131  PLVSFLYERGWRQNFS-SSGFPGPDEEFKMAQDYFKPAEGGLLVDVSCGSGLFSR  184



>gb|KHG26587.1| hypothetical protein F383_01046 [Gossypium arboreum]
Length=337

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  178  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  357
            +K     T+L +CP+CY+     G PGL+L+++ +S  +C  C K YS  +T++DLT+  
Sbjct  55   QKNQTEETDLFSCPVCYEPLIRKGPPGLNLAAIYRSGFKCKQCDKSYSSKDTYLDLTVTA  114

Query  358  GGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGN  537
            G + Y E   A TELFR P VSF+YERGWR +F+   GFPGP++EF + Q+Y KPV GG 
Sbjct  115  GLRDYTEVKPAGTELFRSPFVSFVYERGWRQNFN-RRGFPGPDEEFRMAQEYFKPVEGGI  173

Query  538  IIDASCGSGLFSR  576
            ++D SCGSGLFSR
Sbjct  174  LVDVSCGSGLFSR  186



>gb|KDO59313.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
 gb|KDO59314.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=333

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 105/165 (64%), Gaps = 7/165 (4%)
 Frame = +1

Query  82   SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  261
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  262  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  441
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  442  WRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            WR +F+   GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR
Sbjct  139  WRQNFN-RSGFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSR  182



>gb|AFK46366.1| unknown [Medicago truncatula]
Length=342

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 96/151 (64%), Gaps = 2/151 (1%)
 Frame = +1

Query  124  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  303
            IRA S   V D P+ L  +K    + +L ACPICY+     G  GL+L ++ +S  +C  
Sbjct  43   IRATSAVVV-DSPLDLSTKKDQGTQVDLFACPICYEPLIRKGPIGLNLPAIYRSGFKCKR  101

Query  304  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGP  483
            C+K Y+  + ++DLT+  G + Y E     TELFR PLVSFLYERGWR +F    GFPGP
Sbjct  102  CQKSYTSKDGYLDLTVTSGLRDYVEVQPNRTELFRSPLVSFLYERGWRQNFR-QSGFPGP  160

Query  484  EKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            ++EF + Q+Y +P  GG I+D SCGSGLFSR
Sbjct  161  DEEFRMAQEYFEPAKGGRIVDVSCGSGLFSR  191



>gb|KDO59316.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=314

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 105/165 (64%), Gaps = 7/165 (4%)
 Frame = +1

Query  82   SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  261
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  262  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  441
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  442  WRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            WR +F+   GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR
Sbjct  139  WRQNFN-RSGFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSR  182



>gb|ACJ84583.1| unknown [Medicago truncatula]
 gb|KEH37883.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=342

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 96/151 (64%), Gaps = 2/151 (1%)
 Frame = +1

Query  124  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  303
            IRA S   V D P+ L  +K    + +L ACPICY+     G  GL+L ++ +S  +C  
Sbjct  43   IRATSAVVV-DSPLDLSTKKDQGTQVDLFACPICYEPLIRKGPIGLNLPAIYRSGFKCKR  101

Query  304  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGP  483
            C+K Y+  + ++DLT+  G + Y E     TELFR PLVSFLYERGWR +F    GFPGP
Sbjct  102  CQKSYTSKDGYLDLTVTSGLRDYVEVQPNRTELFRSPLVSFLYERGWRQNFR-QSGFPGP  160

Query  484  EKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            ++EF + Q+Y +P  GG I+D SCGSGLFSR
Sbjct  161  DEEFRMAQEYFEPAKGGRIVDVSCGSGLFSR  191



>gb|KDO59317.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=319

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 105/165 (64%), Gaps = 7/165 (4%)
 Frame = +1

Query  82   SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  261
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  262  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  441
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  442  WRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            WR +F+   GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR
Sbjct  139  WRQNFN-RSGFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSR  182



>ref|XP_006359517.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum tuberosum]
Length=345

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 107/184 (58%), Gaps = 6/184 (3%)
 Frame = +1

Query  25   YVSAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTN  204
            + S V + R +  NSK      T  ++  +  +IRA S   VE +   L    +V     
Sbjct  17   HRSLVPIQRGVSLNSKIRVP--TRFSSNGYTSRIRATSAVAVEPE---LRTPAQVVTEAE  71

Query  205  LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEAL  384
            L ACPICY+     G  G ++ ++ +S  +C  C K YS    ++DLT+  G K Y E+ 
Sbjct  72   LFACPICYEPLIRKGPSGFNVPAIYRSGFKCRKCNKSYSSKNIYLDLTVTSGTKEYNESK  131

Query  385  AASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSG  564
               TELFR P+VSFLYERGWR SF+  GGFPGP++EF++ QDY K   GG ++D SCGSG
Sbjct  132  PTGTELFRSPVVSFLYERGWRQSFN-RGGFPGPDEEFKMAQDYFKVAEGGVLVDVSCGSG  190

Query  565  LFSR  576
            LFSR
Sbjct  191  LFSR  194



>ref|XP_009802104.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Nicotiana sylvestris]
Length=345

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 100/159 (63%), Gaps = 4/159 (3%)
 Frame = +1

Query  100  ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMA  279
            ++R F  +IRA S   VE +  R + +   E  T L ACPICY+     G  G ++ ++ 
Sbjct  40   SSRGFTSRIRASSAIAVEPES-RTLGQDATE--TELFACPICYEPLMRKGPSGFNVPAIY  96

Query  280  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFS  459
            +S  +C  C K YS    ++DLTI  G K Y E+  A TELFR PLVSFLYERGWR +F+
Sbjct  97   RSGFKCRKCNKSYSSKSIYLDLTITSGTKEYSESKPARTELFRSPLVSFLYERGWRQAFN  156

Query  460  LWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
               GFPGP++EF++ Q+Y K   GG +ID SCGSGLFSR
Sbjct  157  R-SGFPGPDEEFKMAQEYFKVAEGGVVIDVSCGSGLFSR  194



>ref|XP_008336951.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
 ref|XP_008336952.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=348

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 108/175 (62%), Gaps = 3/175 (2%)
 Frame = +1

Query  55   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVE-IRTNLLACPICYD  231
            L +N++F   P     +R  +  IRA ST  ++ +     +E +   +   LLACP+CY+
Sbjct  25   LHHNTQFR-PPHLCLTSRHSSHPIRATSTVTLQPERRSTAEEGQSSGVDLELLACPVCYE  83

Query  232  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  411
                 G PGL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  84   PLIRKGPPGLNLRAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKEYVEVKPAGTELFRS  143

Query  412  PLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            P+VSFLYERGWR +F+   GFPGP++EF++ QDY K   GG ++D SCGSGLFSR
Sbjct  144  PIVSFLYERGWRQNFNR-RGFPGPDEEFKMAQDYFKSAEGGVLVDVSCGSGLFSR  197



>gb|ABR16838.1| unknown [Picea sitchensis]
Length=326

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 97/151 (64%), Gaps = 5/151 (3%)
 Frame = +1

Query  124  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  303
            IRA +T    D  V    +  VE   ++L+CPICY      G  GL++S +++S  +C  
Sbjct  57   IRAAATVEAPDVKV----DSNVETTVDVLSCPICYKPLIRKGPSGLNMSFISRSGFQCGN  112

Query  304  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGP  483
            C+K YS  + ++DLT+  G   Y E    +TELFR PLVSF+YERGWR +F+  GGFPGP
Sbjct  113  CKKAYSTRDVYIDLTVTAGSSEYDEYRPLTTELFRSPLVSFVYERGWRQNFA-SGGFPGP  171

Query  484  EKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            ++EF + Q  L+P  GG ++DASCGSGLFSR
Sbjct  172  DEEFRMAQKILEPAAGGLLVDASCGSGLFSR  202



>ref|XP_004974685.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like, 
partial [Setaria italica]
Length=323

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 95/143 (66%), Gaps = 6/143 (4%)
 Frame = +1

Query  151  EDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNE  330
            +++   L+ E   E++ + LACPICY  F    D      S   S+LECSTC+K Y   +
Sbjct  34   DEEVAELLVETVPEMKLSKLACPICYYPFVSASD-----QSGDASSLECSTCKKVYPNKQ  88

Query  331  THVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQD  510
             + DLT+A G   Y E++ A+TELFR  LVSFLYERGWR +F  WGGFPG  +EFE+ + 
Sbjct  89   DYWDLTVAVGSTEYTESMPAATELFRTSLVSFLYERGWRQTFR-WGGFPGRTREFEMAKT  147

Query  511  YLKPVMGGNIIDASCGSGLFSRL  579
            YL P +GG I+DASCGSGLFSRL
Sbjct  148  YLNPTIGGTIVDASCGSGLFSRL  170



>ref|XP_002445476.1| hypothetical protein SORBIDRAFT_07g020130 [Sorghum bicolor]
 gb|EES14971.1| hypothetical protein SORBIDRAFT_07g020130 [Sorghum bicolor]
Length=352

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 91/134 (68%), Gaps = 6/134 (4%)
 Frame = +1

Query  178  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  357
            E   E +   LACPICY         G S  S   S+LECSTC+K Y   + + DLT++ 
Sbjct  71   EPAAETKLRKLACPICYYPLA-----GSSDQSDDASSLECSTCKKSYPNKQDYWDLTVSV  125

Query  358  GGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGN  537
            G   Y E++ A+TELFR PLVSFLYERGWR +F +WGGFPG E+EFE+ + YLKP  GG 
Sbjct  126  GSIEYSESMPAATELFRTPLVSFLYERGWRQNF-IWGGFPGLEREFEMAKTYLKPTFGGT  184

Query  538  IIDASCGSGLFSRL  579
            I+DASCGSGLFSRL
Sbjct  185  IVDASCGSGLFSRL  198



>ref|XP_003574470.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Brachypodium distachyon]
 ref|XP_010235114.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Brachypodium distachyon]
Length=361

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 106/168 (63%), Gaps = 14/168 (8%)
 Frame = +1

Query  82   SPLTPKANRLFAVKI--RALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDP  255
            S L   A++ F   +   A++   VE +PV  + +         LACPICY     + D 
Sbjct  52   SALRASASQAFTAGVPDEAVAEPLVEAEPVAELGK---------LACPICYYPLVSSLDQ  102

Query  256  GLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYE  435
              S  S + S+LEC TC+K YS  + + DLT+A G   Y E++ A+TELFR  LVSFLYE
Sbjct  103  --SAPSKSDSSLECPTCKKVYSDEDGYWDLTVAVGSTEYSESMPAATELFRTQLVSFLYE  160

Query  436  RGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            RGWR +F +WGGFPG E+EFE+ + YLKP  GG I+DASCGSGLFSRL
Sbjct  161  RGWRQNF-IWGGFPGLEREFEMAKTYLKPTTGGIIVDASCGSGLFSRL  207



>ref|XP_010687777.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=339

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 89/128 (70%), Gaps = 1/128 (1%)
 Frame = +1

Query  193  IRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAY  372
            ++ +LLACPIC++     G PGL+L ++ +S  +C TC K YS    ++DLT+  G + Y
Sbjct  62   VQNDLLACPICFETLMRRGPPGLNLEAIYRSGFKCQTCNKSYSSKNVYLDLTVTAGSEEY  121

Query  373  GEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  552
             E    STELFR P+VSFLYERGWR +F+   GFPG E+EF++ Q+Y KP  GG ++D S
Sbjct  122  SENKPTSTELFRSPVVSFLYERGWRQNFN-RSGFPGLEEEFKMAQEYFKPAEGGLLVDVS  180

Query  553  CGSGLFSR  576
            CGSGLFSR
Sbjct  181  CGSGLFSR  188



>ref|XP_011470644.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=337

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 106/175 (61%), Gaps = 8/175 (5%)
 Frame = +1

Query  52   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  231
            +L +NS      L+P   R  ++ IRA + T  +++       +   I    L+CP+CY+
Sbjct  20   RLHHNSH-----LSPPRLRFHSLPIRATTITLQQEQSSSTQKSQSSGI--EFLSCPVCYE  72

Query  232  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  411
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  73   PLIRKGPTGLNLEAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKQYVEVNPARTELFRS  132

Query  412  PLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            PLVSFLYERGWR +FS   GFPGP++EF++ QDY KP  GG ++D SCGSGLFSR
Sbjct  133  PLVSFLYERGWRQNFS-SSGFPGPDEEFKMAQDYFKPAEGGLLVDVSCGSGLFSR  186



>ref|XP_004287240.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=338

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 106/175 (61%), Gaps = 8/175 (5%)
 Frame = +1

Query  52   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  231
            +L +NS      L+P   R  ++ IRA + T  +++       +   I    L+CP+CY+
Sbjct  20   RLHHNSH-----LSPPRLRFHSLPIRATTITLQQEQSSSTQKSQSSGI--EFLSCPVCYE  72

Query  232  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  411
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  73   PLIRKGPTGLNLEAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKQYVEVNPARTELFRS  132

Query  412  PLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            PLVSFLYERGWR +FS   GFPGP++EF++ QDY KP  GG ++D SCGSGLFSR
Sbjct  133  PLVSFLYERGWRQNFS-SSGFPGPDEEFKMAQDYFKPAEGGLLVDVSCGSGLFSR  186



>ref|XP_011020252.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
Length=338

 Score =   147 bits (372),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 104/175 (59%), Gaps = 5/175 (3%)
 Frame = +1

Query  52   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  231
             L +NS+F  + L     R F   IRA S   +E +   L  ++   +  +  ACPICY 
Sbjct  18   HLFHNSRFPATRLRFTYLR-FPSTIRATSAVSLEPE---LSTQQSQTLEVDPFACPICYQ  73

Query  232  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  411
                 G  G +L ++ +S  +C+ C K YS  E ++DLTI  G K Y E     TELFR 
Sbjct  74   PLIRKGPTGFNLPAIYRSGFKCNRCNKTYSSKENYLDLTITAGMKDYTEVKPVRTELFRS  133

Query  412  PLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            PLVSFLYERGWR +F+   GFPGP++EF++ Q+Y KP  GG ++D SCGSGLFSR
Sbjct  134  PLVSFLYERGWRQNFN-QSGFPGPDEEFKMAQEYFKPTEGGLLVDVSCGSGLFSR  187



>ref|XP_011078555.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Sesamum indicum]
Length=338

 Score =   147 bits (370),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 106/190 (56%), Gaps = 13/190 (7%)
 Frame = +1

Query  34   AVLVTRKLGYNSKFSFSPLTPKANR---------LFAVKIRALSTTFVEDKPVRLIDEKK  186
            AV     L +    +F P  P+  R         + + +IRA S   +E +   L  E +
Sbjct  2    AVAAQASLRFYQNSAFFPRNPRLFRDSRLRPPPGVCSARIRASSAVALEPE---LTTEAQ  58

Query  187  VEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGK  366
                 +L ACPICY+     G  G +L ++ +S  +C  C K YS    ++DLT+  G K
Sbjct  59   DTTDVDLFACPICYEPLIRKGPSGFNLPAIYRSGFKCRKCNKSYSSKNIYLDLTVTSGTK  118

Query  367  AYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIID  546
             Y E   A TELFR PLVSF+YERGWR +F+   GFPGP++EF + Q+Y KP  GG ++D
Sbjct  119  EYNEFKPAGTELFRSPLVSFVYERGWRQNFN-RSGFPGPDEEFNMAQEYFKPAEGGVLVD  177

Query  547  ASCGSGLFSR  576
             SCGSGLFSR
Sbjct  178  VSCGSGLFSR  187



>ref|XP_002531454.1| phosphatidylethanolamine n-methyltransferase, putative [Ricinus 
communis]
 gb|EEF30941.1| phosphatidylethanolamine n-methyltransferase, putative [Ricinus 
communis]
Length=290

