BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS052H08

Length=604
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAF19001.1|AF212157_1  S-adenosylhomocysteine hydrolase              341   2e-114   Allium cepa
ref|XP_010253338.1|  PREDICTED: adenosylhomocysteinase                  345   7e-114   Nelumbo nucifera [Indian lotus]
ref|XP_010268032.1|  PREDICTED: adenosylhomocysteinase-like             345   9e-114   Nelumbo nucifera [Indian lotus]
ref|XP_009787091.1|  PREDICTED: adenosylhomocysteinase-like             342   2e-112   Nicotiana sylvestris
sp|P35007.1|SAHH_CATRO  RecName: Full=Adenosylhomocysteinase; Sho...    341   3e-112   Catharanthus roseus [chatas]
gb|AFK08605.1|  S-adenosyl homocysteine hydrolase                       341   3e-112   Nicotiana benthamiana
gb|AAV31754.1|  S-adenosyl-L-homocysteine hydrolase                     341   4e-112   Nicotiana tabacum [American tobacco]
gb|EYU32710.1|  hypothetical protein MIMGU_mgv1a003606mg                343   4e-112   Erythranthe guttata [common monkey flower]
ref|XP_002266154.1|  PREDICTED: adenosylhomocysteinase                  340   5e-112   Vitis vinifera
ref|XP_011102056.1|  PREDICTED: adenosylhomocysteinase                  340   5e-112   Sesamum indicum [beniseed]
ref|XP_009606591.1|  PREDICTED: adenosylhomocysteinase-like             340   7e-112   Nicotiana tomentosiformis
gb|EYU31514.1|  hypothetical protein MIMGU_mgv1a005403mg                340   8e-112   Erythranthe guttata [common monkey flower]
dbj|BAP47515.1|  S-adenosylhomocysteine hydrolase                       339   2e-111   Gentiana triflora
ref|NP_001289538.1|  adenosylhomocysteinase                             339   2e-111   Nicotiana sylvestris
emb|CDP11183.1|  unnamed protein product                                339   2e-111   Coffea canephora [robusta coffee]
ref|XP_008380474.1|  PREDICTED: adenosylhomocysteinase                  339   2e-111   Malus domestica [apple tree]
ref|XP_009373550.1|  PREDICTED: adenosylhomocysteinase                  339   2e-111   Pyrus x bretschneideri [bai li]
ref|XP_010052042.1|  PREDICTED: adenosylhomocysteinase 1                337   9e-111   Eucalyptus grandis [rose gum]
ref|XP_004138966.1|  PREDICTED: adenosylhomocysteinase-like             337   1e-110   
ref|XP_008457223.1|  PREDICTED: adenosylhomocysteinase 1                337   1e-110   Cucumis melo [Oriental melon]
ref|XP_002522805.1|  adenosylhomocysteinase, putative                   337   1e-110   Ricinus communis
gb|EYU31513.1|  hypothetical protein MIMGU_mgv1a004058mg                339   1e-110   Erythranthe guttata [common monkey flower]
ref|XP_009349913.1|  PREDICTED: adenosylhomocysteinase-like             337   1e-110   Pyrus x bretschneideri [bai li]
ref|XP_004252985.1|  PREDICTED: adenosylhomocysteinase-like             337   1e-110   Solanum lycopersicum
gb|KDO43195.1|  hypothetical protein CISIN_1g011464mg                   335   2e-110   Citrus sinensis [apfelsine]
ref|XP_006349914.1|  PREDICTED: adenosylhomocysteinase-like             337   2e-110   Solanum tuberosum [potatoes]
ref|XP_004247887.1|  PREDICTED: adenosylhomocysteinase                  337   2e-110   Solanum lycopersicum
gb|AAV31755.1|  S-adenosyl-L-homocysteine hydrolase                     337   2e-110   Nicotiana tabacum [American tobacco]
gb|AFU51537.1|  S-adenosyl-homocysteine hydrolase protein               337   2e-110   Capsicum annuum
gb|KJB37872.1|  hypothetical protein B456_006G223900                    335   2e-110   Gossypium raimondii
gb|KJB72028.1|  hypothetical protein B456_011G154000                    336   2e-110   Gossypium raimondii
ref|XP_010097949.1|  hypothetical protein L484_026840                   336   3e-110   Morus notabilis
gb|KHG17040.1|  Adenosylhomocysteinase                                  336   3e-110   Gossypium arboreum [tree cotton]
gb|KJB72024.1|  hypothetical protein B456_011G154000                    336   3e-110   Gossypium raimondii
ref|XP_003531217.1|  PREDICTED: adenosylhomocysteinase-like             336   3e-110   Glycine max [soybeans]
ref|XP_003524926.1|  PREDICTED: adenosylhomocysteinase-like             336   3e-110   
gb|AEI54335.1|  adenosylhomocysteinase                                  336   3e-110   Glycine max [soybeans]
gb|KDO43194.1|  hypothetical protein CISIN_1g011464mg                   335   5e-110   Citrus sinensis [apfelsine]
ref|XP_006492541.1|  PREDICTED: adenosylhomocysteinase-like             335   5e-110   Citrus sinensis [apfelsine]
gb|KCW59952.1|  hypothetical protein EUGRSUZ_H02678                     335   5e-110   Eucalyptus grandis [rose gum]
ref|XP_006360925.1|  PREDICTED: adenosylhomocysteinase-like isofo...    335   6e-110   
ref|XP_010023650.1|  PREDICTED: adenosylhomocysteinase                  335   6e-110   Eucalyptus grandis [rose gum]
ref|XP_011012490.1|  PREDICTED: adenosylhomocysteinase-like             335   6e-110   Populus euphratica
gb|AIG62154.1|  S-adenosyl-L-homocysteine hydrolase                     335   7e-110   Populus tomentosa [Chinese white poplar]
gb|AIG62191.1|  S-adenosyl-L-homocysteine hydrolase                     335   8e-110   Populus tomentosa [Chinese white poplar]
gb|AIG62160.1|  S-adenosyl-L-homocysteine hydrolase                     335   9e-110   Populus tomentosa [Chinese white poplar]
gb|AIG62165.1|  S-adenosyl-L-homocysteine hydrolase                     335   9e-110   Populus tomentosa [Chinese white poplar]
gb|AIG62181.1|  S-adenosyl-L-homocysteine hydrolase                     335   1e-109   Populus tomentosa [Chinese white poplar]
gb|AIG62184.1|  S-adenosyl-L-homocysteine hydrolase                     335   1e-109   Populus tomentosa [Chinese white poplar]
gb|AIG62157.1|  S-adenosyl-L-homocysteine hydrolase                     335   1e-109   Populus tomentosa [Chinese white poplar]
gb|AIG62178.1|  S-adenosyl-L-homocysteine hydrolase                     335   1e-109   Populus tomentosa [Chinese white poplar]
gb|AIG62166.1|  S-adenosyl-L-homocysteine hydrolase                     335   1e-109   Populus tomentosa [Chinese white poplar]
gb|AIG62164.1|  S-adenosyl-L-homocysteine hydrolase                     335   1e-109   Populus tomentosa [Chinese white poplar]
gb|AIG62156.1|  S-adenosyl-L-homocysteine hydrolase                     334   1e-109   Populus tomentosa [Chinese white poplar]
ref|XP_008361486.1|  PREDICTED: adenosylhomocysteinase                  334   1e-109   Malus domestica [apple tree]
sp|Q01781.2|SAHH_PETCR  RecName: Full=Adenosylhomocysteinase; Sho...    334   1e-109   Petroselinum crispum
ref|XP_003629610.1|  Adenosylhomocysteinase                             334   1e-109   Medicago truncatula
gb|AAP92452.1|  S-adenosyl-L-homocystein hydrolase                      334   1e-109   Petunia x hybrida [garden petunia]
ref|XP_011102207.1|  PREDICTED: adenosylhomocysteinase-like             334   1e-109   Sesamum indicum [beniseed]
ref|XP_006421018.1|  hypothetical protein CICLE_v10004852mg             334   1e-109   Citrus clementina [clementine]
ref|XP_011003627.1|  PREDICTED: adenosylhomocysteinase                  334   1e-109   Populus euphratica
gb|ABB55380.1|  S-adenosyl-L-homocysteine hydrolase-like                334   2e-109   Solanum tuberosum [potatoes]
ref|XP_011083449.1|  PREDICTED: adenosylhomocysteinase-like             334   2e-109   Sesamum indicum [beniseed]
gb|KDP39327.1|  hypothetical protein JCGZ_01084                         334   2e-109   Jatropha curcas
sp|P93253.1|SAHH_MESCR  RecName: Full=Adenosylhomocysteinase; Sho...    333   2e-109   Mesembryanthemum crystallinum
gb|KCW59951.1|  hypothetical protein EUGRSUZ_H02678                     335   2e-109   Eucalyptus grandis [rose gum]
gb|AIG62149.1|  S-adenosyl-L-homocysteine hydrolase                     333   3e-109   Populus tomentosa [Chinese white poplar]
ref|NP_001078387.1|  adenosylhomocysteinase 1                           328   3e-109   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26655.1|  S-adenosyl-l-homocysteine hydrolase A                   333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AGX26683.1|  S-adenosyl-l-homocysteine hydrolase A                   333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AGX26652.1|  S-adenosyl-l-homocysteine hydrolase A                   333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AGX26650.1|  S-adenosyl-l-homocysteine hydrolase A                   333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AGX26646.1|  S-adenosyl-l-homocysteine hydrolase A                   333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AGX26651.1|  S-adenosyl-l-homocysteine hydrolase A                   333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AIG62171.1|  S-adenosyl-L-homocysteine hydrolase                     333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AIG62150.1|  S-adenosyl-L-homocysteine hydrolase                     333   3e-109   Populus tomentosa [Chinese white poplar]
ref|XP_008222807.1|  PREDICTED: adenosylhomocysteinase isoform X1       333   3e-109   Prunus mume [ume]
gb|AGX26663.1|  S-adenosyl-l-homocysteine hydrolase A                   333   3e-109   Populus tomentosa [Chinese white poplar]
ref|XP_007222610.1|  hypothetical protein PRUPE_ppa004934mg             333   3e-109   Prunus persica
gb|AGX26685.1|  S-adenosyl-l-homocysteine hydrolase A                   333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AGX26672.1|  S-adenosyl-l-homocysteine hydrolase A                   333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AGX26669.1|  S-adenosyl-l-homocysteine hydrolase A                   333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AIG62179.1|  S-adenosyl-L-homocysteine hydrolase                     333   3e-109   Populus tomentosa [Chinese white poplar]
ref|XP_007153624.1|  hypothetical protein PHAVU_003G051200g             333   3e-109   Phaseolus vulgaris [French bean]
gb|AFZ78657.1|  S-adenosyl-L-homocysteine hydrolase                     333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AIG62173.1|  S-adenosyl-L-homocysteine hydrolase                     333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AGX26666.1|  S-adenosyl-l-homocysteine hydrolase A                   333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AIG62159.1|  S-adenosyl-L-homocysteine hydrolase                     333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AGX26664.1|  S-adenosyl-l-homocysteine hydrolase A                   333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AIG62155.1|  S-adenosyl-L-homocysteine hydrolase                     333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AGX26684.1|  S-adenosyl-l-homocysteine hydrolase A                   333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AIG62169.1|  S-adenosyl-L-homocysteine hydrolase                     333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AIG62188.1|  S-adenosyl-L-homocysteine hydrolase                     333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AGX26682.1|  S-adenosyl-l-homocysteine hydrolase A                   333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AGX26678.1|  S-adenosyl-l-homocysteine hydrolase A                   333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AGX26661.1|  S-adenosyl-l-homocysteine hydrolase A                   333   3e-109   Populus tomentosa [Chinese white poplar]
gb|AFW60834.1|  adenosyl homocysteine hydrolase1                        325   3e-109   
gb|AGW81844.1|  S-(5'-adenosyl)-l-homocysteine hydrolase A              333   4e-109   Populus tomentosa [Chinese white poplar]
gb|AIG62187.1|  S-adenosyl-L-homocysteine hydrolase                     333   4e-109   Populus tomentosa [Chinese white poplar]
gb|AIG62158.1|  S-adenosyl-L-homocysteine hydrolase                     333   4e-109   Populus tomentosa [Chinese white poplar]
gb|KJB37873.1|  hypothetical protein B456_006G223900                    333   4e-109   Gossypium raimondii
gb|AIG62148.1|  S-adenosyl-L-homocysteine hydrolase                     333   4e-109   Populus tomentosa [Chinese white poplar]
gb|AER92590.1|  putative S-adenosyl-L-homocysteinase                    335   4e-109   Linum usitatissimum
gb|ADR30776.1|  S-adenosyl-L-homocysteine hydrolase                     333   4e-109   Cucumis sativus [cucumbers]
gb|AIG62180.1|  S-adenosyl-L-homocysteine hydrolase                     333   4e-109   Populus tomentosa [Chinese white poplar]
gb|KHG10896.1|  Adenosylhomocysteinase 1 -like protein                  333   4e-109   Gossypium arboreum [tree cotton]
gb|AIG62152.1|  S-adenosyl-L-homocysteine hydrolase                     333   4e-109   Populus tomentosa [Chinese white poplar]
gb|AIG62151.1|  S-adenosyl-L-homocysteine hydrolase                     333   4e-109   Populus tomentosa [Chinese white poplar]
ref|XP_002300147.1|  adenosylhomocysteinase family protein              333   4e-109   Populus trichocarpa [western balsam poplar]
gb|AGX26679.1|  S-adenosyl-l-homocysteine hydrolase A                   333   6e-109   Populus tomentosa [Chinese white poplar]
gb|AGX26676.1|  S-adenosyl-l-homocysteine hydrolase A                   333   6e-109   Populus tomentosa [Chinese white poplar]
dbj|BAE71233.1|  putative adenosylhomocysteinase                        333   6e-109   Trifolium pratense [peavine clover]
ref|XP_007034216.1|  S-adenosyl-L-homocysteine hydrolase                333   6e-109   
gb|AIG62182.1|  S-adenosyl-L-homocysteine hydrolase                     333   6e-109   Populus tomentosa [Chinese white poplar]
gb|AGX26649.1|  S-adenosyl-l-homocysteine hydrolase A                   332   7e-109   Populus tomentosa [Chinese white poplar]
gb|AAO72664.1|  wheat adenosylhomocysteinase-like protein               332   7e-109   Oryza sativa Japonica Group [Japonica rice]
gb|AHA84211.1|  S-adenosyl-L-homocysteine hydrolase                     332   8e-109   Phaseolus vulgaris [French bean]
gb|AGV54286.1|  adenosylhomocysteinase                                  332   8e-109   Phaseolus vulgaris [French bean]
gb|AIG62176.1|  S-adenosyl-L-homocysteine hydrolase                     332   1e-108   Populus tomentosa [Chinese white poplar]
ref|XP_009135865.1|  PREDICTED: adenosylhomocysteinase 2-like           332   1e-108   Brassica rapa
gb|ABQ18314.1|  S-adenosyl-L-homocysteine hydrolase                     332   1e-108   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AGX26654.1|  S-adenosyl-l-homocysteine hydrolase A                   332   1e-108   Populus tomentosa [Chinese white poplar]
ref|XP_010532739.1|  PREDICTED: adenosylhomocysteinase 1                332   1e-108   Tarenaya hassleriana [spider flower]
ref|XP_004502244.1|  PREDICTED: adenosylhomocysteinase-like             332   1e-108   Cicer arietinum [garbanzo]
gb|AGX26687.1|  S-adenosyl-l-homocysteine hydrolase A                   332   1e-108   Populus tomentosa [Chinese white poplar]
emb|CDY01177.1|  BnaA04g06420D                                          332   1e-108   
ref|XP_009139575.1|  PREDICTED: adenosylhomocysteinase 1                332   2e-108   Brassica rapa
gb|AIG62190.1|  S-adenosyl-L-homocysteine hydrolase                     332   2e-108   Populus tomentosa [Chinese white poplar]
emb|CDX85127.1|  BnaC07g07790D                                          331   2e-108   
ref|XP_006283635.1|  hypothetical protein CARUB_v10004693mg             332   2e-108   Capsella rubella
gb|AAP92454.1|  S-adenosyl-L-homocystein hydrolase                      331   2e-108   Brassica oleracea var. alboglabra [Chinese broccoli]
gb|AGX26656.1|  S-adenosyl-l-homocysteine hydrolase A                   332   2e-108   Populus tomentosa [Chinese white poplar]
gb|AAX16000.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            332   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006373090.1|  adenosylhomocysteinase family protein              332   2e-108   Populus trichocarpa [western balsam poplar]
ref|XP_002870350.1|  hypothetical protein ARALYDRAFT_915516             331   2e-108   Arabidopsis lyrata subsp. lyrata
gb|AAX15998.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            331   2e-108   Arabidopsis thaliana [mouse-ear cress]
gb|AAX15999.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            331   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193130.1|  adenosylhomocysteinase 1                              331   2e-108   Arabidopsis thaliana [mouse-ear cress]
gb|KFK36278.1|  hypothetical protein AALP_AA4G101800                    331   2e-108   Arabis alpina [alpine rockcress]
gb|AAM62888.1|  adenosylhomocysteinase                                  331   2e-108   Arabidopsis thaliana [mouse-ear cress]
gb|AIG62174.1|  S-adenosyl-L-homocysteine hydrolase                     331   2e-108   Populus tomentosa [Chinese white poplar]
ref|XP_008222808.1|  PREDICTED: adenosylhomocysteinase isoform X2       333   2e-108   
gb|AGX26686.1|  S-adenosyl-l-homocysteine hydrolase A                   331   3e-108   Populus tomentosa [Chinese white poplar]
ref|XP_010527457.1|  PREDICTED: adenosylhomocysteinase 1                331   3e-108   Tarenaya hassleriana [spider flower]
gb|AGX26677.1|  S-adenosyl-l-homocysteine hydrolase A                   331   3e-108   Populus tomentosa [Chinese white poplar]