 Score =   145 bits (367),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 86/125 (69%), Gaps = 1/125 (1%)
 Frame = +1

Query  202  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  381
            ++ ACP+CY+     G PG +LS++ +S  +C  C K YS  + ++DLTI    K Y E 
Sbjct  14   DVFACPVCYEPLIRKGPPGFNLSAIYRSGFKCKKCNKTYSSKDNYLDLTITASMKEYTEV  73

Query  382  LAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGS  561
              A TELFR PLVSFLYERGWR +F+   GFPGP++EF++ Q+Y KP  GG ++D SCGS
Sbjct  74   KPARTELFRSPLVSFLYERGWRQNFN-QSGFPGPDEEFKMAQEYFKPAEGGILVDVSCGS  132

Query  562  GLFSR  576
            GLFSR
Sbjct  133  GLFSR  137



>ref|XP_002268107.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Vitis vinifera]
 emb|CBI25579.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   147 bits (370),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 100/155 (65%), Gaps = 4/155 (3%)
 Frame = +1

Query  112  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  291
            F  +IRA S   +E +    ++     +  +L +CP+CY+     G PGL+L ++ +S  
Sbjct  36   FPSRIRASSAVALEPESSTQLNNG---LEFDLFSCPVCYEPLIRKGPPGLNLPAIYRSGF  92

Query  292  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGG  471
            +C +C K YS  + ++DLTI  G K Y E     TELFR PLVSFLYERGWR +F+   G
Sbjct  93   KCRSCNKSYSSKDMYLDLTITAGSKDYNELQPNRTELFRSPLVSFLYERGWRQNFN-QSG  151

Query  472  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            FPG ++EF++ Q+Y +PV+GG ++D SCGSGLFSR
Sbjct  152  FPGRDEEFKMAQEYFEPVIGGLLVDVSCGSGLFSR  186



>ref|XP_004488470.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Cicer arietinum]
Length=346

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 104/175 (59%), Gaps = 5/175 (3%)
 Frame = +1

Query  52   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  231
             L   S+F    L  ++++     IRA S   V +    L  +  +  + +L ACPICY+
Sbjct  26   HLSSESQFRLQLL--RSHQTQRTTIRATSAAVVVESD--LTTQHDLNTQVDLFACPICYE  81

Query  232  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  411
                 G  G +LS++ +S  +C  C+K Y+  + ++DLT+  G + Y E     TELFR 
Sbjct  82   PLIRKGPVGFNLSAIYRSGFKCKRCQKAYTSKDGYLDLTVTSGLRDYTEVQPVRTELFRS  141

Query  412  PLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            PLVSFLYERGWR +F    GFPGPE+EF++ Q+Y +P  GG IID SCGSGLFSR
Sbjct  142  PLVSFLYERGWRQNFR-QSGFPGPEEEFKMAQEYFEPAKGGLIIDVSCGSGLFSR  195



>ref|XP_004965743.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Setaria italica]
Length=299

 Score =   145 bits (367),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = +1

Query  175  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  354
            D++     T + ACP+CY+A    G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  9    DQQNSISETEVFACPVCYEALIRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  68

Query  355  GGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGG  534
             G K Y E   A TELFR PLVSFLYERGWR +F+   GFPG ++EF++ QDY +PV GG
Sbjct  69   SGTKEYTEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQPVAGG  127

Query  535  NIIDASCGSGLFSR  576
             ++D SCGSGLF+R
Sbjct  128  ILLDVSCGSGLFTR  141



>ref|XP_004242718.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum lycopersicum]
Length=339

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 96/155 (62%), Gaps = 4/155 (3%)
 Frame = +1

Query  112  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  291
            F  +IRA S    E +   L    +  +   L ACPICY+  T  G  G ++ ++ +S  
Sbjct  38   FTSRIRATSAVVAEPE---LRTPAQDSMEAELFACPICYEPLTRKGPSGFNVPAIYRSGF  94

Query  292  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGG  471
            +C  C K YS  + ++DLT+  G K Y E   A +ELFR P+VSFLYERGWR +F+L  G
Sbjct  95   KCRKCNKSYSSKDIYLDLTVTSGTKQYNEVKPARSELFRSPIVSFLYERGWRQNFNL-SG  153

Query  472  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            FPGP++EF++ Q+Y K   GG ++D SCGSGLFSR
Sbjct  154  FPGPDEEFKMAQEYFKVAEGGVLVDVSCGSGLFSR  188



>ref|XP_008389527.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=304

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 98/154 (64%), Gaps = 6/154 (4%)
 Frame = +1

Query  124  IRALSTTFVEDKPVRLIDEKKVE---IRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLE  294
            IRA ST  V   P R    ++++   +   +LACPICY+     G PGL+L ++ +S  +
Sbjct  43   IRATST--VALPPERRSRAEEIQSSGVDLEVLACPICYEPLIRRGPPGLNLRAIYRSGFK  100

Query  295  CSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGF  474
            C  C K YS  + ++DLT+  G K Y E     TELFR PLVSFLYERGWR +F+   GF
Sbjct  101  CRKCDKXYSSKDXYLDLTVTAGLKEYVEVQPXXTELFRSPLVSFLYERGWRQNFN-RSGF  159

Query  475  PGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            PGP++EF++ QDY K   GG ++D SCGSGLFSR
Sbjct  160  PGPDEEFKMAQDYFKSAEGGVLVDVSCGSGLFSR  193



>ref|XP_006852799.1| hypothetical protein AMTR_s00033p00159870 [Amborella trichopoda]
 gb|ERN14266.1| hypothetical protein AMTR_s00033p00159870 [Amborella trichopoda]
Length=343

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 88/128 (69%), Gaps = 1/128 (1%)
 Frame = +1

Query  193  IRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAY  372
            ++ NL ACPICY+     G  GL+L ++ +S  +C TCRK YS  +  +DLT+  G K Y
Sbjct  42   LQYNLFACPICYEPLIRKGPSGLTLPAVYRSGFKCQTCRKSYSSKDVFLDLTVTSGTKDY  101

Query  373  GEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  552
             E     TELFR PLVSFLYERGWR +FS   GFPGP++EF++ Q++ +P  GG ++D S
Sbjct  102  NEFKPPRTELFRSPLVSFLYERGWRQTFS-GSGFPGPDEEFKMAQEFFEPAAGGLLVDVS  160

Query  553  CGSGLFSR  576
            CGSGLFSR
Sbjct  161  CGSGLFSR  168



>gb|EEC83568.1| hypothetical protein OsI_29220 [Oryza sativa Indica Group]
Length=352

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 99/156 (63%), Gaps = 7/156 (4%)
 Frame = +1

Query  130  ALSTTFVEDKPVRLIDEKKVEI------RTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  291
            +++  FV   P   ++E  VE       +   LACPICY     + D    +S+ + S+L
Sbjct  52   SVTPEFVTASPDEAVEESSVEREPAAENKLRKLACPICYYPLISSSDQSAPVSAASSSSL  111

Query  292  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGG  471
            ECSTC+K Y     + D+T+A G   Y E+   +TE+FR PLVSFLYERGWR +F +W G
Sbjct  112  ECSTCKKFYPNRGDYWDMTVAVGSTEYSESTTVTTEVFRTPLVSFLYERGWRQNF-IWSG  170

Query  472  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            FPG E+EFE+ Q YLKP  GG I+DASCGSGLFSRL
Sbjct  171  FPGLEREFEMAQTYLKPTTGGIIVDASCGSGLFSRL  206



>ref|NP_001061786.1| Os08g0411200 [Oryza sativa Japonica Group]
 dbj|BAF23700.1| Os08g0411200 [Oryza sativa Japonica Group]
 dbj|BAH00216.1| unnamed protein product [Oryza sativa Japonica Group]
Length=358

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 99/156 (63%), Gaps = 7/156 (4%)
 Frame = +1

Query  130  ALSTTFVEDKPVRLIDEKKVEI------RTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  291
            +++  FV   P   ++E  VE       +   LACPICY     + D    +S+ + S+L
Sbjct  50   SVTPEFVTAAPDEAVEESSVEREPAAENKLRKLACPICYYPLISSSDQSAPVSAASSSSL  109

Query  292  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGG  471
            ECSTC+K Y     + D+T+A G   Y E+   +TE+FR PLVSFLYERGWR +F +W G
Sbjct  110  ECSTCKKFYPNRGDYWDMTVAVGSTEYSESTTVTTEVFRTPLVSFLYERGWRQNF-IWSG  168

Query  472  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            FPG E+EFE+ Q YLKP  GG I+DASCGSGLFSRL
Sbjct  169  FPGLEREFEMAQTYLKPTTGGIIVDASCGSGLFSRL  204



>gb|KJB53960.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=300

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = +1

Query  178  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  357
            ++   + T L +CP+CY+     G PGL+L ++ +S  +C  C K YS  +  +DLT+  
Sbjct  18   QQNQTVETELFSCPVCYEPLIRKGPPGLNLDAIYRSGFKCKKCNKSYSSKDVFLDLTVTT  77

Query  358  GGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGN  537
            G + Y E     TELFR PLVSFLYERGWR +F+L  GFPG ++EF + Q+Y KP  GG 
Sbjct  78   GLRNYTEVKPVRTELFRSPLVSFLYERGWRQNFNL-SGFPGADEEFRMAQEYFKPAEGGT  136

Query  538  IIDASCGSGLFSR  576
            ++D SCGSGLFSR
Sbjct  137  LVDVSCGSGLFSR  149



>gb|KDP30197.1| hypothetical protein JCGZ_16979 [Jatropha curcas]
Length=345

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 105/175 (60%), Gaps = 3/175 (2%)
 Frame = +1

Query  52   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  231
             L  NS+  F P    ++  F   IRA S   +E + +   +E+   +  +  ACPICY+
Sbjct  21   HLSRNSRI-FHPRLQFSSLRFHSTIRATSAVALE-RDLGKQEEQSQTLEVDPFACPICYE  78

Query  232  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  411
                 G PG +LS++ +S  +C  C K Y+  + ++DLTI    K Y E   A +ELFR 
Sbjct  79   PLIRKGPPGFNLSAIYRSGFKCKKCNKTYTSKDKYLDLTITAAMKEYTEVKPARSELFRS  138

Query  412  PLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            PLVSFLYERGWR +F+   GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR
Sbjct  139  PLVSFLYERGWRQNFNR-SGFPGPDEEFKMAQEYFKQAEGGLLVDVSCGSGLFSR  192



>ref|XP_004242719.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Solanum lycopersicum]
Length=341

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 96/158 (61%), Gaps = 10/158 (6%)
 Frame = +1

Query  112  FAVKIRALSTTFVEDK---PVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQ  282
            F  +IRA S   VE +   P + + E +      L ACPICY+     G  G ++ ++ +
Sbjct  40   FTSRIRATSAVAVEPELRTPAQDVAEAE------LFACPICYEPLIRKGPSGFNVPAVYR  93

Query  283  SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSL  462
            S  +C  C K YS    ++DLT+  G K Y E+    TELFR P+VSFLYERGWR SF+ 
Sbjct  94   SGFKCRKCNKSYSSKNIYLDLTVTSGTKEYNESKPTGTELFRSPVVSFLYERGWRQSFN-  152

Query  463  WGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
             GGFPGP++EF + QDY K   GG ++D SCGSGLFSR
Sbjct  153  RGGFPGPDEEFNMAQDYFKVAEGGVLVDVSCGSGLFSR  190



>ref|NP_001132053.1| uncharacterized LOC100193465 [Zea mays]
 gb|ACF80738.1| unknown [Zea mays]
 gb|AFW76186.1| LOW QUALITY PROTEIN: S-adenosylmethionine-dependent methyltransferase 
[Zea mays]
Length=356

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  175  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  354
            +++ + + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  66   EQQNIIMETEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  125

Query  355  GGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGG  534
             G K Y E   A TELFR PLVSFLYERGWR +F+   GFPG ++EF++ QDY +P+ GG
Sbjct  126  AGTKEYSEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQPIAGG  184

Query  535  NIIDASCGSGLFSR  576
             ++D SCGSGLF+R
Sbjct  185  ILLDVSCGSGLFTR  198



>ref|XP_004965742.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Setaria italica]
Length=354

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = +1

Query  175  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  354
            D++     T + ACP+CY+A    G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  64   DQQNSISETEVFACPVCYEALIRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  123

Query  355  GGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGG  534
             G K Y E   A TELFR PLVSFLYERGWR +F+   GFPG ++EF++ QDY +PV GG
Sbjct  124  SGTKEYTEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQPVAGG  182

Query  535  NIIDASCGSGLFSR  576
             ++D SCGSGLF+R
Sbjct  183  ILLDVSCGSGLFTR  196



>gb|ACG27569.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
Length=344

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  175  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  354
            +++ + + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  54   EQQNIIMETEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  113

Query  355  GGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGG  534
             G K Y E   A TELFR PLVSFLYERGWR +F+   GFPG ++EF++ QDY +P+ GG
Sbjct  114  AGTKEYSEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQPIAGG  172

Query  535  NIIDASCGSGLFSR  576
             ++D SCGSGLF+R
Sbjct  173  ILLDVSCGSGLFTR  186



>gb|EMT07919.1| Putative methyltransferase [Aegilops tauschii]
Length=358

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 88/127 (69%), Gaps = 1/127 (1%)
 Frame = +1

Query  196  RTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYG  375
            +T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+  G K Y 
Sbjct  75   KTEVFACPVCYEPLIRKGPPGMNLPAIYRSGFKCSKCNKSFTSKDVFLDLTVTSGMKEYS  134

Query  376  EALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASC  555
            E   A TELFR PLVSFLYERGWR +F+   GFPG ++EF++ QDY KPV GG ++D SC
Sbjct  135  ELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGRDEEFQMAQDYFKPVAGGILVDVSC  193

Query  556  GSGLFSR  576
            GSGLFSR
Sbjct  194  GSGLFSR  200



>gb|EEE68668.1| hypothetical protein OsJ_27281 [Oryza sativa Japonica Group]
Length=369

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 99/156 (63%), Gaps = 7/156 (4%)
 Frame = +1

Query  130  ALSTTFVEDKPVRLIDEKKVEI------RTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  291
            +++  FV   P   ++E  VE       +   LACPICY     + D    +S+ + S+L
Sbjct  50   SVTPEFVTAAPDEAVEESSVEREPAAENKLRKLACPICYYPLISSSDQSAPVSAASSSSL  109

Query  292  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGG  471
            ECSTC+K Y     + D+T+A G   Y E+   +TE+FR PLVSFLYERGWR +F +W G
Sbjct  110  ECSTCKKFYPNRGDYWDMTVAVGSTEYSESTTVTTEVFRTPLVSFLYERGWRQNF-IWSG  168

Query  472  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            FPG E+EFE+ Q YLKP  GG I+DASCGSGLFSRL
Sbjct  169  FPGLEREFEMAQTYLKPTTGGIIVDASCGSGLFSRL  204



>gb|ACF85541.1| unknown [Zea mays]
 gb|ACF88073.1| unknown [Zea mays]
Length=346

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  175  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  354
            +++ + + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  56   EQQNIIMETEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  115

Query  355  GGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGG  534
             G K Y E   A TELFR PLVSFLYERGWR +F+   GFPG ++EF++ QDY +P+ GG
Sbjct  116  AGTKEYSEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQPIAGG  174

Query  535  NIIDASCGSGLFSR  576
             ++D SCGSGLF+R
Sbjct  175  ILLDVSCGSGLFTR  188



>ref|XP_006359516.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum tuberosum]
Length=343

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 98/155 (63%), Gaps = 4/155 (3%)
 Frame = +1

Query  112  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  291
            +  +IRA S   VE + +R   +   E    L ACPICY+     G  G ++ ++ +S  
Sbjct  42   YTSRIRATSAVAVEPE-LRTPAQDATE--AELFACPICYEPLIRKGPSGFNVPAIYRSGF  98