gb|AGT16642.1|  Adenosylhomocysteinase                                  331   3e-108   Saccharum hybrid cultivar R570
ref|XP_006297468.1|  hypothetical protein CARUB_v10013488mg             332   3e-108   
ref|XP_010908558.1|  PREDICTED: adenosylhomocysteinase                  331   3e-108   
gb|AIG62168.1|  S-adenosyl-L-homocysteine hydrolase                     331   4e-108   Populus tomentosa [Chinese white poplar]
ref|XP_006848518.1|  hypothetical protein AMTR_s00013p00261120          331   4e-108   Amborella trichopoda
ref|XP_002278000.1|  PREDICTED: adenosylhomocysteinase-like             330   4e-108   Vitis vinifera
gb|AIG62186.1|  S-adenosyl-L-homocysteine hydrolase                     330   4e-108   Populus tomentosa [Chinese white poplar]
gb|AGX26671.1|  S-adenosyl-l-homocysteine hydrolase A                   330   4e-108   Populus tomentosa [Chinese white poplar]
gb|AGX26647.1|  S-adenosyl-l-homocysteine hydrolase A                   330   4e-108   Populus tomentosa [Chinese white poplar]
gb|AIG62163.1|  S-adenosyl-L-homocysteine hydrolase                     330   4e-108   Populus tomentosa [Chinese white poplar]
ref|XP_010247578.1|  PREDICTED: adenosylhomocysteinase                  330   4e-108   Nelumbo nucifera [Indian lotus]
gb|AGX26674.1|  S-adenosyl-l-homocysteine hydrolase A                   330   4e-108   Populus tomentosa [Chinese white poplar]
gb|AAL16259.1|AF428329_1  AT3g23810/MYM9_15                             330   5e-108   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26673.1|  S-adenosyl-l-homocysteine hydrolase A                   330   5e-108   Populus tomentosa [Chinese white poplar]
gb|AGX26653.1|  S-adenosyl-l-homocysteine hydrolase A                   330   5e-108   Populus tomentosa [Chinese white poplar]
emb|CDY47309.1|  BnaAnng08830D                                          330   5e-108   Brassica napus [oilseed rape]
ref|XP_004973012.1|  PREDICTED: adenosylhomocysteinase-like             330   5e-108   Setaria italica
gb|AHL20280.1|  S-adenosylhomocysteine hydrolase                        330   5e-108   Kalanchoe daigremontiana
ref|XP_004953493.1|  PREDICTED: adenosylhomocysteinase-like             330   7e-108   Setaria italica
gb|AGX26657.1|  S-adenosyl-l-homocysteine hydrolase A                   330   8e-108   Populus tomentosa [Chinese white poplar]
ref|XP_010551666.1|  PREDICTED: adenosylhomocysteinase 1-like           330   8e-108   Tarenaya hassleriana [spider flower]
emb|CDX77483.1|  BnaA07g06210D                                          329   8e-108   
emb|CDY50423.1|  BnaCnng19320D                                          330   9e-108   Brassica napus [oilseed rape]
gb|AGX26665.1|  S-adenosyl-l-homocysteine hydrolase A                   330   9e-108   Populus tomentosa [Chinese white poplar]
gb|AGX26667.1|  S-adenosyl-l-homocysteine hydrolase A                   330   1e-107   Populus tomentosa [Chinese white poplar]
gb|AGX26662.1|  S-adenosyl-l-homocysteine hydrolase A                   329   1e-107   Populus tomentosa [Chinese white poplar]
sp|P50249.1|SAHH_PHASS  RecName: Full=Adenosylhomocysteinase; Sho...    329   1e-107   Phalaenopsis sp.
ref|XP_006414844.1|  hypothetical protein EUTSA_v10024750mg             332   1e-107   
sp|P50246.1|SAHH_MEDSA  RecName: Full=Adenosylhomocysteinase; Sho...    329   1e-107   Medicago sativa [alfalfa]
emb|CDY58805.1|  BnaC08g46780D                                          329   2e-107   Brassica napus [oilseed rape]
gb|AGX26681.1|  S-adenosyl-l-homocysteine hydrolase A                   329   2e-107   Populus tomentosa [Chinese white poplar]
gb|ACJ11250.1|  S-adenosyl-L-homocystein hydrolase                      329   2e-107   Gossypium hirsutum [American cotton]
emb|CDP15078.1|  unnamed protein product                                329   2e-107   Coffea canephora [robusta coffee]
gb|AIG62170.1|  S-adenosyl-L-homocysteine hydrolase                     329   2e-107   Populus tomentosa [Chinese white poplar]
gb|AAK92718.1|  putative S-adenosyl-L-homocysteinas protein             329   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189023.1|  adenosylhomocysteinase 2                              329   2e-107   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26689.1|  S-adenosyl-l-homocysteine hydrolase A                   328   2e-107   Populus tomentosa [Chinese white poplar]
ref|XP_009107496.1|  PREDICTED: adenosylhomocysteinase 1-like           328   2e-107   Brassica rapa
dbj|BAH19670.1|  AT4G13940                                              323   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102577.1|  PREDICTED: adenosylhomocysteinase 2                328   2e-107   Brassica rapa
ref|NP_001148534.1|  adenosylhomocysteinase                             328   2e-107   
ref|XP_010905139.1|  PREDICTED: adenosylhomocysteinase-like             328   3e-107   Elaeis guineensis
emb|CAJ01707.1|  putative S-adenosylhomocystein hydrolase 2             328   3e-107   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008776857.1|  PREDICTED: adenosylhomocysteinase-like             328   3e-107   Phoenix dactylifera
gb|KFK28004.1|  hypothetical protein AALP_AA8G459100                    328   4e-107   Arabis alpina [alpine rockcress]
gb|AAP92453.1|  S-adenosyl-L-homocystein hydrolase                      328   4e-107   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001234012.1|  adenosylhomocysteinase                             328   4e-107   
gb|AIG62185.1|  S-adenosyl-L-homocysteine hydrolase                     328   5e-107   Populus tomentosa [Chinese white poplar]
ref|XP_002883461.1|  S-adenosyl-L-homocysteine (sah) hydrolase 2        328   5e-107   
dbj|BAP47516.1|  S-adenosylhomocysteine hydrolase                       328   5e-107   Gentiana triflora
gb|ACN34730.1|  unknown                                                 327   7e-107   Zea mays [maize]
ref|XP_006418835.1|  hypothetical protein EUTSA_v10002505mg             327   8e-107   Eutrema salsugineum [saltwater cress]
gb|ABK25129.1|  unknown                                                 327   9e-107   Picea sitchensis
gb|ABI95857.1|  S-adenosyl-homocysteine hydrolase                       327   9e-107   Nicotiana suaveolens
gb|AIG62177.1|  S-adenosyl-L-homocysteine hydrolase                     327   9e-107   Populus tomentosa [Chinese white poplar]
gb|ABK24229.1|  unknown                                                 327   1e-106   Picea sitchensis
gb|AIG62161.1|  S-adenosyl-L-homocysteine hydrolase                     327   1e-106   Populus tomentosa [Chinese white poplar]
ref|XP_008794647.1|  PREDICTED: adenosylhomocysteinase-like             327   1e-106   Phoenix dactylifera
ref|XP_003538528.1|  PREDICTED: adenosylhomocysteinase-like             327   1e-106   Glycine max [soybeans]
gb|AAM19782.1|  AT3g23810/MYM9_15                                       327   2e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009403608.1|  PREDICTED: adenosylhomocysteinase-like             326   2e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008803686.1|  PREDICTED: adenosylhomocysteinase                  326   2e-106   Phoenix dactylifera
gb|KJB28098.1|  hypothetical protein B456_005G027700                    326   2e-106   Gossypium raimondii
ref|XP_003601687.1|  Adenosylhomocysteinase                             326   3e-106   Medicago truncatula
ref|XP_006662925.1|  PREDICTED: adenosylhomocysteinase-like             326   3e-106   Oryza brachyantha
emb|CDY53211.1|  BnaC03g74050D                                          325   3e-106   Brassica napus [oilseed rape]
ref|XP_004296983.1|  PREDICTED: adenosylhomocysteinase                  325   4e-106   Fragaria vesca subsp. vesca
gb|EMT01272.1|  Adenosylhomocysteinase                                  325   4e-106   
ref|XP_010673385.1|  PREDICTED: adenosylhomocysteinase                  325   5e-106   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009415939.1|  PREDICTED: adenosylhomocysteinase                  325   5e-106   Musa acuminata subsp. malaccensis [pisang utan]
sp|Q9SP37.1|SAHH_LUPLU  RecName: Full=Adenosylhomocysteinase; Sho...    325   7e-106   Lupinus luteus
ref|XP_009413566.1|  PREDICTED: adenosylhomocysteinase-like             325   7e-106   Musa acuminata subsp. malaccensis [pisang utan]
pdb|3OND|A  Chain A, Crystal Structure Of Lupinus Luteus S-adenos...    325   8e-106   Lupinus luteus
ref|NP_001265954.1|  adenosylhomocysteinase-like                        324   1e-105   Cicer arietinum [garbanzo]
ref|XP_002987608.1|  hypothetical protein SELMODRAFT_158886             324   1e-105   Selaginella moellendorffii
gb|EPS72602.1|  adenosylhomocysteinase                                  326   2e-105   Genlisea aurea
emb|CCC55421.1|  S-adenosyl-L-homocysteine hydrolase                    323   2e-105   Pinus pinaster [cluster pine]
sp|P32112.1|SAHH_WHEAT  RecName: Full=Adenosylhomocysteinase; Sho...    323   3e-105   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003577583.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    323   4e-105   
ref|XP_008438321.1|  PREDICTED: adenosylhomocysteinase-like             323   5e-105   Cucumis melo [Oriental melon]
emb|CDY50106.1|  BnaC01g43540D                                          323   7e-105   Brassica napus [oilseed rape]
ref|XP_010512939.1|  PREDICTED: adenosylhomocysteinase 2-like           322   7e-105   Camelina sativa [gold-of-pleasure]
gb|KFK39678.1|  hypothetical protein AALP_AA3G275000                    322   8e-105   Arabis alpina [alpine rockcress]
gb|ABR16547.1|  unknown                                                 322   1e-104   Picea sitchensis
gb|ACN40278.1|  unknown                                                 322   1e-104   Picea sitchensis
ref|XP_010488460.1|  PREDICTED: adenosylhomocysteinase 2                322   1e-104   Camelina sativa [gold-of-pleasure]
gb|ABR17322.1|  unknown                                                 322   1e-104   Picea sitchensis
ref|XP_001755906.1|  predicted protein                                  322   1e-104   
gb|ABR16573.1|  unknown                                                 322   1e-104   Picea sitchensis
ref|XP_009106322.1|  PREDICTED: adenosylhomocysteinase 2                322   1e-104   Brassica rapa
ref|XP_001755926.1|  predicted protein                                  321   2e-104   
ref|XP_010466740.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    321   2e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010913095.1|  PREDICTED: adenosylhomocysteinase-like             321   2e-104   Elaeis guineensis
gb|ABR16138.1|  unknown                                                 320   3e-104   Picea sitchensis
ref|XP_001755929.1|  predicted protein                                  317   5e-103   
ref|XP_004133979.1|  PREDICTED: adenosylhomocysteinase-like             317   6e-103   Cucumis sativus [cucumbers]
ref|XP_004166113.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    317   9e-103   
ref|XP_007163813.1|  hypothetical protein PHAVU_001G266500g             316   1e-102   Phaseolus vulgaris [French bean]
gb|AAL33588.1|  S-adenosyl-L-homocysteine hydrolase                     306   7e-102   Zea mays [maize]
gb|AFY99087.1|  S-adenosyl-l-homocysteine hydrolase                     304   1e-101   Campanula persicifolia [peach-bells]
ref|NP_001067845.2|  Os11g0455500                                       315   2e-101   
gb|AFY99082.1|  S-adenosyl-l-homocysteine hydrolase                     303   4e-101   Clermontia kakeana
gb|KJB19538.1|  hypothetical protein B456_003G108500                    309   9e-100   Gossypium raimondii
gb|KHG19993.1|  Adenosylhomocysteinase 1 -like protein                  308   3e-99    Gossypium arboreum [tree cotton]
ref|XP_007037836.1|  S-adenosyl-L-homocysteine hydrolase                308   3e-99    
emb|CAB09795.1|  S-adenosyl-L-homocysteine hydrolase                    305   3e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001756025.1|  predicted protein                                  295   1e-97    
ref|XP_005843353.1|  S-adenosyl-L-homocysteine hydrolase                298   1e-95    Chlorella variabilis
gb|KCW60457.1|  hypothetical protein EUGRSUZ_H03177                     296   5e-95    Eucalyptus grandis [rose gum]
gb|ABA01148.1|  S-adenosyl-L-homocystein hydrolase                      286   6e-94    Chlamydomonas incerta
gb|KCW60456.1|  hypothetical protein EUGRSUZ_H03176                     293   1e-93    Eucalyptus grandis [rose gum]
ref|XP_005643510.1|  S-Adenosyl homocysteine hydrolase                  293   1e-93    Coccomyxa subellipsoidea C-169
gb|ADQ00183.1|  S-adenosyl homocysteine hydrolase                       293   3e-93    Chlamydomonas sp. ICE-L
ref|XP_002950429.1|  hypothetical protein VOLCADRAFT_74602              292   5e-93    Volvox carteri f. nagariensis
ref|XP_001693339.1|  S-Adenosyl homocysteine hydrolase                  290   2e-92    Chlamydomonas reinhardtii
ref|XP_011397211.1|  Adenosylhomocysteinase                             289   3e-91    Auxenochlorella protothecoides
gb|AFY99086.1|  S-adenosyl-l-homocysteine hydrolase                     277   4e-91    Lobelia erinus
dbj|BAA03710.1|  cytokinin binding protein CBP57                        285   5e-91    Nicotiana sylvestris
gb|ABR16332.1|  unknown                                                 286   7e-91    Picea sitchensis
gb|KDD76058.1|  S-adenosyl-L-homocysteine hydrolase                     286   9e-91    Helicosporidium sp. ATCC 50920
gb|ADJ96635.1|  S-adenosyl homocysteine hydrolase                       285   1e-90    Dunaliella salina
gb|KJB72029.1|  hypothetical protein B456_011G154000                    283   8e-90    Gossypium raimondii
gb|KCW60454.1|  hypothetical protein EUGRSUZ_H03173                     280   2e-88    Eucalyptus grandis [rose gum]
gb|KCW60455.1|  hypothetical protein EUGRSUZ_H03174                     278   7e-88    Eucalyptus grandis [rose gum]
gb|KIZ05177.1|  adenosylhomocysteinase                                  290   1e-87    Monoraphidium neglectum
gb|ABG22475.1|  Adenosylhomocysteinase, putative, expressed             274   2e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010024049.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    276   6e-87    Eucalyptus grandis [rose gum]
gb|ABA93500.1|  Adenosylhomocysteinase, putative, expressed             275   1e-86    Oryza sativa Japonica Group [Japonica rice]
emb|CEF99088.1|  S-adenosyl-L-homocysteine hydrolase, conserved site    274   3e-86    Ostreococcus tauri
emb|CBN20774.1|  S-Adenosyl homocysteine hydrolase                      273   6e-86    Polytomella sp. Pringsheim 198.80
ref|XP_001419579.1|  predicted protein                                  272   3e-85    Ostreococcus lucimarinus CCE9901
emb|CAJ01706.1|  S-adenosyl-L-homocysteine hydrolase                    268   3e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABR16616.1|  unknown                                                 266   1e-83    Picea sitchensis
ref|XP_005708566.1|  adenosylhomocysteinase                             266   8e-83    Galdieria sulphuraria
ref|XP_005716982.1|  S-adenosyl-L-homocysteine hydrolase                259   2e-80    
ref|XP_003057172.1|  adenosylhomocysteinase                             258   5e-80    
ref|XP_002505983.1|  adenosylhomocysteinase                             258   5e-80    
ref|XP_008881882.1|  adenosylhomocysteinase, putative                   254   9e-79    
ref|XP_002366178.1|  adenosylhomocysteinase, putative                   254   1e-78    
gb|EPT27008.1|  adenosylhomocysteinase, putative                        255   8e-78    
gb|EPR62066.1|  putative adenosylhomocysteinase                         255   9e-78    
gb|KFH13893.1|  putative adenosylhomocysteinase                         255   1e-77    
gb|KFG55060.1|  putative adenosylhomocysteinase                         255   1e-77    
gb|KFG42936.1|  putative adenosylhomocysteinase                         255   1e-77    
gb|ESS32583.1|  putative adenosylhomocysteinase                         255   1e-77    
ref|XP_008611237.1|  adenosylhomocysteinase                             251   3e-77    
ref|XP_005830876.1|  hypothetical protein GUITHDRAFT_110013             251   3e-77    
ref|XP_003884366.1|  hypothetical protein NCLIV_047660                  249   8e-77    
ref|XP_002177758.1|  adenosylhomocysteinase                             248   6e-76    
ref|XP_002776364.1|  adenosylhomocysteinase, putative                   239   8e-76    
ref|XP_008872075.1|  adenosylhomocysteinase 2                           245   5e-75    
ref|XP_007510486.1|  S-adenosyl-L-homocysteine hydrolase                247   8e-75    
ref|XP_005790915.1|  S-adenosyl-L-homocysteine hydrolase                244   1e-74    
ref|XP_009531393.1|  hypothetical protein PHYSODRAFT_347096             243   4e-74    
ref|XP_008893590.1|  adenosylhomocysteinase                             243   5e-74    
ref|XP_002788757.1|  conserved hypothetical protein                     241   1e-73    
ref|XP_009833581.1|  adenosylhomocysteinase 2                           241   1e-73    
emb|CCA20123.1|  unnamed protein product                                241   2e-73    