Query  292  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGG  471
            +CS C K YS  + ++DLT+  G K Y E   A +ELFR P+VSFLYERGWR +F+L  G
Sbjct  99   KCSKCNKSYSSKDIYLDLTVTSGTKQYNEVKPARSELFRSPIVSFLYERGWRQNFNL-SG  157

Query  472  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            FPGP++EF++ Q+Y K   GG ++D SCGSGLFSR
Sbjct  158  FPGPDEEFKMAQEYFKVAEGGVLVDVSCGSGLFSR  192



>ref|XP_002438745.1| hypothetical protein SORBIDRAFT_10g025400 [Sorghum bicolor]
 gb|EER90112.1| hypothetical protein SORBIDRAFT_10g025400 [Sorghum bicolor]
Length=352

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 88/128 (69%), Gaps = 1/128 (1%)
 Frame = +1

Query  193  IRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAY  372
            + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+  G K Y
Sbjct  68   METEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVTAGTKEY  127

Query  373  GEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  552
             E   A TELFR PLVSFLYERGWR +F+   GFPG ++EFE+ QDY +PV GG ++D S
Sbjct  128  SEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFEMAQDYFQPVAGGILLDVS  186

Query  553  CGSGLFSR  576
            CGSGLF+R
Sbjct  187  CGSGLFTR  194



>dbj|BAF93193.1| putative methyltransferase-like [Hordeum vulgare]
Length=165

 Score =   140 bits (352),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 86/127 (68%), Gaps = 1/127 (1%)
 Frame = +1

Query  196  RTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYG  375
            +T + ACP+CY+     G PG++L ++ +S  +C  C K ++  +  +DLT+  G K Y 
Sbjct  18   KTEVFACPVCYEPLIRKGPPGMNLPAIYRSGFKCPKCNKSFTSKDVFLDLTVTSGMKQYS  77

Query  376  EALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASC  555
            E   A TELFR PLVSFLYERGWR +F+   GFPG ++EF++ QDY + V GG ++D SC
Sbjct  78   ELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGRDEEFQMAQDYFQSVAGGILVDVSC  136

Query  556  GSGLFSR  576
            GSGLFSR
Sbjct  137  GSGLFSR  143



>ref|NP_001150427.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
 gb|ACG39054.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
 tpg|DAA49108.1| TPA: S-adenosylmethionine-dependent methyltransferase [Zea mays]
Length=348

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 88/130 (68%), Gaps = 6/130 (5%)
 Frame = +1

Query  190  EIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKA  369
            E +   LACPICY     + D     +S     LEC TC+K Y   + + DLT++ G   
Sbjct  71   ETKLRKLACPICYYPLASSSDQLDDATS-----LECPTCKKCYPNKQDYWDLTVSVGSTE  125

Query  370  YGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDA  549
            Y E++  +TELFR PLVSFLYERGWR +F +WGGFPG E+EFE+ + YLKP +GG I+DA
Sbjct  126  YSESMPVATELFRTPLVSFLYERGWRQNF-IWGGFPGLEREFEMAKTYLKPTIGGTIVDA  184

Query  550  SCGSGLFSRL  579
            SCGSGLFSRL
Sbjct  185  SCGSGLFSRL  194



>gb|KHG21340.1| hypothetical protein F383_03824 [Gossypium arboreum]
Length=394

 Score =   145 bits (366),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 100/168 (60%), Gaps = 4/168 (2%)
 Frame = +1

Query  82   SPLTPK---ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGD  252
            SP  P    +++ F + +RA S   +E        ++   + T L +CP+CY+     G 
Sbjct  77   SPFRPSLHFSSKPFRLTVRASSAVALEQDLRTQGTQQNQTVETELFSCPVCYEPLIRKGP  136

Query  253  PGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLY  432
             GL+L ++ +S  +C  C K +S  +  +DLT+  G + Y E     TELFR PLVSFLY
Sbjct  137  LGLNLDAIYRSGFKCKKCNKSFSSKDVFLDLTVTAGLRNYTEVKPVRTELFRSPLVSFLY  196

Query  433  ERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            ERGWR +F+L  GFPG ++EF + Q+Y KP  GG ++D SCGSGLFSR
Sbjct  197  ERGWRQNFNL-SGFPGADEEFRMAQEYFKPAEGGTLVDVSCGSGLFSR  243



>ref|XP_010099510.1| putative methyltransferase [Morus notabilis]
 gb|EXB79361.1| putative methyltransferase [Morus notabilis]
Length=346

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 97/151 (64%), Gaps = 2/151 (1%)
 Frame = +1

Query  124  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  303
            IRA S+  +  +P   ++E +    + + ACP+CY+     G  GL+L ++ +S  +C  
Sbjct  47   IRATSSV-IALEPSSSVEENRSSEVSEVFACPVCYEPLIRKGPSGLNLEAIYRSGFKCKK  105

Query  304  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGP  483
            C K YS  + ++DLT+  G + Y E   A TELFR PLVSFLYERGWR +F+   GFPGP
Sbjct  106  CNKSYSSKDIYLDLTVTAGLRDYTEVKPAGTELFRSPLVSFLYERGWRQNFN-RSGFPGP  164

Query  484  EKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            ++EF++ Q Y K V GG ++D SCGSGLFSR
Sbjct  165  DEEFKMAQGYFKSVEGGLLVDVSCGSGLFSR  195



>ref|XP_002988667.1| hypothetical protein SELMODRAFT_46133, partial [Selaginella moellendorffii]
 gb|EFJ10178.1| hypothetical protein SELMODRAFT_46133, partial [Selaginella moellendorffii]
Length=269

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 86/125 (69%), Gaps = 1/125 (1%)
 Frame = +1

Query  202  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  381
             LLACPIC+DA    G PG++  ++A+S  +CSTC++ +S    ++DLT+  G K Y E 
Sbjct  1    ELLACPICFDALLRKGPPGINQFAIAKSGFQCSTCKRSFSSRNEYLDLTVTSGAKDYVEV  60

Query  382  LAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGS  561
                TELFR PLVS +YERGWR +F    GFPGP++E ++  +YL+P  GG I+D SCGS
Sbjct  61   PPTGTELFRNPLVSLIYERGWRQNFER-SGFPGPDEELKMALEYLRPAFGGVIVDVSCGS  119

Query  562  GLFSR  576
            GLF+R
Sbjct  120  GLFTR  124



>ref|XP_010928269.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X3 [Elaeis guineensis]
Length=315

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 91/141 (65%), Gaps = 6/141 (4%)
 Frame = +1

Query  169  LIDEKKVEIR-----TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNET  333
            L+D +  +++      NLLACPICY+     G  GL+L ++ +S  +C  C K +S  + 
Sbjct  19   LLDIQDTQVKQDFLEVNLLACPICYEPLMRKGPSGLNLPAIYRSGFKCLKCNKSFSSKDV  78

Query  334  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDY  513
            ++DLTI  G K Y E     TELFR P VSFLYERGWR +F+   GFPGP++EF + Q+Y
Sbjct  79   YLDLTITSGTKEYNELKPTRTELFRSPFVSFLYERGWRQNFN-RSGFPGPDEEFNMAQEY  137

Query  514  LKPVMGGNIIDASCGSGLFSR  576
             K V GG ++D SCGSGLFSR
Sbjct  138  FKTVAGGLLVDVSCGSGLFSR  158



>ref|XP_010928267.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=355

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 96/157 (61%), Gaps = 6/157 (4%)
 Frame = +1

Query  106  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  285
            R F ++  A + T   D  V     K+  +  NLLACPICY+     G  GL+L ++ +S
Sbjct  48   RGFPLRATAAALTVEPDTQV-----KQDFLEVNLLACPICYEPLMRKGPSGLNLPAIYRS  102

Query  286  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLW  465
              +C  C K +S  + ++DLTI  G K Y E     TELFR P VSFLYERGWR +F+  
Sbjct  103  GFKCLKCNKSFSSKDVYLDLTITSGTKEYNELKPTRTELFRSPFVSFLYERGWRQNFN-R  161

Query  466  GGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
             GFPGP++EF + Q+Y K V GG ++D SCGSGLFSR
Sbjct  162  SGFPGPDEEFNMAQEYFKTVAGGLLVDVSCGSGLFSR  198



>ref|XP_003546595.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Glycine max]
 gb|KHN41316.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=341

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 95/151 (63%), Gaps = 4/151 (3%)
 Frame = +1

Query  124  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  303
            IRA+S    E +   L  ++   I  ++ ACP+CY+     G  GL+L ++ +S   C  
Sbjct  44   IRAISAVAAESE---LGTQQDQAIEADIFACPVCYEPLIRKGPSGLNLPAIYRSGFMCKR  100

Query  304  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGP  483
            C+K YS  + ++DLT+  G + Y E   A TELFR PLVSFLYERGWR +F    GFPGP
Sbjct  101  CKKSYSSKDRYLDLTVTAGLRDYTEIQPARTELFRSPLVSFLYERGWRQNFR-QSGFPGP  159

Query  484  EKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            ++EF++ Q+Y +   GG I+D SCGSGLFSR
Sbjct  160  DEEFKMAQEYFESAKGGLIVDVSCGSGLFSR  190



>ref|XP_009358530.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Pyrus x bretschneideri]
Length=345

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 105/175 (60%), Gaps = 3/175 (2%)
 Frame = +1

Query  55   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEI-RTNLLACPICYD  231
            L +NS+F   P   + +R  +  IRA ST  ++ +     +E +       LLACPICY+
Sbjct  22   LHHNSQFR-PPHLCRPSRHSSHPIRATSTVILQPRRRSPAEESQSSGGDLELLACPICYE  80

Query  232  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  411
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  81   PLIRKGPSGLNLRAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKEYVEVKPAGTELFRS  140

Query  412  PLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            PLVSFLYERGWR +F+   GFPGP++EF++ QDY      G ++D SCGSGLFSR
Sbjct  141  PLVSFLYERGWRQNFNR-RGFPGPDEEFKMAQDYFISAEAGVLVDVSCGSGLFSR  194



>ref|XP_007013645.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY31264.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=340

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 99/166 (60%), Gaps = 4/166 (2%)
 Frame = +1

Query  79   FSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPG  258
            F P    +++     +RA S   +E     L  ++   + T+L +CP+CY+     G  G
Sbjct  28   FRPSLHFSSQPLRFTVRASSAVALEPD---LSSQRNQTVDTDLFSCPVCYEPLIRKGPSG  84

Query  259  LSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYER  438
            L+L ++ +S  +C  C K YS  + ++DLTI  G + Y E     TELFR P VSF+YER
Sbjct  85   LNLEAIYRSGFKCKKCNKSYSSKDVYLDLTITAGLRDYTEVKPVGTELFRSPFVSFVYER  144

Query  439  GWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            GWR +F+   GFPGP++EF + Q+Y KP  GG ++D SCGSGLFSR
Sbjct  145  GWRQNFNR-SGFPGPDEEFRMAQEYFKPAEGGILVDVSCGSGLFSR  189



>ref|XP_003563313.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Brachypodium distachyon]
Length=356

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +1

Query  205  LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEAL  384
            + ACP+CY+     G PG++L ++ +S  +CS C+K ++  +  +DLT+  G K Y E  
Sbjct  76   VFACPVCYEPLIRKGPPGINLPAIYRSGFKCSKCKKSFTSKDIFLDLTVTSGTKEYSELK  135

Query  385  AASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSG  564
             A TELFR PLVSFLYERGWR +F+   GFPG ++EF++ QDY +PV GG +ID SCGSG
Sbjct  136  PARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQPVAGGILIDVSCGSG  194

Query  565  LFSR  576
            LF+R
Sbjct  195  LFTR  198



>ref|XP_009338403.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=345

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 105/175 (60%), Gaps = 3/175 (2%)
 Frame = +1

Query  55   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEI-RTNLLACPICYD  231
            L +NS+F   P   + +R  +  IRA ST  ++ +     +E +       LLACPICY+
Sbjct  22   LHHNSQFR-PPHLCRPSRHSSHPIRATSTVILQPERRAAAEESQSSGGDLELLACPICYE  80

Query  232  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  411
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  81   PLIRKGPSGLNLRAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKEYVEVKPAGTELFRS  140

Query  412  PLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            PLVSFLYERGWR +F+   GFPGP++EF++ QDY      G ++D SCGSGLFSR
Sbjct  141  PLVSFLYERGWRQNFNR-RGFPGPDEEFKMAQDYFISAEAGVLVDVSCGSGLFSR  194



>ref|XP_009338401.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=350

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 105/175 (60%), Gaps = 3/175 (2%)
 Frame = +1

Query  55   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEI-RTNLLACPICYD  231
            L +NS+F   P   + +R  +  IRA ST  ++ +     +E +       LLACPICY+
Sbjct  22   LHHNSQFR-PPHLCRPSRHSSHPIRATSTVILQPERRAAAEESQSSGGDLELLACPICYE  80

Query  232  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  411
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  81   PLIRKGPSGLNLRAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKEYVEVKPAGTELFRS  140

Query  412  PLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            PLVSFLYERGWR +F+   GFPGP++EF++ QDY      G ++D SCGSGLFSR
Sbjct  141  PLVSFLYERGWRQNFNR-RGFPGPDEEFKMAQDYFISAEAGVLVDVSCGSGLFSR  194



>ref|XP_006381066.1| methyltransferase-related family protein [Populus trichocarpa]
 gb|ERP58863.1| methyltransferase-related family protein [Populus trichocarpa]
Length=308

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 87/136 (64%), Gaps = 1/136 (1%)
 Frame = +1

Query  169  LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLT  348
            L  ++   +  +  ACPICY      G  G +L ++ +S  +C+ C K YS  E ++DLT
Sbjct  23   LSTQQSQTLEVDPFACPICYQPLIRKGPKGFNLPAIYRSGFKCNRCNKTYSSKENYLDLT  82

Query  349  IAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVM  528
            I  G K Y E     TELFR PLVSFLYERGWR +F+   GFPGP++EF++ Q+Y KP  
Sbjct  83   ITAGMKDYTEVKPVRTELFRSPLVSFLYERGWRQNFNQ-SGFPGPDEEFKMAQEYFKPTE  141

Query  529  GGNIIDASCGSGLFSR  576
            GG ++D SCGSGLFSR
Sbjct  142  GGLLVDVSCGSGLFSR  157



>ref|XP_010042876.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like, 
partial [Eucalyptus grandis]
Length=170

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 88/134 (66%), Gaps = 5/134 (4%)
 Frame = +1

Query  106  RLFAVKIRALSTTFVEDKPV-----RLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLS  270
            R+ A K+RA  + +VE +P        + ++K+    N LACPIC++  T+ GDP LS++
Sbjct  37   RVLAPKLRASYSAYVETRPPPPPLESTVRQEKLGGNQNALACPICFEPLTFTGDPVLSVN  96

Query  271  SMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRX  450
            S + S L+C TC+K Y GNETH DLT  GG K YGE +  ++ELFR PLVS+LYERGWR 
Sbjct  97   SASGSTLQCGTCKKAYVGNETHFDLTTTGGTKEYGEPVPFASELFRTPLVSYLYERGWRQ  156

Query  451  SFSLWGGFPGPEKE  492
             F    G PGPEKE
Sbjct  157  YFESLLGSPGPEKE  170



>gb|EYU34934.1| hypothetical protein MIMGU_mgv1a009522mg [Erythranthe guttata]
Length=339

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 105/190 (55%), Gaps = 13/190 (7%)
 Frame = +1

Query  34   AVLVTRKLGYNSKFSFSPLTPKANRLFAVK---------IRALSTTFVEDKPVRLIDEKK  186
            AV +   L ++    F P +P  +R   ++         IRA S   ++ +  R   E +
Sbjct  2    AVALQPSLRFHHNSPFFPKSPHLSRNSQIRPNPSFATASIRASSAVALDTESSR---EAQ  58