ref|XP_009493630.1|  adenosylhomocysteinase 1                           240   3e-73    
ref|XP_009033133.1|  hypothetical protein AURANDRAFT_69644              240   4e-73    
ref|XP_002765933.1|  conserved hypothetical protein                     236   1e-71    
ref|WP_020576907.1|  S-adenosyl-L-homocysteine hydrolase                236   1e-71    
emb|CCI50303.1|  unnamed protein product                                236   2e-71    
ref|XP_002902721.1|  adenosylhomocysteinase                             235   3e-71    
gb|EJK60373.1|  hypothetical protein THAOC_19286                        226   4e-71    
ref|XP_005786995.1|  S-adenosyl-L-homocysteine hydrolase                234   5e-71    
gb|EWM21100.1|  s-adenosyl homocysteine hydrolase                       237   8e-71    
emb|CDI83949.1|  adenosylhomocysteinase, putative                       226   2e-70    
ref|WP_037787267.1|  hypothetical protein                               226   2e-70    
ref|XP_002290951.1|  hypothetical protein THAPSDRAFT_28496              230   4e-69    
ref|WP_023410675.1|  S-adenosyl-L-homocysteine hydrolase                229   8e-69    
ref|WP_030289952.1|  MULTISPECIES: hypothetical protein                 228   2e-68    
gb|ACJ13434.1|  adenosylhomocysteinase                                  221   2e-68    
ref|XP_001423621.1|  hypothetical protein                               228   3e-68    
ref|WP_030724358.1|  adenosylhomocysteinase                             220   3e-68    
ref|WP_030260730.1|  MULTISPECIES: hypothetical protein                 228   3e-68    
ref|WP_017625947.1|  S-adenosyl-L-homocysteine hydrolase                227   4e-68    
ref|WP_031077053.1|  hypothetical protein                               227   5e-68    
ref|WP_017595102.1|  S-adenosyl-L-homocysteine hydrolase                227   6e-68    
ref|XP_005535237.1|  S-adenosyl-L-homocysteine hydrolase                227   8e-68    
ref|WP_033354750.1|  hypothetical protein                               226   1e-67    
ref|WP_014804737.1|  S-adenosyl-L-homocysteine hydrolase                226   2e-67    
ref|WP_030398087.1|  MULTISPECIES: hypothetical protein                 226   2e-67    
ref|WP_005221374.1|  S-adenosyl-L-homocysteine hydrolase                225   2e-67    
ref|WP_030245490.1|  hypothetical protein                               225   3e-67    
ref|WP_011292928.1|  S-adenosyl-L-homocysteine hydrolase                225   3e-67    
ref|WP_014911909.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    224   4e-67    
ref|WP_028072996.1|  hypothetical protein                               219   6e-67    
gb|KJB72027.1|  hypothetical protein B456_011G154000                    223   6e-67    
ref|WP_029018156.1|  hypothetical protein                               224   7e-67    
ref|WP_017583238.1|  S-adenosyl-L-homocysteine hydrolase                224   9e-67    
ref|WP_017613514.1|  S-adenosyl-L-homocysteine hydrolase                224   9e-67    
ref|WP_017542451.1|  S-adenosyl-L-homocysteine hydrolase                223   1e-66    
ref|WP_037796630.1|  adenosylhomocysteinase                             223   1e-66    
ref|WP_030310801.1|  hypothetical protein                               223   1e-66    
ref|WP_028648434.1|  S-adenosyl-L-homocysteine hydrolase                223   2e-66    
ref|WP_028061676.1|  hypothetical protein                               223   2e-66    
ref|WP_042432571.1|  adenosylhomocysteinase                             223   2e-66    
ref|WP_035863223.1|  S-adenosyl-L-homocysteine hydrolase                223   2e-66    
ref|WP_043914237.1|  S-adenosyl-L-homocysteine hydrolase                223   2e-66    
ref|WP_007192127.1|  S-adenosyl-L-homocysteine hydrolase                222   3e-66    
ref|WP_020389898.1|  S-adenosyl-L-homocysteine hydrolase                222   3e-66    
ref|WP_017604622.1|  S-adenosyl-L-homocysteine hydrolase                222   3e-66    
ref|WP_035848617.1|  hypothetical protein                               222   3e-66    
ref|WP_030634444.1|  adenosylhomocysteinase                             214   3e-66    
ref|WP_030264019.1|  hypothetical protein                               222   4e-66    
ref|WP_035801129.1|  hypothetical protein                               222   5e-66    
ref|WP_030634534.1|  adenosylhomocysteinase                             213   6e-66    
ref|WP_027357796.1|  adenosylhomocysteinase                             221   6e-66    
ref|WP_017596835.1|  S-adenosyl-L-homocysteine hydrolase                221   7e-66    
ref|WP_034088535.1|  hypothetical protein                               221   7e-66    
ref|WP_012935821.1|  S-adenosyl-L-homocysteine hydrolase                221   1e-65    
ref|WP_033218411.1|  S-adenosyl-L-homocysteine hydrolase                221   1e-65    
emb|CDW86895.1|  s-adenosyl-l-homocysteine hydrolase                    221   1e-65    
ref|WP_017608316.1|  S-adenosyl-L-homocysteine hydrolase                220   2e-65    
ref|WP_014142777.1|  S-adenosyl-L-homocysteine hydrolase                220   2e-65    
ref|WP_033342518.1|  hypothetical protein                               220   2e-65    
ref|WP_042410976.1|  hypothetical protein                               220   2e-65    
ref|WP_033255593.1|  S-adenosyl-L-homocysteine hydrolase                220   3e-65    
emb|CBJ28078.1|  S-Adenosyl homocysteine hydrolase                      220   3e-65    
ref|WP_030119663.1|  adenosylhomocysteinase                             213   3e-65    
ref|WP_038287745.1|  hypothetical protein                               220   3e-65    
ref|WP_030759761.1|  adenosylhomocysteinase                             213   3e-65    
ref|WP_017538521.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    219   3e-65    
ref|WP_030920540.1|  S-adenosyl-L-homocysteine hydrolase                219   4e-65    
ref|WP_014136057.1|  S-adenosyl-L-homocysteine hydrolase                219   4e-65    
ref|WP_030461911.1|  S-adenosyl-L-homocysteine hydrolase                219   4e-65    
ref|WP_009148000.1|  S-adenosyl-L-homocysteine hydrolase                219   4e-65    
ref|WP_028062632.1|  hypothetical protein                               219   4e-65    
ref|WP_030221563.1|  adenosylhomocysteinase                             219   5e-65    
ref|WP_019711661.1|  S-adenosyl-L-homocysteine hydrolase                219   6e-65    
ref|WP_004953444.1|  S-adenosyl-L-homocysteine hydrolase                219   6e-65    
ref|WP_020252885.1|  hypothetical protein                               219   6e-65    
ref|WP_015281066.1|  adenosylhomocysteinase                             218   6e-65    
ref|WP_020251800.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    218   7e-65    
ref|WP_043962062.1|  adenosylhomocysteinase                             219   7e-65    
ref|WP_014779838.1|  S-adenosyl-L-homocysteine hydrolase                218   7e-65    
ref|WP_037575816.1|  hypothetical protein                               219   8e-65    
ref|WP_017570953.1|  S-adenosyl-L-homocysteine hydrolase                218   8e-65    
ref|WP_033824956.1|  hypothetical protein                               219   8e-65    
ref|WP_028072995.1|  hypothetical protein                               214   1e-64    
ref|WP_037775629.1|  adenosylhomocysteinase                             218   1e-64    
ref|WP_042456565.1|  hypothetical protein                               218   1e-64    
ref|WP_017585142.1|  S-adenosyl-L-homocysteine hydrolase                218   1e-64    
gb|ADE22275.1|  putative adenosylhomocysteinase                         218   1e-64    
gb|EDY66712.2|  adenosylhomocysteinase                                  218   1e-64    
ref|WP_012919256.1|  S-adenosyl-L-homocysteine hydrolase                218   1e-64    
ref|WP_007074914.1|  S-adenosyl-L-homocysteine hydrolase                218   1e-64    
ref|WP_017618754.1|  S-adenosyl-L-homocysteine hydrolase                218   1e-64    
ref|WP_037837039.1|  adenosylhomocysteinase                             211   2e-64    
ref|WP_026206556.1|  adenosylhomocysteinase                             218   2e-64    
ref|WP_037840693.1|  adenosylhomocysteinase                             211   2e-64    
ref|WP_030716579.1|  adenosylhomocysteinase                             211   2e-64    
ref|WP_039960509.1|  adenosylhomocysteinase                             213   2e-64    
ref|WP_031147523.1|  adenosylhomocysteinase                             211   2e-64    
ref|WP_037605447.1|  hypothetical protein                               218   2e-64    
ref|WP_037910293.1|  adenosylhomocysteinase                             218   2e-64    
ref|WP_042387828.1|  hypothetical protein                               217   3e-64    
ref|WP_027734715.1|  adenosylhomocysteinase                             217   3e-64    
ref|WP_017945881.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    217   3e-64    
ref|WP_006348984.1|  S-adenosyl-L-homocysteine hydrolase                217   3e-64    
ref|WP_017575237.1|  S-adenosyl-L-homocysteine hydrolase                217   3e-64    
ref|WP_031509769.1|  adenosylhomocysteinase                             217   4e-64    
ref|WP_012936074.1|  S-adenosyl-L-homocysteine hydrolase                217   4e-64    
ref|WP_030122306.1|  adenosylhomocysteinase                             209   5e-64    
gb|EJY87176.1|  Adenosylhomocysteinase                                  216   6e-64    
ref|WP_018846770.1|  S-adenosyl-L-homocysteine hydrolase                216   7e-64    
ref|WP_031943710.1|  S-adenosyl-L-homocysteine hydrolase                216   8e-64    
ref|WP_030543976.1|  adenosylhomocysteinase                             216   8e-64    
ref|WP_009717416.1|  S-adenosyl-L-homocysteine hydrolase                216   9e-64    
ref|XP_002784976.1|  adenosylhomocysteinase, putative                   206   9e-64    
ref|WP_020506665.1|  S-adenosyl-L-homocysteine hydrolase                216   9e-64    
ref|WP_030889521.1|  MULTISPECIES: adenosylhomocysteinase               216   9e-64    
ref|WP_018386384.1|  S-adenosyl-L-homocysteine hydrolase                216   9e-64    
ref|WP_028810729.1|  adenosylhomocysteinase                             216   1e-63    
ref|WP_042802104.1|  adenosylhomocysteinase                             215   1e-63    
gb|EFL18396.1|  adenosylhomocysteinase                                  216   1e-63    
ref|WP_043108500.1|  adenosylhomocysteinase                             215   1e-63    
ref|WP_030350966.1|  adenosylhomocysteinase                             216   1e-63    
ref|WP_030979035.1|  adenosylhomocysteinase                             208   1e-63    
ref|WP_030231660.1|  adenosylhomocysteinase                             209   1e-63    
ref|WP_030155670.1|  hypothetical protein                               215   1e-63    
ref|WP_040272134.1|  hypothetical protein                               215   2e-63    
ref|WP_038284612.1|  hypothetical protein                               215   2e-63    
ref|WP_007041769.1|  S-adenosyl-L-homocysteine hydrolase                215   2e-63    
ref|WP_014440987.1|  S-adenosyl-L-homocysteine hydrolase                215   2e-63    
ref|WP_031063941.1|  adenosylhomocysteinase                             208   2e-63    
ref|WP_030390893.1|  adenosylhomocysteinase                             213   2e-63    
ref|WP_006134655.1|  S-adenosyl-L-homocysteine hydrolase                207   2e-63    
ref|WP_030742429.1|  adenosylhomocysteinase                             215   2e-63    
ref|WP_030723207.1|  adenosylhomocysteinase                             215   2e-63    
ref|WP_030802969.1|  MULTISPECIES: adenosylhomocysteinase               215   3e-63    
ref|WP_017564266.1|  S-adenosyl-L-homocysteine hydrolase                214   3e-63    
ref|WP_042186348.1|  adenosylhomocysteinase                             214   3e-63    
ref|WP_031147752.1|  adenosylhomocysteinase                             207   3e-63    
ref|WP_038286492.1|  hypothetical protein                               214   3e-63    
ref|WP_015796151.1|  S-adenosyl-L-homocysteine hydrolase                214   3e-63    
ref|WP_024494417.1|  adenosylhomocysteinase                             210   3e-63    
ref|WP_028429456.1|  adenosylhomocysteinase                             214   3e-63    
ref|WP_031015775.1|  adenosylhomocysteinase                             211   4e-63    
ref|WP_030276178.1|  hypothetical protein                               214   4e-63    
ref|WP_014155919.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    214   5e-63    
ref|WP_035857732.1|  hypothetical protein                               214   5e-63    
ref|WP_030998790.1|  adenosylhomocysteinase                             214   5e-63    
ref|WP_044347377.1|  adenosylhomocysteinase                             214   5e-63    
ref|WP_030735559.1|  adenosylhomocysteinase                             214   6e-63    
ref|WP_030891029.1|  adenosylhomocysteinase                             214   6e-63    
ref|WP_007822968.1|  S-adenosyl-L-homocysteine hydrolase                214   6e-63    
ref|WP_009068214.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    214   6e-63    
ref|WP_030365247.1|  adenosylhomocysteinase                             214   6e-63    
ref|WP_032784234.1|  adenosylhomocysteinase                             214   6e-63    
ref|WP_032769603.1|  adenosylhomocysteinase                             214   6e-63    
ref|WP_031126383.1|  adenosylhomocysteinase                             214   7e-63    
ref|WP_008746056.1|  S-adenosyl-L-homocysteine hydrolase                214   7e-63    
ref|WP_013731725.1|  S-adenosyl-L-homocysteine hydrolase                214   7e-63    
ref|WP_015608928.1|  MULTISPECIES: SAHH Adenosylhomocysteinase          213   8e-63    
ref|WP_032787207.1|  adenosylhomocysteinase                             213   8e-63    
ref|WP_020963739.1|  hypothetical protein                               205   8e-63    
ref|WP_043752821.1|  adenosylhomocysteinase                             213   8e-63    
ref|WP_028417695.1|  adenosylhomocysteinase                             213   8e-63    
ref|WP_018492922.1|  S-adenosyl-L-homocysteine hydrolase                213   9e-63    
ref|WP_031093876.1|  adenosylhomocysteinase                             213   9e-63    
ref|WP_007460887.1|  S-adenosyl-L-homocysteine hydrolase                213   9e-63    
ref|WP_030595575.1|  adenosylhomocysteinase                             213   9e-63    
gb|KIZ22480.1|  adenosylhomocysteinase                                  213   1e-62    
ref|WP_003968738.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    213   1e-62    
ref|WP_019763336.1|  S-adenosyl-L-homocysteine hydrolase                213   1e-62    
ref|WP_006474824.1|  S-adenosyl-L-homocysteine hydrolase                213   1e-62    
ref|WP_030977071.1|  adenosylhomocysteinase                             213   1e-62    
ref|WP_030927023.1|  adenosylhomocysteinase                             213   1e-62    
ref|WP_030694652.1|  adenosylhomocysteinase                             210   1e-62    
ref|WP_030266050.1|  adenosylhomocysteinase                             206   1e-62    
ref|WP_019546896.1|  S-adenosyl-L-homocysteine hydrolase                213   1e-62    
ref|WP_030199703.1|  MULTISPECIES: adenosylhomocysteinase               213   1e-62    
ref|WP_018961954.1|  S-adenosyl-L-homocysteine hydrolase                213   1e-62    
ref|WP_016910634.1|  S-adenosyl-L-homocysteine hydrolase                213   1e-62    
ref|WP_030337328.1|  adenosylhomocysteinase                             213   1e-62    
ref|WP_029384937.1|  MULTISPECIES: adenosylhomocysteinase               213   1e-62    
ref|WP_030497957.1|  adenosylhomocysteinase                             211   1e-62    
ref|WP_006125011.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    213   1e-62    
ref|WP_030724754.1|  adenosylhomocysteinase                             213   1e-62    
ref|WP_018552942.1|  S-adenosyl-L-homocysteine hydrolase                211   1e-62    
ref|WP_023417428.1|  S-adenosyl-L-homocysteine hydrolase                213   1e-62    
ref|WP_030593735.1|  adenosylhomocysteinase                             213   1e-62    
ref|WP_030010948.1|  adenosylhomocysteinase                             213   2e-62    
ref|WP_013154760.1|  S-adenosyl-L-homocysteine hydrolase                213   2e-62    
ref|WP_030700076.1|  adenosylhomocysteinase                             213   2e-62    
ref|WP_010059945.1|  S-adenosyl-L-homocysteine hydrolase                213   2e-62    
ref|WP_041129509.1|  adenosylhomocysteinase                             213   2e-62    
ref|WP_019608106.1|  S-adenosyl-L-homocysteine hydrolase                213   2e-62    
gb|ACJ22539.1|  S-adenosylhomocysteinase                                205   2e-62    
ref|WP_030572588.1|  adenosylhomocysteinase                             213   2e-62    
ref|WP_013421278.1|  S-adenosyl-L-homocysteine hydrolase                213   2e-62    
ref|WP_023421854.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    213   2e-62    
ref|WP_030326708.1|  adenosylhomocysteinase                             212   2e-62    