Query  187  VEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGK  366
                  L AC ICY+     G  G +L ++ +S  +C  C K YS    ++DLT+  G K
Sbjct  59   STSDVELFACAICYEPLIRKGPSGFNLQAIYRSGFKCRNCNKSYSSKNLYLDLTVTSGTK  118

Query  367  AYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIID  546
             Y E   A TELFR PLVSF+YERGWR +F+   GFPGP++EF + Q+Y KP  GG +ID
Sbjct  119  EYNEFQPAGTELFRSPLVSFVYERGWRQNFN-SRGFPGPDEEFSMAQEYFKPAEGGVLID  177

Query  547  ASCGSGLFSR  576
             SCGSGLFSR
Sbjct  178  VSCGSGLFSR  187



>dbj|BAJ94151.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 87/127 (69%), Gaps = 1/127 (1%)
 Frame = +1

Query  196  RTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYG  375
            +T + ACPICY+     G PG++L ++ +S  +CS C K ++  +  +DLT+  G K Y 
Sbjct  65   KTEVFACPICYEPLIRKGPPGMNLPAIYRSGFKCSKCNKSFTSKDVFLDLTVTSGMKQYS  124

Query  376  EALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASC  555
            E   A TELFR PLVSFLYERGWR +F+   GFPG ++EF++ QDY + V GG ++D SC
Sbjct  125  ELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGRDEEFQMAQDYFQSVAGGILVDVSC  183

Query  556  GSGLFSR  576
            GSGLFSR
Sbjct  184  GSGLFSR  190



>ref|XP_002986403.1| hypothetical protein SELMODRAFT_235009 [Selaginella moellendorffii]
 gb|EFJ12612.1| hypothetical protein SELMODRAFT_235009 [Selaginella moellendorffii]
Length=340

 Score =   142 bits (357),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 86/125 (69%), Gaps = 1/125 (1%)
 Frame = +1

Query  202  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  381
             LLACPIC+DA    G PG++  ++A+S  +CSTC++ +S    ++DLT+  G K Y E 
Sbjct  71   ELLACPICFDALLRKGPPGINQFAIAKSGFQCSTCKRSFSSRNEYLDLTVTSGAKDYVEV  130

Query  382  LAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGS  561
                TELFR PLVS +YERGWR +F    GFPGP++E ++  +YL+P  GG I+D SCGS
Sbjct  131  PPTGTELFRNPLVSLIYERGWRQNFE-RSGFPGPDEELKMALEYLRPAFGGVIVDVSCGS  189

Query  562  GLFSR  576
            GLF+R
Sbjct  190  GLFTR  194



>dbj|BAJ91607.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   142 bits (357),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 87/127 (69%), Gaps = 1/127 (1%)
 Frame = +1

Query  196  RTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYG  375
            +T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+  G K Y 
Sbjct  65   KTEVFACPVCYEPLIRKGPPGMNLPAIYRSGFKCSKCNKSFTSKDVFLDLTVTSGMKQYS  124

Query  376  EALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASC  555
            E   A TELFR PLVSFLYERGWR +F+   GFPG ++EF++ QDY + V GG ++D SC
Sbjct  125  ELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGRDEEFQMAQDYFQSVAGGILVDVSC  183

Query  556  GSGLFSR  576
            GSGLFSR
Sbjct  184  GSGLFSR  190



>gb|KHN28439.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=341

 Score =   141 bits (356),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 95/151 (63%), Gaps = 4/151 (3%)
 Frame = +1

Query  124  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  303
            IRA+S    E +   L  ++   I  ++ ACP+CY+     G  GL+L ++ +S   C  
Sbjct  44   IRAISAVAAESE---LGTQQDHAIEADIFACPVCYEPLIRKGPSGLNLPAIYRSGFMCKR  100

Query  304  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGP  483
            C+K YS  + ++DLT+  G + Y E   A TELFR PLVSFLYERGWR +F    GFPGP
Sbjct  101  CKKTYSSKDRYLDLTVTAGLRDYTEIQPARTELFRSPLVSFLYERGWRQNFR-QSGFPGP  159

Query  484  EKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            ++EF++ Q+Y +   GG ++D SCGSGLFSR
Sbjct  160  DEEFKMAQEYFESAEGGLLVDVSCGSGLFSR  190



>ref|XP_009386973.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=353

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 103/161 (64%), Gaps = 6/161 (4%)
 Frame = +1

Query  94   PKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSS  273
            P+++R   +++ A +   VE +  R+     ++++  LLACPICY+     G  GL++ S
Sbjct  42   PRSSR--GLRVSATAALSVEQE-TRVQHNDSMDLQ--LLACPICYEPLIRKGPAGLNVPS  96

Query  274  MAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXS  453
            + +S  +C  C K ++  + ++DLTI  G   Y E   A TELFR PLVSFLYERGWR +
Sbjct  97   IYRSGFKCQKCNKSFTSKDVYLDLTITSGTTEYSEFKPARTELFRSPLVSFLYERGWRQN  156

Query  454  FSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            F+   GFPG ++EF + Q+Y KPV GG ++D SCGSGLFSR
Sbjct  157  FN-RSGFPGLDEEFNMAQEYFKPVAGGLLVDVSCGSGLFSR  196



>ref|XP_007202300.1| hypothetical protein PRUPE_ppa007882mg [Prunus persica]
 gb|EMJ03499.1| hypothetical protein PRUPE_ppa007882mg [Prunus persica]
Length=352

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 85/124 (69%), Gaps = 1/124 (1%)
 Frame = +1

Query  205  LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEAL  384
            LLACP+CY+     G PGL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E  
Sbjct  79   LLACPVCYEPLIRKGPPGLNLQAIYRSAFKCKKCDKSYSSKDIYLDLTVIAGLKEYVEVK  138

Query  385  AASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSG  564
             A TELFR PLVSFLYERGWR +F+   GFPG ++EF++ QDY K   GG ++D SCGSG
Sbjct  139  PAGTELFRNPLVSFLYERGWRQNFN-RSGFPGLDEEFKMAQDYFKSAEGGVLLDVSCGSG  197

Query  565  LFSR  576
            LFSR
Sbjct  198  LFSR  201



>ref|XP_010533098.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Tarenaya hassleriana]
Length=345

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 88/136 (65%), Gaps = 1/136 (1%)
 Frame = +1

Query  169  LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLT  348
            LI  K   + T++ ACP+CY+     G PG++L ++ +S  +C  C K YS  + ++DLT
Sbjct  60   LITPKTQTLETDIFACPVCYEPLVRKGPPGINLQAIYRSGFKCRECEKTYSSKDGYLDLT  119

Query  349  IAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVM  528
            +      + E    +TELFR PLVSFLYERGWR +F+   GFPGP++EF + Q+Y +   
Sbjct  120  VTADSGNFDEVKPITTELFRSPLVSFLYERGWRQNFN-RSGFPGPDEEFRMAQEYFRSAE  178

Query  529  GGNIIDASCGSGLFSR  576
            GG ++D SCGSGLFSR
Sbjct  179  GGLLVDVSCGSGLFSR  194



>ref|XP_010050326.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=350

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = +1

Query  178  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  357
            +K   + + + +CPICY++    G  GL+L +M  S  +C+ C+K YS N   +DLT+  
Sbjct  68   QKDQTLESEIFSCPICYESLIRRGPSGLNLEAMHGSGFKCNRCKKSYSSNGNFLDLTLTA  127

Query  358  GGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGN  537
            G + Y E     TELFR PLVSFLYERGWR +F    GFPG E+EF++ Q+Y KP  GG 
Sbjct  128  GLRNYIEVKPRQTELFRSPLVSFLYERGWRQNFK-HSGFPGQEEEFKMAQEYFKPAEGGL  186

Query  538  IIDASCGSGLFSR  576
            ++D SCGSGLFSR
Sbjct  187  LLDVSCGSGLFSR  199



>ref|NP_001242875.1| uncharacterized protein LOC100798970 [Glycine max]
 gb|ACU18789.1| unknown [Glycine max]
Length=341

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 95/151 (63%), Gaps = 4/151 (3%)
 Frame = +1

Query  124  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  303
            IRA+S    E +   L  ++   I  ++ ACP+CY+     G  GL+L ++ +S   C  
Sbjct  44   IRAISAVAAESE---LGTQQDHAIEADIFACPVCYEPLIRKGPSGLNLPAIYRSGFMCKR  100

Query  304  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGP  483
            C+K YS  + ++DLT+  G + Y E   A TELFR PLVSFL+ERGWR +F    GFPGP
Sbjct  101  CKKTYSSKDRYLDLTVTAGLRDYTEIQPARTELFRSPLVSFLHERGWRQNFR-QSGFPGP  159

Query  484  EKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            ++EF++ Q+Y +   GG ++D SCGSGLFSR
Sbjct  160  DEEFKMAQEYFESAEGGLLVDVSCGSGLFSR  190



>ref|XP_010250394.1| PREDICTED: uncharacterized protein LOC104592660 [Nelumbo nucifera]
Length=795

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 95/152 (63%), Gaps = 4/152 (3%)
 Frame = +1

Query  121  KIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECS  300
            +IRA S    E  PV    +        + ACP+CY+     G PGL+L ++ +S  +C 
Sbjct  40   RIRASSAVATE--PVTSTQQNNA-FEFEVFACPVCYEPLIRKGPPGLNLPAIYRSGFQCQ  96

Query  301  TCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPG  480
             C KKYS  + ++DLT+  G K Y E   A TELFR PLVSFLYERGWR +F+   GFPG
Sbjct  97   RCNKKYSSRDIYLDLTVIAGTKEYTEFKPARTELFRSPLVSFLYERGWRQNFNR-SGFPG  155

Query  481  PEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            P++EF++  +Y KP  GG ++D SCGSGLFSR
Sbjct  156  PDEEFKMALEYFKPAEGGLLVDVSCGSGLFSR  187



>gb|EMT30153.1| Putative methyltransferase [Aegilops tauschii]
Length=416

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 90/140 (64%), Gaps = 1/140 (1%)
 Frame = +1

Query  157  KPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETH  336
            +P     E+     T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  
Sbjct  120  EPAETKTEQNDTSETEVFACPVCYEPLIRKGPPGMNLPAIYRSGFKCSKCNKSFTSKDVF  179

Query  337  VDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYL  516
            +DLT+  G K Y E   A TELFR PLVS+LYERGWR +F+   GFPG ++EF++ QDY 
Sbjct  180  LDLTVTSGMKEYSELKPARTELFRSPLVSYLYERGWRQNFNR-SGFPGRDEEFQMAQDYF  238

Query  517  KPVMGGNIIDASCGSGLFSR  576
            + V GG ++D SCGSGLFSR
Sbjct  239  QSVAGGILVDVSCGSGLFSR  258



>gb|AEJ88263.1| putative S-adenosylmethionine-dependent methyltransferase [Wolffia 
arrhiza]
Length=274

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 88/139 (63%), Gaps = 7/139 (5%)
 Frame = +1

Query  178  EKKVEIRTN------LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHV  339
            EK+ E R N        +CP+CY      G PGL+LS++ +S   C +C K +S   T++
Sbjct  63   EKESESRGNETSESDKFSCPVCYRPLIRTGPPGLNLSAIYRSGFLCKSCNKPFSSRNTYL  122

Query  340  DLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLK  519
            DLT+  G K Y E+  + TELFR P VSFLYERGWR +F    GFPG ++EF + Q+Y K
Sbjct  123  DLTVTSGAKEYNESKPSRTELFRSPFVSFLYERGWRQNFR-NSGFPGLDEEFRMAQEYFK  181

Query  520  PVMGGNIIDASCGSGLFSR  576
            PV GG ++D SCGSGLF R
Sbjct  182  PVEGGFLLDVSCGSGLFLR  200



>ref|XP_009141962.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Brassica rapa]
Length=355

 Score =   139 bits (351),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 90/135 (67%), Gaps = 2/135 (1%)
 Frame = +1

Query  175  DEKKVE-IRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  351
            D+K+ E + T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+
Sbjct  70   DKKETETVETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTV  129

Query  352  AGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMG  531
              G  ++ E    +TELFR PLVSFLYERGWR +F+   GFPGP++EF + ++Y K   G
Sbjct  130  TAGFDSFNEVKPITTELFRSPLVSFLYERGWRQNFAR-SGFPGPDEEFRMAEEYFKEAEG  188

Query  532  GNIIDASCGSGLFSR  576
            G ++D SCGSGLFSR
Sbjct  189  GVLVDVSCGSGLFSR  203



>ref|XP_001778776.1| predicted protein [Physcomitrella patens]
 gb|EDQ56362.1| predicted protein [Physcomitrella patens]
Length=309

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 91/143 (64%), Gaps = 1/143 (1%)
 Frame = +1

Query  148  VEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN  327
            +  +P   +D ++    + LL CPIC+      G  GL+ +++  S   C +CR+K+S  
Sbjct  12   LRQEPRSNLDREEENSTSELLCCPICHKPLQRTGPSGLTQNAIRSSGFSCHSCRRKFSNR  71

Query  328  ETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQ  507
              +VDLTI  G + Y E   A  E+FR P+VSF+YERGWR +F+   GFPGP++EF++ Q
Sbjct  72   GDYVDLTILDGTRVYDENTTAGAEIFRSPVVSFVYERGWRQNFAR-AGFPGPDEEFKMAQ  130

Query  508  DYLKPVMGGNIIDASCGSGLFSR  576
            +Y K V GG I+D SCGSGLF+R
Sbjct  131  NYFKSVQGGVILDVSCGSGLFTR  153



>emb|CDY57579.1| BnaC04g56820D [Brassica napus]
Length=353

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 99/159 (62%), Gaps = 3/159 (2%)
 Frame = +1

Query  103  NRLFAVKIRALS-TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMA  279
            +R  +  IRA++    + + P   I E +  + T + ACP+CY+     G  G++L ++ 
Sbjct  45   SRFTSASIRAVALEPELNETPSSDIKETET-VETQVFACPVCYEPLMRKGPSGINLQAIY  103

Query  280  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFS  459
            +S  +C  C K YS  + ++DLT+  G  ++ E    +TELFR PLVSFLYERGWR +F+
Sbjct  104  RSGFKCGQCNKTYSSKDEYLDLTVTAGFDSFNEVKPITTELFRSPLVSFLYERGWRQNFA  163

Query  460  LWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
               GFPGP++EF + ++Y K   GG ++D SCGSGLFSR
Sbjct  164  R-SGFPGPDEEFRMAEEYFKEAEGGVLVDVSCGSGLFSR  201



>gb|KCW45297.1| hypothetical protein EUGRSUZ_L01041 [Eucalyptus grandis]
Length=239

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 100/179 (56%), Gaps = 15/179 (8%)
 Frame = +1

Query  73   FSFSPLTPKANRLFA-----------VKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  219
            F+  PL P+  RL               +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPPFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  220  ICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  399
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  400  LFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            LFR P+VSFLYERGWR +F+   GFPG ++EF++ Q+Y KP  GG ++D SCGSGLFSR
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPGQDEEFKMAQEYFKPAEGGLLVDVSCGSGLFSR  185



>ref|XP_010040339.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=269

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 100/179 (56%), Gaps = 15/179 (8%)
 Frame = +1

Query  73   FSFSPLTPKANRLFA-----------VKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  219
            F+  PL P+  RL               +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPPFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  220  ICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  399
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  400  LFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            LFR P+VSFLYERGWR +F+   GFPG ++EF++ Q+Y KP  GG ++D SCGSGLFSR
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPGQDEEFKMAQEYFKPAEGGLLVDVSCGSGLFSR  185



>ref|XP_010928270.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X4 [Elaeis guineensis]
Length=314