>gb|AAF19001.1|AF212157_1 S-adenosylhomocysteine hydrolase [Allium cepa]
Length=312

 Score =   341 bits (874),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 178/185 (96%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLELELAEV+MPGLMACR EFGPSQPFKGARITGSL MT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVDMPGLMACRTEFGPSQPFKGARITGSLLMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEY KNGT+PDPSSTDNAEFQIVLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGTLPDPSSTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKVDP  189



>ref|XP_010253338.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   345 bits (886),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 177/185 (96%), Positives = 182/185 (98%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK G +PDPSSTDNAEFQIVLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKTGKLPDPSSTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LKADP
Sbjct  185  LKADP  189



>ref|XP_010268032.1| PREDICTED: adenosylhomocysteinase-like [Nelumbo nucifera]
Length=485

 Score =   345 bits (885),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 177/185 (96%), Positives = 183/185 (99%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDISQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK G +PDPSSTDNAEFQIVLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKTGKLPDPSSTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LKADP
Sbjct  185  LKADP  189



>ref|XP_009787091.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana sylvestris]
Length=485

 Score =   342 bits (876),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 175/185 (95%), Positives = 182/185 (98%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDPSSTDNAEFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>sp|P35007.1|SAHH_CATRO RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
 emb|CAA81527.1| S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
Length=485

 Score =   341 bits (874),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 175/185 (95%), Positives = 182/185 (98%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQ+HAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQEHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY KNG +PDPSSTDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKNGALPDPSSTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AFK08605.1| S-adenosyl homocysteine hydrolase [Nicotiana benthamiana]
Length=485

 Score =   341 bits (874),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 182/185 (98%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGT+PDP+STDNAEFQ+VLTII++ 
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTIPDPNSTDNAEFQLVLTIIKES  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AAV31754.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   341 bits (874),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 182/185 (98%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGT+PDP+STDNAEFQ+VLTII++ 
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTIPDPNSTDNAEFQLVLTIIKES  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|EYU32710.1| hypothetical protein MIMGU_mgv1a003606mg [Erythranthe guttata]
Length=574

 Score =   343 bits (881),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 177/185 (96%), Positives = 182/185 (98%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  94   VEKTTSGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  153

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  154  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  213

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ KNGTVPDP+STDNAEFQIVLTIIRDG
Sbjct  214  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKNGTVPDPNSTDNAEFQIVLTIIRDG  273

Query  589  LKADP  603
            LK DP
Sbjct  274  LKTDP  278



>ref|XP_002266154.1| PREDICTED: adenosylhomocysteinase [Vitis vinifera]
 emb|CAN64242.1| hypothetical protein VITISV_022595 [Vitis vinifera]
Length=485

 Score =   340 bits (873),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 175/185 (95%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP QPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPQQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDPSSTDNAEFQIVLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_011102056.1| PREDICTED: adenosylhomocysteinase [Sesamum indicum]
Length=485

 Score =   340 bits (873),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 175/186 (94%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHM
Sbjct  4    VVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDPSSTDNAEFQIVLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTIIRD  183

Query  586  GLKADP  603
            GLKADP
Sbjct  184  GLKADP  189



>ref|XP_009606591.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=485

 Score =   340 bits (872),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDPSSTDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|EYU31514.1| hypothetical protein MIMGU_mgv1a005403mg [Erythranthe guttata]
Length=485