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 90/141 (64%), Gaps = 7/141 (5%)
 Frame = +1

Query  169  LIDEKKVEIR-----TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNET  333
            L+D +  +++      NLLACPICY+     G  GL+L ++ +S  +C  C K +S  + 
Sbjct  19   LLDIQDTQVKQDFLEVNLLACPICYEPLMRKGPSGLNLPAIYRSGFKCLKCNKSFSSKDV  78

Query  334  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDY  513
            ++DLTI  G K Y E     TELF  P VSFLYERGWR +F+   GFPGP++EF + Q+Y
Sbjct  79   YLDLTITSGTKEYNELKPTRTELFS-PFVSFLYERGWRQNFN-RSGFPGPDEEFNMAQEY  136

Query  514  LKPVMGGNIIDASCGSGLFSR  576
             K V GG ++D SCGSGLFSR
Sbjct  137  FKTVAGGLLVDVSCGSGLFSR  157



>gb|KDO59312.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=328

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 101/165 (61%), Gaps = 12/165 (7%)
 Frame = +1

Query  82   SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  261
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  262  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  441
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  442  WRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            WR +F+   GFPGP++E     +Y K   GG ++D SCGSGLFSR
Sbjct  139  WRQNFN-RSGFPGPDEE-----EYFKSAQGGLLVDVSCGSGLFSR  177



>ref|XP_010928268.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=354

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 95/157 (61%), Gaps = 7/157 (4%)
 Frame = +1

Query  106  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  285
            R F ++  A + T   D  V     K+  +  NLLACPICY+     G  GL+L ++ +S
Sbjct  48   RGFPLRATAAALTVEPDTQV-----KQDFLEVNLLACPICYEPLMRKGPSGLNLPAIYRS  102

Query  286  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLW  465
              +C  C K +S  + ++DLTI  G K Y E     TELF  P VSFLYERGWR +F+  
Sbjct  103  GFKCLKCNKSFSSKDVYLDLTITSGTKEYNELKPTRTELFS-PFVSFLYERGWRQNFN-R  160

Query  466  GGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
             GFPGP++EF + Q+Y K V GG ++D SCGSGLFSR
Sbjct  161  SGFPGPDEEFNMAQEYFKTVAGGLLVDVSCGSGLFSR  197



>ref|XP_002306578.1| methyltransferase-related family protein [Populus trichocarpa]
 gb|EEE93574.1| methyltransferase-related family protein [Populus trichocarpa]
Length=244

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = +1

Query  325  NETHVDLTIAGGGKAYGE-ALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFEL  501
             ETH++LT+A G K YG+ A+  +TE FR P +SFLYERGWR +F +WGGFPGPEKEFEL
Sbjct  5    KETHLELTVASGSKGYGDIAMPLATEFFRTPFMSFLYERGWRQNF-VWGGFPGPEKEFEL  63

Query  502  MQDYLKPVMGGNIIDASCGSGLFSRL  579
            M+DYLKPV+GGNI+DASCGSGLFSRL
Sbjct  64   MKDYLKPVLGGNILDASCGSGLFSRL  89



>gb|KCW79027.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=304

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 101/179 (56%), Gaps = 15/179 (8%)
 Frame = +1

Query  73   FSFSPLTPKANRLF-----------AVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  219
            F+  PL P+  RL            +  +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPSFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  220  ICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  399
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  400  LFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            LFR P+VSFLYERGWR +F+   GFPG ++EF++ Q+Y KP  GG ++D SCGSGLFSR
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPGQDEEFKMAQEYFKPAEGGLLVDVSCGSGLFSR  185



>gb|KCW79026.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=305

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 101/179 (56%), Gaps = 15/179 (8%)
 Frame = +1

Query  73   FSFSPLTPKANRLF-----------AVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  219
            F+  PL P+  RL            +  +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPSFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  220  ICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  399
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  400  LFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            LFR P+VSFLYERGWR +F+   GFPG ++EF++ Q+Y KP  GG ++D SCGSGLFSR
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPGQDEEFKMAQEYFKPAEGGLLVDVSCGSGLFSR  185



>ref|XP_010047200.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW79025.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=336

 Score =   136 bits (343),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 101/179 (56%), Gaps = 15/179 (8%)
 Frame = +1

Query  73   FSFSPLTPKANRLF-----------AVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  219
            F+  PL P+  RL            +  +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPSFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  220  ICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  399
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  400  LFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            LFR P+VSFLYERGWR +F+   GFPG ++EF++ Q+Y KP  GG ++D SCGSGLFSR
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPGQDEEFKMAQEYFKPAEGGLLVDVSCGSGLFSR  185



>ref|XP_006411367.1| hypothetical protein EUTSA_v10016844mg [Eutrema salsugineum]
 gb|ESQ52820.1| hypothetical protein EUTSA_v10016844mg [Eutrema salsugineum]
Length=363

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 98/163 (60%), Gaps = 8/163 (5%)
 Frame = +1

Query  106  RLFAVKIRALSTTFVEDKPVRLIDEKK-----VEIR-TNLLACPICYDAFTWNGDPGLSL  267
            R  ++ IRA++    E    R  D+K+     +EI  T + ACP+CY+     G  G++L
Sbjct  51   RFPSLAIRAVALE-SESNETRSSDQKENQTQSIEIEETQVFACPVCYEPLMRKGPSGINL  109

Query  268  SSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWR  447
             ++ +S  +C  C K YS  + ++DLT+      Y E    +TELFR PLVSFLYERGWR
Sbjct  110  KAIYRSGFKCGQCNKTYSSKDEYLDLTVTADLDDYNEVKPITTELFRSPLVSFLYERGWR  169

Query  448  XSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
             +FS   GFPGP++EF + + Y K   GG ++D SCGSGLFSR
Sbjct  170  QNFSR-SGFPGPDEEFRMAERYFKEAEGGVLVDVSCGSGLFSR  211



>ref|NP_001058196.1| Os06g0646000 [Oryza sativa Japonica Group]
 dbj|BAD37452.1| methyltransferase-like [Oryza sativa Japonica Group]
 dbj|BAD37605.1| methyltransferase-like [Oryza sativa Japonica Group]
 dbj|BAF20110.1| Os06g0646000 [Oryza sativa Japonica Group]
 dbj|BAG91023.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81074.1| hypothetical protein OsI_23892 [Oryza sativa Indica Group]
Length=345

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 88/137 (64%), Gaps = 5/137 (4%)
 Frame = +1

Query  178  EKKVEIRTN----LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDL  345
            E KV    N    + ACP+CY+     G  G++L S+ +S  +CS C K ++  +  +DL
Sbjct  53   ENKVPQSNNSEAEVFACPVCYEPLIRKGPSGINLPSIYRSGFKCSKCNKSFTSKDIFLDL  112

Query  346  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPV  525
            T+  G K Y E   A TELFR PLVSFLYERGWR +F+   GFPG ++EF++ QDY + V
Sbjct  113  TVTSGTKEYSELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQSV  171

Query  526  MGGNIIDASCGSGLFSR  576
             GG ++D SCGSGLF+R
Sbjct  172  AGGVLLDVSCGSGLFTR  188



>ref|XP_006657188.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Oryza brachyantha]
Length=353

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 90/140 (64%), Gaps = 5/140 (4%)
 Frame = +1

Query  169  LIDEKKVEIRTN----LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETH  336
            L  E KV+   N    + ACP+CY+     G  G++L ++ +S  +CS C K ++  +  
Sbjct  57   LPRESKVQQSNNSETEVFACPVCYEPLIRKGPSGINLPAIYRSGFKCSKCNKSFTSKDIF  116

Query  337  VDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYL  516
            +DLT+  G K Y E   A TELFR PLVSFLYERGWR +F+   GFPG ++EF++ QDY 
Sbjct  117  LDLTVTSGTKEYSELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYF  175

Query  517  KPVMGGNIIDASCGSGLFSR  576
            + V GG ++D SCGSGLF+R
Sbjct  176  QSVTGGVLLDVSCGSGLFTR  195



>ref|XP_006293382.1| hypothetical protein CARUB_v10023510mg [Capsella rubella]
 gb|EOA26280.1| hypothetical protein CARUB_v10023510mg [Capsella rubella]
Length=356

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 85/132 (64%), Gaps = 2/132 (2%)
 Frame = +1

Query  184  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  360
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  74   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  133

Query  361  GKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  540
               Y E    +TELFR PLVSFLYERGWR +F    GFPGP++EF + ++Y K   GG +
Sbjct  134  LDDYNEVKPITTELFRSPLVSFLYERGWRQNFQR-SGFPGPDEEFRMAEEYFKEAEGGVL  192

Query  541  IDASCGSGLFSR  576
            +D SCGSGLFSR
Sbjct  193  VDVSCGSGLFSR  204



>ref|XP_008456635.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X2 [Cucumis melo]
Length=338

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 100/174 (57%), Gaps = 5/174 (3%)
 Frame = +1

Query  55   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDA  234
            L  N +F + PL     R F   IRA S   +E       D+     + ++ +CP+C++ 
Sbjct  19   LSRNIQFRY-PLRLSTPRSFLSTIRASSALVLESDSGTQQDQNS---KIDVFSCPVCFEP  74

Query  235  FTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLP  414
                G PG +L ++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR P
Sbjct  75   LLRKGPPGFNLPAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSP  134

Query  415  LVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            LVS+LYERGWR +F+   GFPG ++EF++  +Y K V GG ++DASCGSGLFSR
Sbjct  135  LVSYLYERGWRQNFN-QSGFPGLDEEFKMAMEYFKSVEGGLLVDASCGSGLFSR  187



>ref|XP_004167998.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized methyltransferase 
At2g41040, chloroplastic-like [Cucumis sativus]
Length=338

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 97/165 (59%), Gaps = 4/165 (2%)
 Frame = +1

Query  82   SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  261
            SPL     R     IRA S   +E       D+    ++ ++ +CP+C++     G PG 
Sbjct  27   SPLRLSTPRSILSTIRASSALVLESDSGIQQDQN---LKIDVFSCPVCFEPLLRKGPPGF  83

Query  262  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  441
            +LS++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR PLVS+LYERG
Sbjct  84   NLSAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSPLVSYLYERG  143

Query  442  WRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            WR +F+   GFPG ++EF++  +Y K V GG ++DASCGSGLFSR
Sbjct  144  WRQNFN-QSGFPGLDEEFKMAMEYFKSVEGGLLVDASCGSGLFSR  187



>ref|XP_008456627.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X1 [Cucumis melo]
Length=339

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 100/174 (57%), Gaps = 5/174 (3%)
 Frame = +1

Query  55   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDA  234
            L  N +F + PL     R F   IRA S   +E       D+     + ++ +CP+C++ 
Sbjct  19   LSRNIQFRY-PLRLSTPRSFLSTIRASSALVLESDSGTQQDQNS---KIDVFSCPVCFEP  74

Query  235  FTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLP  414
                G PG +L ++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR P
Sbjct  75   LLRKGPPGFNLPAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSP  134

Query  415  LVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            LVS+LYERGWR +F+   GFPG ++EF++  +Y K V GG ++DASCGSGLFSR
Sbjct  135  LVSYLYERGWRQNFN-QSGFPGLDEEFKMAMEYFKSVEGGLLVDASCGSGLFSR  187



>ref|XP_006586686.1| PREDICTED: uncharacterized protein LOC100798970 isoform X1 [Glycine 
max]
Length=336

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 92/151 (61%), Gaps = 9/151 (6%)
 Frame = +1

Query  124  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  303
            IRA+S    E +   L  ++   I  ++ ACP+CY+     G  GL+LS        C  
Sbjct  44   IRAISAVAAESE---LGTQQDHAIEADIFACPVCYEPLIRKGPSGLNLSGFM-----CKR  95

Query  304  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGP  483
            C+K YS  + ++DLT+  G + Y E   A TELFR PLVSFLYERGWR +F    GFPGP
Sbjct  96   CKKTYSSKDRYLDLTVTAGLRDYTEIQPARTELFRSPLVSFLYERGWRQNFR-QSGFPGP  154

Query  484  EKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            ++EF++ Q+Y +   GG ++D SCGSGLFSR
Sbjct  155  DEEFKMAQEYFESAEGGLLVDVSCGSGLFSR  185



>ref|XP_010505866.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Camelina sativa]
Length=355

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 86/132 (65%), Gaps = 2/132 (2%)
 Frame = +1

Query  184  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  360
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  73   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  132

Query  361  GKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  540
             + Y E    +TELFR PLVSFLYERGWR +F    GFPGP++EF + ++Y K   GG +
Sbjct  133  LEDYDEVKPITTELFRSPLVSFLYERGWRQNFKR-SGFPGPDEEFRMAEEYFKEAEGGVL  191

Query  541  IDASCGSGLFSR  576
            +D SCGSGLFSR
Sbjct  192  VDVSCGSGLFSR  203



>ref|NP_181637.2| uncharacterized methyltransferase [Arabidopsis thaliana]
 sp|Q0WPT7.1|Y2104_ARATH RecName: Full=Uncharacterized methyltransferase At2g41040, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAF00862.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09918.1| uncharacterized methyltransferase [Arabidopsis thaliana]
Length=352

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 85/132 (64%), Gaps = 2/132 (2%)
 Frame = +1

Query  184  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  360
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  70   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  129

Query  361  GKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  540
               Y E    +TELFR PLVSFLYERGWR +F    GFPGP++EF + ++Y K   GG +
Sbjct  130  LDDYNEVKPITTELFRSPLVSFLYERGWRQAFKR-SGFPGPDEEFRMAEEYFKEAEGGLL  188

Query  541  IDASCGSGLFSR  576
            +D SCGSGLFSR
Sbjct  189  VDVSCGSGLFSR  200



>ref|XP_010508773.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Camelina sativa]
Length=356

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 86/132 (65%), Gaps = 2/132 (2%)
 Frame = +1

Query  184  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  360
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  74   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGRCNKTYSSKDEYLDLTVTAD  133

Query  361  GKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  540
             + Y E    +TELFR PLVSFLYERGWR +F    GFPGP++EF + ++Y K   GG +
Sbjct  134  LEDYDEVKPITTELFRSPLVSFLYERGWRQNFKR-SGFPGPDEEFRMAEEYFKEAEGGVL  192

Query  541  IDASCGSGLFSR  576
            +D SCGSGLFSR
Sbjct  193  VDVSCGSGLFSR  204



>ref|XP_004287239.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=289

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 89/134 (66%), Gaps = 3/134 (2%)
 Frame = +1

Query  172  IDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  351
            ++E   E+   LL+CP+CY+  T  G PGL L ++ +S+ EC  C K YS  + ++DLT+
Sbjct  8    LNESSAEV--ELLSCPVCYEPLTRVGPPGLILQAICRSSFECKKCYKSYSSKKNYLDLTV  65

Query  352  AGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMG  531
              G K Y EA    TELFR  ++SF+YE+G+R  F  + GFPGP++EF++ QDY K   G
Sbjct  66   TAGLKKYVEAKPIGTELFRSIIMSFIYEKGYRQCFKRY-GFPGPDEEFKMAQDYFKSAEG  124

Query  532  GNIIDASCGSGLFS  573
            G ++D SCGSGLF+
Sbjct  125  GVLVDVSCGSGLFA  138



>gb|KFK36957.1| hypothetical protein AALP_AA4G194500 [Arabis alpina]
Length=343

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 97/159 (61%), Gaps = 8/159 (5%)
 Frame = +1

Query  103  NRLFAVKIRALS-TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMA  279
            +R  +  IRA++  + V + P  +I+E      T + ACP+CY+     G  G++L S+ 
Sbjct  40   SRFTSASIRAVALQSDVNESPSTVIEE------TQVFACPVCYEPLLRKGPSGINLQSIY  93

Query  280  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFS  459
            +S  +C  C K YS  + ++DLT+      + E    +TELFR PLVSFLYERGWR +F 
Sbjct  94   RSGFKCGQCNKTYSSKDEYLDLTVTADLANFNEVKPITTELFRSPLVSFLYERGWRDNFK  153

Query  460  LWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
               GFPG E+EF++ ++Y K   GG ++D SCGSG+FSR
Sbjct  154  R-SGFPGAEEEFKMAEEYFKEAEGGILVDVSCGSGIFSR  191



>ref|XP_010517586.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Camelina sativa]
Length=355

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 85/132 (64%), Gaps = 2/132 (2%)
 Frame = +1

Query  184  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  360
            ++EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  73   QIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  132

Query  361  GKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  540
               Y E    +TELFR PLVSFLYERGWR +F    GFPGP++EF + ++Y K   GG +
Sbjct  133  LDDYNEVKPITTELFRSPLVSFLYERGWRQNFKR-SGFPGPDEEFRMAEEYFKEAEGGVL  191

Query  541  IDASCGSGLFSR  576
            +D SCGSGLFSR
Sbjct  192  VDVSCGSGLFSR  203



>ref|XP_004139262.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Cucumis sativus]
Length=338

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 96/165 (58%), Gaps = 4/165 (2%)
 Frame = +1

Query  82   SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  261
            SPL     R     IRA S   +E       D+    ++ ++ +CP+C++     G PG 
Sbjct  27   SPLRLSTPRSILSTIRASSALVLESDSGIQQDQN---LKIDVFSCPVCFEPLLRKGPPGF  83

Query  262  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  441
            +L ++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR PLVS+LYERG
Sbjct  84   NLPAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSPLVSYLYERG  143

Query  442  WRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            WR +F+   GFPG ++EF++  +Y K V GG ++DASCGSGLFSR
Sbjct  144  WRQNFN-QSGFPGLDEEFKMAMEYFKSVEGGLLVDASCGSGLFSR  187



>gb|KGN60753.1| hypothetical protein Csa_2G009410 [Cucumis sativus]
Length=339

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 96/165 (58%), Gaps = 4/165 (2%)
 Frame = +1

Query  82   SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  261
            SPL     R     IRA S   +E       D+    ++ ++ +CP+C++     G PG 
Sbjct  27   SPLRLSTPRSILSTIRASSALVLESDSGIQQDQN---LKIDVFSCPVCFEPLLRKGPPGF  83

Query  262  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  441
            +L ++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR PLVS+LYERG
Sbjct  84   NLPAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSPLVSYLYERG  143

Query  442  WRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            WR +F+   GFPG ++EF++  +Y K V GG ++DASCGSGLFSR
Sbjct  144  WRQNFN-QSGFPGLDEEFKMAMEYFKSVEGGLLVDASCGSGLFSR  187



>emb|CDY06948.1| BnaA04g23670D [Brassica napus]
Length=800

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 97/155 (63%), Gaps = 3/155 (2%)
 Frame = +1

Query  115  AVKIRALS-TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  291
            +  IRA++    + + P   I E +  + T + ACP+CY+     G  G++L ++ +S  
Sbjct  496  SASIRAVALEPELNETPSSDIKETET-VETQVFACPVCYEPLMRKGPSGINLQAIYRSGF  554

Query  292  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGG  471
            +C  C K YS  + ++DLT+  G  ++ E    +TELFR PLVSFLYERGWR +F+   G
Sbjct  555  KCGQCNKTYSSKDEYLDLTVTAGFDSFNEVKPITTELFRSPLVSFLYERGWRQNFAR-SG  613

Query  472  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            FPGP++EF + ++Y K   GG ++D SCGSGLFSR
Sbjct  614  FPGPDEEFRMAEEYFKEAEGGVLVDVSCGSGLFSR  648



>ref|XP_002879904.1| hypothetical protein ARALYDRAFT_903411 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56163.1| hypothetical protein ARALYDRAFT_903411 [Arabidopsis lyrata subsp. 
lyrata]
Length=350

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 89/150 (59%), Gaps = 2/150 (1%)
 Frame = +1

Query  130  ALSTTFVEDKPVRLIDEKKVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTC  306
            A  +T   +  +   +  K++I    + ACP+CY      G  G++L ++ +S  +C  C
Sbjct  50   AAISTVAPESDINKNETPKIKIEEAQVFACPVCYQPLMRKGPSGINLQAIYRSGFKCGQC  109

Query  307  RKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPE  486
             K YS  + ++DLT+      Y E    +TELFR PLVSFLYERGWR +F    GFPGP+
Sbjct  110  NKTYSSKDEYLDLTVTADLDDYNEVKPITTELFRSPLVSFLYERGWRQAFKR-SGFPGPD  168

Query  487  KEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            +EF + ++Y K   GG ++D SCGSGLFSR
Sbjct  169  EEFRMAEEYFKESEGGILVDVSCGSGLFSR  198



>gb|KDO80932.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=235

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 68/79 (86%), Gaps = 1/79 (1%)
 Frame = +1

Query  343  LTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKP  522
            +T A G K YGE ++ +TE FR+P +SF+YERGWR +F +WGGFPGPEKEFELM+ YLKP
Sbjct  1    MTAASGSKDYGELMSPATEFFRMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKP  59

Query  523  VMGGNIIDASCGSGLFSRL  579
            V+GGNIIDASCGSGLFSR+
Sbjct  60   VLGGNIIDASCGSGLFSRI  78



>ref|XP_006434004.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47244.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
Length=233

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 68/79 (86%), Gaps = 1/79 (1%)
 Frame = +1

Query  343  LTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKP  522
            +T A G K YGE ++ +TE FR+P +SF+YERGWR +F +WGGFPGPEKEFELM+ YLKP
Sbjct  1    MTAASGSKDYGELMSPATEFFRMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKP  59

Query  523  VMGGNIIDASCGSGLFSRL  579
            V+GGNIIDASCGSGLFSR+
Sbjct  60   VLGGNIIDASCGSGLFSRI  78



>ref|XP_006826926.1| hypothetical protein AMTR_s00010p00172800, partial [Amborella 
trichopoda]
 gb|ERM94163.1| hypothetical protein AMTR_s00010p00172800, partial [Amborella 
trichopoda]
Length=215

 Score =   125 bits (314),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 1/130 (1%)
 Frame = +1

Query  187  VEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGK  366
            V  R + LACPICY     N      + S    N  C  C+K YS  E ++DL++     
Sbjct  8    VVTRLDSLACPICYQPLIRNSGANPKILSPRGLNFRCQNCQKAYSNYEEYIDLSVTDDSN  67

Query  367  AYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIID  546
             Y  A+ ++TE+FR PLVS+LYERG+  +F+ W GF G +KEFE +  YL+P +GG I+D
Sbjct  68   EYVGAMPSATEVFRNPLVSYLYERGYGKNFT-WSGFSGLDKEFETVTKYLQPTLGGIIVD  126

Query  547  ASCGSGLFSR  576
            ASCGSG+FSR
Sbjct  127  ASCGSGMFSR  136



>gb|EMT00494.1| Putative methyltransferase [Aegilops tauschii]
Length=493

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 94/158 (59%), Gaps = 18/158 (11%)
 Frame = +1

Query  103  NRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQ  282
            +RLFA+      T F E K   L D  K E+     ACP+CY+     G PG++L ++ +
Sbjct  196  SRLFAI-----VTEFQEIK-TELNDASKTEV----FACPVCYEPLIRKGPPGMNLPAIYR  245

Query  283  SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSL  462
            S  +CS C K ++  +  +DLT+  G K Y E   A TELFR PLVSFLYERGWR +F+ 
Sbjct  246  SGFKCSKCNKSFTSKDVFLDLTVTSGIKEYSELKPARTELFRSPLVSFLYERGWRQNFNR  305

Query  463  WGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
              GFPG ++EF+        V GG ++D SCGSGLFSR
Sbjct  306  -SGFPGRDEEFQ-------SVAGGILVDVSCGSGLFSR  335



>ref|XP_008242913.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic, 
partial [Prunus mume]
Length=263

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 75/111 (68%), Gaps = 1/111 (1%)
 Frame = +1

Query  244  NGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVS  423
             G PGL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E     TELFR PLVS
Sbjct  3    KGPPGLNLQAIYRSAFKCKKCDKSYSSKDIYLDLTVIAGLKEYVEVKPVGTELFRSPLVS  62

Query  424  FLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            FLYERGWR +F+   GFPG ++EF++ QDY K   GG ++D SCGSGLFSR
Sbjct  63   FLYERGWRQNFNR-SGFPGIDEEFKMAQDYFKSAEGGVLLDVSCGSGLFSR  112



>gb|AAD12007.1| hypothetical protein [Arabidopsis thaliana]
Length=262

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 81/131 (62%), Gaps = 2/131 (2%)
 Frame = +1

Query  184  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  360
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  68   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  127

Query  361  GKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  540
               Y E    +TELFR PLVSFLYERGWR +F    GFPGP++EF + ++Y K   GG +
Sbjct  128  LDDYNEVKPITTELFRSPLVSFLYERGWRQAFK-RSGFPGPDEEFRMAEEYFKEAEGGLL  186

Query  541  IDASCGSGLFS  573
            +D+   SG+ +
Sbjct  187  VDSGKYSGVIA  197



>ref|XP_009595293.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=169

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 82/135 (61%), Gaps = 4/135 (3%)
 Frame = +1

Query  100  ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMA  279
            ++R F  +IRA S   VE + +R   +   E    L +CPICY+     G PG +L ++ 
Sbjct  39   SSRGFNSRIRASSAVAVEPE-LRTPAQDATE--AELFSCPICYEPLMRKGPPGFNLPAIY  95

Query  280  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFS  459
            +S  +C  C K YS    ++DLTI  G K Y E+  A TELFR P+VSFLYERGWR +F+
Sbjct  96   RSGFKCRKCNKSYSSKNIYLDLTITSGTKEYSESKPARTELFRSPVVSFLYERGWRQNFN  155

Query  460  LWGGFPGPEKEFELM  504
            L  GFPGP++E +L 
Sbjct  156  L-SGFPGPDEEVKLF  169



>ref|XP_009595292.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=173

 Score =   116 bits (291),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 82/138 (59%), Gaps = 6/138 (4%)
 Frame = +1

Query  100  ANRLFAVKIRALSTTFVED---KPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLS  270
            ++R F  +IRA S   VE    K +R   +   E    L +CPICY+     G PG +L 
Sbjct  39   SSRGFNSRIRASSAVAVEPVIAKELRTPAQDATE--AELFSCPICYEPLMRKGPPGFNLP  96

Query  271  SMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRX  450
            ++ +S  +C  C K YS    ++DLTI  G K Y E+  A TELFR P+VSFLYERGWR 
Sbjct  97   AIYRSGFKCRKCNKSYSSKNIYLDLTITSGTKEYSESKPARTELFRSPVVSFLYERGWRQ  156

Query  451  SFSLWGGFPGPEKEFELM  504
            +F+L  GFPGP++E +L 
Sbjct  157  NFNL-SGFPGPDEEVKLF  173



>gb|EMT14235.1| Putative methyltransferase [Aegilops tauschii]
Length=465

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 83/139 (60%), Gaps = 16/139 (12%)
 Frame = +1

Query  160  PVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHV  339
            P + I  +    +T + ACP+CY+     G PG++LS               ++  +  +
Sbjct  51   PFQEIKTEHDASKTEVFACPVCYEPLIRKGPPGMNLS---------------FTSKDVFL  95

Query  340  DLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLK  519
            DLT+  G K Y E   A TELFR PLV FLYERGWR +F+   GFPG ++EF++ QDY++
Sbjct  96   DLTVTSGMKEYSELKPARTELFRSPLVPFLYERGWRQNFNR-SGFPGRDEEFQMAQDYIQ  154

Query  520  PVMGGNIIDASCGSGLFSR  576
            PV GG ++D S GSGLFSR
Sbjct  155  PVAGGILVDVSGGSGLFSR  173



>gb|AFW76187.1| hypothetical protein ZEAMMB73_680706 [Zea mays]
Length=187

 Score =   116 bits (291),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 75/114 (66%), Gaps = 1/114 (1%)
 Frame = +1

Query  175  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  354
            +++ + + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  66   EQQNIIMETEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  125

Query  355  GGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYL  516
             G K Y E   A TELFR PLVSFLYERGWR +F+   GFPG ++EF++ QDY 
Sbjct  126  AGTKEYSEQKPARTELFRSPLVSFLYERGWRQNFNR-SGFPGLDEEFQMAQDYF  178



>gb|KEH37884.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=277

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 70/102 (69%), Gaps = 1/102 (1%)
 Frame = +1

Query  271  SMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRX  450
            ++ +S  +C  C+K Y+  + ++DLT+  G + Y E     TELFR PLVSFLYERGWR 
Sbjct  26   AIYRSGFKCKRCQKSYTSKDGYLDLTVTSGLRDYVEVQPNRTELFRSPLVSFLYERGWRQ  85

Query  451  SFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            +F    GFPGP++EF + Q+Y +P  GG I+D SCGSGLFSR
Sbjct  86   NFRQ-SGFPGPDEEFRMAQEYFEPAKGGRIVDVSCGSGLFSR  126



>ref|XP_005643537.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE18993.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=357

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 88/159 (55%), Gaps = 8/159 (5%)
 Frame = +1

Query  106  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  285
            RL  V  RA +   +  +P+    E+  +      ACPIC    T       S   +AQ+
Sbjct  42   RLRVVPCRATAQP-ISARPLGTDSERVKDSVEYNFACPIC---LTTEFSIQKSNQGLAQA  97

Query  286  NLECSTCRKKYSGNETHVDLTIAGGGKA--YGEALAASTELFRLPLVSFLYERGWRXSFS  459
             L C  C + +S NE  VDLT   G  A  Y ++    T++FR PLVSF YERGWR SF+
Sbjct  98   -LHCDRCARTFSANEKSVDLTSTSGAPARVYKQSFWGGTQIFRSPLVSFAYERGWRSSFT  156

Query  460  LWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
             W GFPG +KEFE+  DYL+   G  ++D SCGSGLFSR
Sbjct  157  -WAGFPGEQKEFEMAMDYLQAAYGEVLVDMSCGSGLFSR  194



>gb|EPS57983.1| hypothetical protein M569_16834, partial [Genlisea aurea]
Length=96

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +1

Query  205  LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEAL  384
            L ACPIC+      G PG +L ++ +S  +CS+C K YS    ++DLTI  G K Y E +
Sbjct  2    LFACPICHLPLIRKGPPGFNLEAIYRSAFKCSSCNKSYSSKNIYLDLTITAGTKEYNEFV  61

Query  385  AASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKE  492
             A TELFR PLVSFLYERGWR +F+   GFPGPE+E
Sbjct  62   PARTELFRSPLVSFLYERGWRQNFNR-SGFPGPEEE  96



>gb|KHN03912.1| Putative methyltransferase, chloroplastic, partial [Glycine soja]
Length=213

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  RLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            R+PL+SFL+ERGWR +FS+WGGFPGPEKEFELM+ +LKPV+GGNIIDASC SGLFSRL
Sbjct  2    RVPLISFLHERGWRQTFSVWGGFPGPEKEFELMKGFLKPVLGGNIIDASCASGLFSRL  59



>ref|XP_003527908.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Glycine max]
Length=248

 Score =   110 bits (275),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  RLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            R+PL+SFL+ERGWR +FS+WGGFPGPEKEFELM+ +LKPV+GGNIIDASC SGLFSRL
Sbjct  36   RVPLISFLHERGWRQTFSVWGGFPGPEKEFELMKGFLKPVLGGNIIDASCASGLFSRL  93



>ref|XP_008336947.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
 ref|XP_008336948.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
 ref|XP_008336949.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
Length=325

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 82/139 (59%), Gaps = 15/139 (11%)
 Frame = +1

Query  202  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN------ETHVDLTIAGGG  363
             LLACP+CY+     G PGL+L ++ +S  EC  C K Y+ +      + ++DLT++GG 
Sbjct  33   ELLACPVCYEPLIRKGPPGLNLQAIFRSAFECKICHKLYNSSSKSKEKDIYLDLTVSGGL  92

Query  364  KAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMG----  531
            + Y     A T+ FR  LVSFLYERGWR  F    GFPGP++EF++  DY +        
Sbjct  93   REYIAPXPAGTDFFRYRLVSFLYERGWRQYFG-QSGFPGPDQEFKMAMDYFQSATDQGEG  151

Query  532  ----GNIIDASCGSGLFSR  576
                G ++D SCGSGLFSR
Sbjct  152  GGSGGVVVDVSCGSGLFSR  170



>ref|XP_008336950.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Malus domestica]
Length=324

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 82/139 (59%), Gaps = 15/139 (11%)
 Frame = +1

Query  202  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN------ETHVDLTIAGGG  363
             LLACP+CY+     G PGL+L ++ +S  EC  C K Y+ +      + ++DLT++GG 
Sbjct  33   ELLACPVCYEPLIRKGPPGLNLQAIFRSAFECKICHKLYNSSSKSKEKDIYLDLTVSGGL  92

Query  364  KAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMG----  531
            + Y     A T+ FR  LVSFLYERGWR  F    GFPGP++EF++  DY +        
Sbjct  93   REYIAPXPAGTDFFRYRLVSFLYERGWRQYFG-QSGFPGPDQEFKMAMDYFQSATDQGEG  151

Query  532  ----GNIIDASCGSGLFSR  576
                G ++D SCGSGLFSR
Sbjct  152  GGSGGVVVDVSCGSGLFSR  170



>dbj|BAC99645.1| hypothetical protein [Oryza sativa Japonica Group]
Length=323

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 80/136 (59%), Gaps = 7/136 (5%)
 Frame = +1

Query  130  ALSTTFVEDKPVRLIDEKKVEI------RTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  291
            +++  FV   P   ++E  VE       +   LACPICY     + D    +S+ + S+L
Sbjct  50   SVTPEFVTAAPDEAVEESSVEREPAAENKLRKLACPICYYPLISSSDQSAPVSAASSSSL  109

Query  292  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGG  471
            ECSTC+K Y     + D+T+A G   Y E+   +TE+FR PLVSFLYERGWR +F +W G
Sbjct  110  ECSTCKKFYPNRGDYWDMTVAVGSTEYSESTTVTTEVFRTPLVSFLYERGWRQNF-IWSG  168

Query  472  FPGPEKEFELMQDYLK  519
            FPG E+E +++  Y +
Sbjct  169  FPGLERERDMINIYAQ  184



>ref|XP_008344066.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=327

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +1

Query  334  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDY  513
            ++DLT+  G K Y E     TELFR PLVSFLYERGWR +F+   GFPGP++EF++ QDY
Sbjct  97   YLDLTVTAGLKEYVEVQPTRTELFRSPLVSFLYERGWRQNFNR-SGFPGPDEEFKMAQDY  155

Query  514  LKPVMGGNIIDASCGSGLFSR  576
             K   GG ++D SCGSGLFSR
Sbjct  156  FKSAEGGVLVDVSCGSGLFSR  176



>gb|ACF86599.1| unknown [Zea mays]
 tpg|DAA49106.1| TPA: hypothetical protein ZEAMMB73_519956 [Zea mays]
 tpg|DAA49107.1| TPA: hypothetical protein ZEAMMB73_519956 [Zea mays]
Length=186

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 65/106 (61%), Gaps = 6/106 (6%)
 Frame = +1

Query  190  EIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKA  369
            E +   LACPICY     + D     +S     LEC TC+K Y   + + DLT++ G   
Sbjct  71   ETKLRKLACPICYYPLASSSDQLDDATS-----LECPTCKKCYPNKQDYWDLTVSVGSTE  125

Query  370  YGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQ  507
            Y E++  +TELFR PLVSFLYERGWR +F +WGGFPG E+E  L+ 
Sbjct  126  YSESMPVATELFRTPLVSFLYERGWRQNF-IWGGFPGLEREVMLLN  170



>ref|XP_002954755.1| hypothetical protein VOLCADRAFT_106536 [Volvox carteri f. nagariensis]
 gb|EFJ44161.1| hypothetical protein VOLCADRAFT_106536 [Volvox carteri f. nagariensis]
Length=369

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 72/126 (57%), Gaps = 13/126 (10%)
 Frame = +1

Query  214  CPICYDAFTWNGDPGLSLSSMAQSN--LECSTCRKKYSGNETHVDLTIAGG--GKAYGEA  381
            CPIC            SLSSM   +  L C  C++ +  +  ++DLT+  G   + Y + 
Sbjct  82   CPICLQTH-------FSLSSMPTQSGGLSCVRCQRTFPSSPAYLDLTLTSGVRQRVYKQR  134

Query  382  LAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNI-IDASCG  558
                TELFR PLVSF YERGWR  F+ W GFPG +KE+++   YL P   G + +D SCG
Sbjct  135  SWGGTELFRNPLVSFAYERGWRQGFA-WAGFPGADKEYDIAMSYLLPAAAGKVLVDMSCG  193

Query  559  SGLFSR  576
            SGLFSR
Sbjct  194  SGLFSR  199



>ref|XP_001694737.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02321.1| predicted protein [Chlamydomonas reinhardtii]
Length=275

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = +1

Query  289  LECSTCRKKYSGNETHVDLTIAGG--GKAYGEALAASTELFRLPLVSFLYERGWRXSFSL  462
            L C+ C + +  + +++DLT+  G   K Y +     TELFR PLVSF+YERGWR  F+ 
Sbjct  11   LYCNRCVRTFPASPSYLDLTLTAGIKQKVYNQRSWGGTELFRSPLVSFVYERGWRQGFA-  69

Query  463  WGGFPGPEKEFELMQDYLKPVMGGNI-IDASCGSGLFSR  576
            W GFPG ++E+++  DYL P  GG + +D SCGSGLFSR
Sbjct  70   WAGFPGADREYDIAMDYLLPAAGGKVLVDMSCGSGLFSR  108



>emb|CDP12319.1| unnamed protein product [Coffea canephora]
Length=134

 Score = 97.1 bits (240),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 61/102 (60%), Gaps = 1/102 (1%)
 Frame = +1

Query  199  TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGE  378
            +NL+   IC D     G  G S+ ++ +S  +C  C K YS    ++DLT+  G K Y E
Sbjct  23   SNLIFNTICDDPLVRRGPSGFSVPAIYRSGFKCRVCNKTYSSKNIYLDLTVTAGSKDYNE  82

Query  379  ALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELM  504
               A TELFR PLVSFLYERGWR +F+   GFPGP KE + +
Sbjct  83   LKPAGTELFRSPLVSFLYERGWRQNFNC-SGFPGPNKEVKFL  123



>ref|XP_002968407.1| hypothetical protein SELMODRAFT_89857 [Selaginella moellendorffii]
 gb|EFJ30661.1| hypothetical protein SELMODRAFT_89857 [Selaginella moellendorffii]
Length=315

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 72/130 (55%), Gaps = 8/130 (6%)
 Frame = +1

Query  208  LACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALA  387
            LACP C +  + +G  G + +++A+S L C TC K +  + T +DLT+      + E L 
Sbjct  26   LACPTCLEPLSRHGPQGFNRAAIAKSILRCQTCSKDFPSDGTFIDLTLGANRSTWQETLP  85

Query  388  ASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYL-------KPVMGGNIID  546
                LFR   +S +YE  WR SF  + GFPGP++E EL + +L       +P     ++D
Sbjct  86   IGVRLFRTKWISLIYEENWRKSFEKF-GFPGPDREVELAETFLQTAVDPSRPDEENLLVD  144

Query  547  ASCGSGLFSR  576
             SCG+GL SR
Sbjct  145  ISCGTGLHSR  154



>gb|KGN60339.1| hypothetical protein Csa_3G895850 [Cucumis sativus]
Length=220

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  415  LVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  579
            LVSFLYERGWR SFS+  GFPGPEKEFEL+++++ PV+GG+IIDASCGSG+FSR+
Sbjct  11   LVSFLYERGWRQSFSVLLGFPGPEKEFELIKNFITPVLGGSIIDASCGSGMFSRI  65



>gb|KGN60338.1| hypothetical protein Csa_3G895840 [Cucumis sativus]
Length=180

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 82/155 (53%), Gaps = 8/155 (5%)
 Frame = +1

Query  55   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRT-NLLACPICYD  231
              ++S  S SP         +      ++T V+     +ID    + +  N+LAC IC+ 
Sbjct  24   FNFHSTLSISPRLSLLTLRSSSAPPMETSTNVQPSDSVMIDNDNEDNKIKNILACSICHG  83

Query  232  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  411
              T     GL + S     LEC TC+K ++G+E+H+DLTI GG  + GE++ A+TE+FR 
Sbjct  84   PLTAAAGSGLPVESTNGYQLECGTCKKSFTGSESHLDLTITGGTDS-GESMPAATEIFRT  142

Query  412  PLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYL  516
             LVSFLYERGWR         P P  EF L +D L
Sbjct  143  RLVSFLYERGWRPK-----EIPLPH-EFILNRDLL  171



>emb|CAN77779.1| hypothetical protein VITISV_004172 [Vitis vinifera]
Length=714

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 60/95 (63%), Gaps = 15/95 (16%)
 Frame = +1

Query  334  HVDLTIAGGGKAYGEALAASTELFR--------------LPLVSFLYERGWRXSFSLWGG  471
            ++DLTI  G K Y E     TELFR               PLVSFLYERGWR +F+   G
Sbjct  2    YLDLTITAGSKDYNELQPNRTELFRNCPCLIFGXFAIVRSPLVSFLYERGWRQNFNX-SG  60

Query  472  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            FPG ++EF++ Q+Y  PV+GG ++D SCGSGLFSR
Sbjct  61   FPGRDEEFKMAQEYFXPVIGGLLVDVSCGSGLFSR  95


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 69/136 (51%), Gaps = 18/136 (13%)
 Frame = +1

Query  202  NLLACPICYDAFTWNGDPGLSLSSMA----------QSNLECSTCRKKYSGNETHVDLTI  351
            +L +CP+CY+     G PGL+L  +           +S  +C TC K YS  + ++DLTI
Sbjct  232  DLFSCPVCYEXLIRKGPPGLNLXCLKNYTICRPAIYRSGFKCKTCNKSYSSKDMYLDLTI  291

Query  352  AGGGKAYGEALAASTELFR-LPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVM  528
              G KAY EA    TELFR L      Y  G                +F++ Q+Y KP  
Sbjct  292  TAGSKAYNEAQPVRTELFRSLSPRPTGYASG-------TNHIKVDIVQFKMAQEYFKPAA  344

Query  529  GGNIIDASCGSGLFSR  576
            GG ++D SCGSGLFSR
Sbjct  345  GGLLVDVSCGSGLFSR  360



>ref|XP_005842697.1| hypothetical protein CHLNCDRAFT_136276 [Chlorella variabilis]
 gb|EFN50565.1| hypothetical protein CHLNCDRAFT_136276 [Chlorella variabilis]
Length=190

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 60/106 (57%), Gaps = 7/106 (7%)
 Frame = +1

Query  208  LACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG--GKAYGEA  381
            LACPIC         P  +       +L C  C + ++   T+ DLT+  G   KAY ++
Sbjct  81   LACPICLS----TKLPLRNTQGRPTGSLSCPRCNRTFASTPTYADLTLTSGIQQKAYQQS  136

Query  382  LAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLK  519
                T +FR PLVSF+YERGWR  F+ W GFPG +KEFEL  DYL+
Sbjct  137  WWGGTTIFRSPLVSFVYERGWRQGFA-WAGFPGADKEFELAMDYLQ  181



>ref|XP_006473932.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Citrus sinensis]
Length=139

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 6/112 (5%)
 Frame = +1

Query  82   SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  261
            SP  P++ R F+  IRA++      +PV+    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPVKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  262  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPL  417
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR PL
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRTPL  130



>ref|XP_006474605.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Citrus sinensis]
Length=160

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 70/121 (58%), Gaps = 8/121 (7%)
 Frame = +1

Query  82   SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  261
            SP  P++ R F+  IRA++      +PV+    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPVKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  262  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLV--SFLYE  435
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR  LV  +F +E
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRCVLVILAFFHE  138

Query  436  R  438
            +
Sbjct  139  K  139



>ref|XP_002960327.1| hypothetical protein SELMODRAFT_402502 [Selaginella moellendorffii]
 gb|EFJ37866.1| hypothetical protein SELMODRAFT_402502 [Selaginella moellendorffii]
Length=604

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 77/137 (56%), Gaps = 8/137 (6%)
 Frame = +1

Query  175  DEKKVEIRTNL--LACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKY-SGNETHVDL  345
            +E++ + RT L  LACPIC      + +  +S+ + A ++  C+ CR+ Y S +   ++L
Sbjct  52   NEQEDDARTTLKSLACPICLQPLWTSSNESVSVENAASTSFRCNGCRRSYHSSSRGIINL  111

Query  346  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPV  525
            TI G   A G  L+AS  +F  P+V+  Y++ +R       GFPG ++EF + Q+ L+P 
Sbjct  112  TIPG---ACGVPLSAS--VFENPIVARFYDKSYRDQVFQLVGFPGFDEEFTMAQEILRPC  166

Query  526  MGGNIIDASCGSGLFSR  576
             G  I+D SC  G  +R
Sbjct  167  FGKAIMDLSCAGGTLTR  183



>ref|XP_003056709.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58354.1| predicted protein [Micromonas pusilla CCMP1545]
Length=384

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 66/132 (50%), Gaps = 22/132 (17%)
 Frame = +1

Query  205  LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTC-RKKYSGNETHVDLTIAGGGKA--YG  375
            LLACPIC             L+     +L C+ C R  Y   +  +DL +   G A  Y 
Sbjct  63   LLACPIC-------------LTPFPAGSLRCARCARDAYPTKDGILDLCLDANGAAGAYA  109

Query  376  EALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMG-----GNI  540
            E   + T LF+  ++S  YE GWR SF+ W GFPG E+E E+   +L+           +
Sbjct  110  EPQRSGTRLFQSDVISAAYENGWRQSFA-WAGFPGEEEETEIAMTFLRGAGATTAPRATL  168

Query  541  IDASCGSGLFSR  576
            +D SCGSGLFSR
Sbjct  169  LDVSCGSGLFSR  180



>ref|XP_002306577.1| hypothetical protein POPTR_0005s17000g [Populus trichocarpa]
 gb|EEE93573.1| hypothetical protein POPTR_0005s17000g [Populus trichocarpa]
Length=122

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = +1

Query  91   TPKANRL-FAVKIRALSTTFVEDKPVRLID-EKKVEIRTNLLACPICYDAFTWNGDPGLS  264
            TP   R  FA KIRA ST F E KP   +  EK V    N+LACP+CY+  T  G   LS
Sbjct  29   TPTFKRTSFATKIRASSTAFAETKPTGPVTVEKDVRSSKNILACPVCYEPVTLIGATVLS  88

Query  265  LSSMAQSNLECSTCRKKYSGNETHV  339
            + S   S+L+CSTC+K YSG ET +
Sbjct  89   VYSARGSSLQCSTCKKTYSGKETQL  113



>ref|XP_007510827.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18360.1| predicted protein [Bathycoccus prasinos]
Length=390

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 54/93 (58%), Gaps = 13/93 (14%)
 Frame = +1

Query  334  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDY  513
            + DL I+    ++ EA  + T LF  P+VS  YERGWR SF+ W GFPG EKEF++   +
Sbjct  115  YTDLEISRNANSFREAKLSGTSLFETPIVSNAYERGWRDSFA-WAGFPGKEKEFDVAMRF  173

Query  514  LKP------------VMGGNIIDASCGSGLFSR  576
            ++              +G  ++D SCGSGLF+R
Sbjct  174  VRENTNQRQQQNQKQQLGEVVLDVSCGSGLFAR  206



>ref|XP_002967385.1| hypothetical protein SELMODRAFT_408369 [Selaginella moellendorffii]
 gb|EFJ31984.1| hypothetical protein SELMODRAFT_408369 [Selaginella moellendorffii]
Length=776

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 75/137 (55%), Gaps = 8/137 (6%)
 Frame = +1

Query  175  DEKKVEIRTNL--LACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKY-SGNETHVDL  345
            +E+  + RT L  LACPIC      + +  +S+ + A ++  C+ CR+ Y S +   ++L
Sbjct  224  NEQDDDARTTLKSLACPICLQPLWTSSNESVSVENAASTSFRCNGCRRSYHSSSRGIINL  283

Query  346  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPV  525
            TI G   A G  L+AS  +F   +V+  Y++ +R       GFPG ++EF + Q+ L+P 
Sbjct  284  TIPG---ACGVPLSAS--VFENSIVARFYDKSYRDQVFQLVGFPGFDEEFTMAQEILRPC  338

Query  526  MGGNIIDASCGSGLFSR  576
             G  I+D SC  G  +R
Sbjct  339  FGKAIMDLSCAGGTLTR  355



>ref|XP_005824779.1| hypothetical protein GUITHDRAFT_116106 [Guillardia theta CCMP2712]
 gb|EKX37799.1| hypothetical protein GUITHDRAFT_116106 [Guillardia theta CCMP2712]
Length=365

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = +1

Query  322  GNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFEL  501
             N   V   +AG G A  +      ELFR P+VS+LYERGWR  F+   GFPG EKE+EL
Sbjct  124  ANNPLVSAFLAGAG-AQMDGQPLRQELFRTPVVSWLYERGWRAGFAS-AGFPGIEKEYEL  181

Query  502  MQDYLKPVMGGNIIDASCGSGLFSR  576
            + D+ +      ++D SCGSGL  R
Sbjct  182  VMDFFQEARNKTVVDLSCGSGLMVR  206



>ref|XP_002500021.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61279.1| predicted protein [Micromonas sp. RCC299]
Length=385

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +1

Query  394  TELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGN-IIDASCGSGLF  570
            T  F  P V+F YERGWR SF+   GFPGP++EF L Q  L P   G  ++DASCGSGLF
Sbjct  146  TSTFETPQVAFAYERGWRDSFAR-AGFPGPDEEFRLAQAKLLPFAAGKCVVDASCGSGLF  204

Query  571  SR  576
            +R
Sbjct  205  TR  206



>ref|XP_005713645.1| unnamed protein product [Chondrus crispus]
 emb|CDF33826.1| unnamed protein product [Chondrus crispus]
Length=298

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 56/98 (57%), Gaps = 7/98 (7%)
 Frame = +1

Query  295  CSTCRKKYSGNETHVDLT-IAGGGKAYGEAL---AASTELFRLPLVSFLYERGWRXSFSL  462
            C+TC+ + +    +VDLT  A    +    L     S  LF+LPLVS  YERGWR +F+ 
Sbjct  40   CATCKFEPTERRGYVDLTRTASSPPSLLRNLLTQPPSQSLFQLPLVSAAYERGWRANFA-  98

Query  463  WGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
              GFPG EKE +L  D+  P     ++D SCGSGL +R
Sbjct  99   RAGFPGIEKERDLFLDFAAP--AAAVLDMSCGSGLMAR  134



>ref|XP_005536724.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80688.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=441

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 65/127 (51%), Gaps = 19/127 (15%)
 Frame = +1

Query  199  TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGE  378
             N L CP  +   +W     +S  S      + +  R +Y+ +E           +  G 
Sbjct  162  ANRLRCPNGHGEASWIQ---VSEKSRGGGFWDLTPQRFRYNVDE-----------RPRGP  207

Query  379  ALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGN-IIDASC  555
            ++    +LF+ P V+FLYERGWR  F    GFPGP+ EF ++Q + K   G N ++D SC
Sbjct  208  SVELRRDLFQSPFVAFLYERGWRDQFRS-SGFPGPDAEFRIVQSFFK---GANCVMDLSC  263

Query  556  GSGLFSR  576
            GSGLF+R
Sbjct  264  GSGLFTR  270



>ref|XP_003057905.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH57856.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=235

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +1

Query  394  TELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNI-IDASCGSGLF  570
            T  F  P V+F YERGWR SF    GFPGP++E++L +  L P     + +DASCGSGLF
Sbjct  1    TSTFETPQVAFAYERGWRDSFKR-AGFPGPDEEYDLARAKLLPHAADKVLVDASCGSGLF  59

Query  571  SR  576
            +R
Sbjct  60   TR  61



>ref|XP_002992310.1| hypothetical protein SELMODRAFT_430530 [Selaginella moellendorffii]
 gb|EFJ06586.1| hypothetical protein SELMODRAFT_430530 [Selaginella moellendorffii]
Length=212

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 4/64 (6%)
 Frame = +1

Query  382  LAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGS  561
            L + TELFR PLVS +YERGWR +F    GFPG   + ++  +YL+P  GG I+D SCGS
Sbjct  7    LPSGTELFRNPLVSLIYERGWRQNFER-SGFPG---QLKMALEYLRPAFGGVIVDVSCGS  62

Query  562  GLFS  573
             + +
Sbjct  63   AVIA  66



>ref|XP_001418638.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO96931.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=227

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +1

Query  394  TELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKP-VMGGNIIDASCGSGLF  570
            T  F  P V+F YERGWR SF    GFPGP++E  L  D L     GG ++DASCGSGLF
Sbjct  1    TATFETPQVAFAYERGWRDSFKR-AGFPGPDEEARLAVDALGEFAKGGIVVDASCGSGLF  59

Query  571  SR  576
            +R
Sbjct  60   TR  61



>ref|XP_010040340.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=134

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 64/139 (46%), Gaps = 11/139 (8%)
 Frame = +1

Query  1    TMATAG---LGYVSAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRL  171
            TMA++    L +    L+ R      +  FS +     RL +  +RA S   VE      
Sbjct  2    TMASSSMHQLSFARHPLLPRNSRVQPRPQFSSV-----RLPSFTVRASSVLAVEPD---T  53

Query  172  IDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  351
              +K   +   + +CPICY+     G  GL+L ++ +S  +C  C K YS     +DLT+
Sbjct  54   GTQKDQTLEVEIFSCPICYEPLIRRGPSGLNLEAVYRSGFKCKNCNKSYSSKNNFLDLTL  113

Query  352  AGGGKAYGEALAASTELFR  408
              G + Y E   A +ELFR
Sbjct  114  TAGLRDYVEVKPARSELFR  132



>gb|EWM24600.1| phosphatidylethanolamine n [Nannochloropsis gaditana]
Length=387

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 54/108 (50%), Gaps = 21/108 (19%)
 Frame = +1

Query  313  KYSGNETHVDLTIAGGGKA---YGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGP  483
            KY  NE ++DL  A        +  +   + ELFR PL SFLYERGWR +F    GFPG 
Sbjct  136  KYPANEVYMDLVPAEERMQVPFFSPSAIVTQELFRSPLTSFLYERGWRDNFKT-AGFPGI  194

Query  484  EKEFELMQDYLKPVMG-----------------GNIIDASCGSGLFSR  576
            ++EF  ++ +  P+                   G +ID SCGSGL +R
Sbjct  195  DEEFRDLEAFFAPLSDAGSESEREGEQQRRSGRGTVIDLSCGSGLTAR  242



>ref|XP_003080221.1| methyltransferase-related (ISS) [Ostreococcus tauri]
 emb|CAL54388.1| Methyltransferase type 11 [Ostreococcus tauri]
Length=389

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +1

Query  394  TELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKP-VMGGNIIDASCGSGLF  570
            T  F  P V+F YERGWR SF+   GFPGP++E  L  D L      G I+DASCGSGLF
Sbjct  163  TATFETPQVAFAYERGWRDSFAR-AGFPGPDEETRLAMDALGEFARDGIIVDASCGSGLF  221

Query  571  SR  576
            SR
Sbjct  222  SR  223



>gb|KCW45298.1| hypothetical protein EUGRSUZ_L01042 [Eucalyptus grandis]
Length=132

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 50/101 (50%), Gaps = 3/101 (3%)
 Frame = +1

Query  106  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  285
            RL +  +RA S   VE        +K   +   + +CPICY+     G  GL+L ++ +S
Sbjct  33   RLPSFTVRASSVLAVEPD---TGTQKDQTLEVEIFSCPICYEPLIRRGPSGLNLEAVYRS  89

Query  286  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFR  408
              +C  C K YS     +DLT+  G + Y E   A +ELFR
Sbjct  90   GFKCKNCNKSYSSKNNFLDLTLTAGLRDYVEVKPARSELFR  130



>ref|XP_005855405.1| hypothetical protein NGA_2005920 [Nannochloropsis gaditana CCMP526]
 ref|XP_005855816.1| hypothetical protein NGA_2005910 [Nannochloropsis gaditana CCMP526]
 gb|EKU20544.1| hypothetical protein NGA_2005910 [Nannochloropsis gaditana CCMP526]
 gb|EKU20954.1| hypothetical protein NGA_2005920 [Nannochloropsis gaditana CCMP526]
Length=387

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 53/108 (49%), Gaps = 21/108 (19%)
 Frame = +1

Query  313  KYSGNETHVDLTIAGGGKA---YGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGP  483
            KY  NE ++DL           +  +   + ELFR PL SFLYERGWR +F    GFPG 
Sbjct  136  KYPANEVYMDLVPVEERMQVPFFSPSAIVTQELFRSPLTSFLYERGWRDNFKT-AGFPGI  194

Query  484  EKEFELMQDYLKPVMG-----------------GNIIDASCGSGLFSR  576
            ++EF  ++ +  P+                   G +ID SCGSGL +R
Sbjct  195  DEEFRDLEAFFAPLSDAGSESEREGEQQRRSGRGTVIDLSCGSGLMAR  242



>ref|XP_002506188.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67446.1| predicted protein [Micromonas sp. RCC299]
Length=359

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 67/143 (47%), Gaps = 24/143 (17%)
 Frame = +1

Query  175  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHV-DLTI  351
            D  + E     LACPIC  AF               +   C+ C + +   +  + DL +
Sbjct  60   DTHRRERARPQLACPICLRAFV--------------AGTTCACCARTFPTIDGKILDLCL  105

Query  352  AGGGK--AYGEA--LAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLK  519
              GG    Y +     + T LF+   ++ +YE GWR SF+ W GFPG   E+E   +Y+K
Sbjct  106  DAGGANGTYTDPPLRKSGTTLFQSEAIANVYENGWRQSFA-WAGFPGESTEWEYAMEYVK  164

Query  520  PVMGGN----IIDASCGSGLFSR  576
                G     ++D SCGSGLF+R
Sbjct  165  AAGHGGGGGVLLDVSCGSGLFTR  187



>ref|XP_005781281.1| hypothetical protein EMIHUDRAFT_442892 [Emiliania huxleyi CCMP1516]
 gb|EOD28852.1| hypothetical protein EMIHUDRAFT_442892 [Emiliania huxleyi CCMP1516]
Length=459

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 42/65 (65%), Gaps = 4/65 (6%)
 Frame = +1

Query  391  STELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMG---GNIIDASCGS  561
             T++FR P++ FLYERGWR  F    GFPG EKE++ +  + +PV     G ++D SCGS
Sbjct  106  QTQMFRTPVLGFLYERGWRQQFRA-AGFPGIEKEYDEVSAFFEPVAAQGRGVVVDMSCGS  164

Query  562  GLFSR  576
            GL  R
Sbjct  165  GLMYR  169



>ref|XP_002185698.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65168.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=412

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 43/79 (54%), Gaps = 5/79 (6%)
 Frame = +1

Query  352  AGGGKAYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMG  531
            A  G   GE      +LF  P+VS  YERGWR  F+   GFPG + E +L  DY  PVM 
Sbjct  174  ATAGFPMGEDYVPMRDLFTSPVVSAAYERGWRQGFA-QAGFPGADDEAQLAMDYFAPVMA  232

Query  532  ----GNIIDASCGSGLFSR  576
                  ++D SC +GLF+R
Sbjct  233  MSDTKTLVDMSCATGLFTR  251



>gb|EJK66010.1| hypothetical protein THAOC_13088 [Thalassiosira oceanica]
Length=446

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 10/69 (14%)
 Frame = +1

Query  397  ELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGN---------IIDA  549
            +LF  P VSF YERGWR  F    GFPG + E+EL ++Y +PV+            ++D 
Sbjct  217  DLFTSPQVSFAYERGWRQGFQA-AGFPGADAEYELAKEYFEPVIASKRAKGDGTDVLVDM  275

Query  550  SCGSGLFSR  576
            SC +GLF+R
Sbjct  276  SCATGLFTR  284



>emb|CBJ26935.1| S-adenosyl-L-methionine-dependent methyltransferases-like [Ectocarpus 
siliculosus]
Length=471

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 44/72 (61%), Gaps = 5/72 (7%)
 Frame = +1

Query  367  AYGEALAASTELFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYLKPV--MGGNI  540
            + GEA+   T  F+ PLVS+LYERGWR  FS   GFPG ++EF L  +Y       G  +
Sbjct  251  SRGEAVKEGT--FQTPLVSWLYERGWRQGFSA-NGFPGIDEEFRLASEYFSSTGADGKAV  307

Query  541  IDASCGSGLFSR  576
            ID SCGSGL  R
Sbjct  308  IDLSCGSGLMMR  319



>ref|XP_007514982.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15222.1| predicted protein [Bathycoccus prasinos]
Length=383

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = +1

Query  400  LFRLPLVSFLYERGWRXSFSLWGGFPGPEKEFELMQDYL-KPVMGGNIIDASCGSGLFSR  576
            LF  PLVSF YERGWR +F    GFPG E E E   + L +  +G  IID SCGSGLF+R
Sbjct  163  LFESPLVSFAYERGWRDNFKR-SGFPGVEVEKENAMEALGEDAVGDVIIDCSCGSGLFTR  221



>gb|EMS47735.1| hypothetical protein TRIUR3_02804 [Triticum urartu]
Length=241

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +1

Query  439  GWRXSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSR  576
            GWR +F+   GFPG ++EF++ QDY + V GG ++D SCGSGLFSR
Sbjct  72   GWRQNFN-RSGFPGRDEEFQMAQDYFQSVAGGILVDVSCGSGLFSR  116



>dbj|BAH19476.1| AT2G41040 [Arabidopsis thaliana]
Length=141

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)
 Frame = +1

Query  184  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  360
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  70   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  129

Query  361  GKAYGEALAAST  396
               Y E    +T
Sbjct  130  LDDYNEVKPITT  141



>tpg|DAA49105.1| TPA: hypothetical protein ZEAMMB73_519956 [Zea mays]
Length=138

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 5/73 (7%)
 Frame = +1

Query  190  EIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKA  369
            E +   LACPICY     + D     +S     LEC TC+K Y   + + DLT++ G   
Sbjct  71   ETKLRKLACPICYYPLASSSDQLDDATS-----LECPTCKKCYPNKQDYWDLTVSVGSTE  125

Query  370  YGEALAASTELFR  408
            Y E++  +TELFR
Sbjct  126  YSESMPVATELFR  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220