 Score =   340 bits (872),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
             VEKT+SGREYKVKDMSQADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    VVEKTTSGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDPSSTDNAEFQIVLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPSSTDNAEFQIVLTIIRD  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKEDP  189



>dbj|BAP47515.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   339 bits (870),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTNSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDPSSTDNAEFQ+VLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFKKSGKLPDPSSTDNAEFQLVLTIIRD  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKTDP  189



>ref|NP_001289538.1| adenosylhomocysteinase [Nicotiana sylvestris]
 ref|XP_009622119.1| PREDICTED: adenosylhomocysteinase [Nicotiana tomentosiformis]
 ref|XP_009800926.1| PREDICTED: adenosylhomocysteinase [Nicotiana sylvestris]
 sp|P68172.1|SAHH_NICSY RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana sylvestris]
 sp|P68173.1|SAHH_TOBAC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana tabacum]
 dbj|BAA03709.1| S-adenosyl-L-homocystein hydrolase [Nicotiana sylvestris]
 dbj|BAA08142.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 dbj|BAA23164.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 gb|AAV31756.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   339 bits (870),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 182/185 (98%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGT+PDP+STDNAEFQ+VLTII++ 
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTIIKES  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>emb|CDP11183.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   339 bits (870),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 182/185 (98%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CRAEFGP+QPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPTQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYKKSGKLPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_008380474.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK+GT+PDPSSTDN EFQ+VLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKSGTLPDPSSTDNQEFQLVLTIIRD  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKTDP  189



>ref|XP_009373550.1| PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri]
Length=485

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK+GT+PDPSSTDN EFQ+VLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKSGTLPDPSSTDNQEFQLVLTIIRD  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKTDP  189



>ref|XP_010052042.1| PREDICTED: adenosylhomocysteinase 1 [Eucalyptus grandis]
 gb|KCW75898.1| hypothetical protein EUGRSUZ_D00281 [Eucalyptus grandis]
Length=485

 Score =   337 bits (865),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAE+GP+QPFKGARITGSLHMT
Sbjct  5    VEKTAGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEYGPAQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAATARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K G VPDP+STDNAEFQIVLTII+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKVPDPASTDNAEFQIVLTIIKDG  184

Query  589  LKADP  603
            LKADP
Sbjct  185  LKADP  189



>ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 ref|XP_004162424.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN61486.1| hypothetical protein Csa_2G140370 [Cucumis sativus]
Length=485

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGALPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>ref|XP_008457223.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis melo]
Length=485

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGALPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis]
 gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis]
Length=485

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGQVPDPTSTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|EYU31513.1| hypothetical protein MIMGU_mgv1a004058mg [Erythranthe guttata]
Length=547

 Score =   339 bits (869),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDM+QADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  67   VEKTTSGREYKVKDMTQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  126

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  127  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  186

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K G +PDPSSTDNAEFQIVLTIIRDG
Sbjct  187  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKLPDPSSTDNAEFQIVLTIIRDG  246

Query  589  LKADP  603
            LK DP
Sbjct  247  LKTDP  251



>ref|XP_009349913.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=485

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+GT+PDPSSTDN EFQ+VLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGTLPDPSSTDNQEFQLVLTIIRD  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKTDP  189



>ref|XP_004252985.1| PREDICTED: adenosylhomocysteinase-like [Solanum lycopersicum]
Length=485

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAATARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK G  PDP+STDN EFQ+VLTII+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKTGKFPDPNSTDNVEFQLVLTIIKDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|KDO43195.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=445

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEK++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRD  183

Query  586  GLKADP  603
            GLKADP
Sbjct  184  GLKADP  189



>ref|XP_006349914.1| PREDICTED: adenosylhomocysteinase-like [Solanum tuberosum]
Length=485

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAATARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK G  PDP STDN EFQ+VLTII+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKTGKFPDPHSTDNVEFQLVLTIIKDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>ref|XP_004247887.1| PREDICTED: adenosylhomocysteinase [Solanum lycopersicum]
Length=485

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA RAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGT+PDPSSTDN EFQ+VLTII++ 
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPSSTDNVEFQLVLTIIKES  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AAV31755.1| S-adenosyl-L-homocysteine hydrolase, partial [Nicotiana tabacum]
Length=479

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/183 (94%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = +1

Query  55   KTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQ  234
            KT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMTIQ
Sbjct  1    KTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQ  60

Query  235  TAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALD  414
            TAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALD
Sbjct  61   TAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALD  120

Query  415  WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLK  594
            WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDPSSTDN EFQ+VLTIIRDGLK
Sbjct  121  WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNVEFQLVLTIIRDGLK  180

Query  595  ADP  603
             DP
Sbjct  181  TDP  183



>gb|AFU51537.1| S-adenosyl-homocysteine hydrolase protein [Capsicum annuum]
Length=485

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGTVPDPSSTDN EFQ+VL II++ 
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTVPDPSSTDNVEFQLVLGIIKES  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKVDP  189



>gb|KJB37872.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=446

 Score =   335 bits (859),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRD
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVLTIIRD  183

Query  586  GLKADP  603
            GLKADP
Sbjct  184  GLKADP  189



>gb|KJB72028.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=487

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTIIRD
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPSSTDNAEFQIVLTIIRD  183

Query  586  GLKADP  603
            GLKADP
Sbjct  184  GLKADP  189



>ref|XP_010097949.1| hypothetical protein L484_026840 [Morus notabilis]
 gb|EXB73679.1| hypothetical protein L484_026840 [Morus notabilis]
Length=485

 Score =   336 bits (862),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRD  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKTDP  189



>gb|KHG17040.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=485

 Score =   336 bits (862),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTIIRD
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPSSTDNAEFQIVLTIIRD  183

Query  586  GLKADP  603
            GLKADP
Sbjct  184  GLKADP  189



>gb|KJB72024.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=485

 Score =   336 bits (862),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTIIRD
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPSSTDNAEFQIVLTIIRD  183

Query  586  GLKADP  603
            GLKADP
Sbjct  184  GLKADP  189



>ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGELPDPNSTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGELPDPNSTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AEI54335.1| adenosylhomocysteinase [Glycine max]
Length=485

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGELPDPNSTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|KDO43194.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=485

 Score =   335 bits (860),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEK++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRD  183

Query  586  GLKADP  603
            GLKADP
Sbjct  184  GLKADP  189



>ref|XP_006492541.1| PREDICTED: adenosylhomocysteinase-like [Citrus sinensis]
Length=485

 Score =   335 bits (860),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEK++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRD  183

Query  586  GLKADP  603
            GLKADP
Sbjct  184  GLKADP  189



>gb|KCW59952.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=467

 Score =   335 bits (858),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G +PDP+STDNAEFQ+VLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGKLPDPASTDNAEFQLVLTIIRD  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKTDP  189



>ref|XP_006360925.1| PREDICTED: adenosylhomocysteinase-like isoform X1 [Solanum tuberosum]
Length=485

 Score =   335 bits (860),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA RAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGT+PDP+STDN EFQ+VLTII++ 
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPTSTDNVEFQLVLTIIKES  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_010023650.1| PREDICTED: adenosylhomocysteinase [Eucalyptus grandis]
 gb|KCW59953.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=485

 Score =   335 bits (859),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G +PDP+STDNAEFQ+VLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGKLPDPASTDNAEFQLVLTIIRD  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKTDP  189



>ref|XP_011012490.1| PREDICTED: adenosylhomocysteinase-like [Populus euphratica]
Length=485

 Score =   335 bits (859),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AIG62154.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   335 bits (859),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AIG62191.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   335 bits (858),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AIG62160.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62162.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62167.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62172.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62183.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   335 bits (858),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AIG62165.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   335 bits (858),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AIG62181.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AIG62184.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AIG62157.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AIG62178.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AIG62166.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AIG62164.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62189.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AIG62156.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_008361486.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPLKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+GT+PDPSSTDN EFQ+VLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGTLPDPSSTDNQEFQLVLTIIRD  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKTDP  189



>sp|Q01781.2|SAHH_PETCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Petroselinum crispum]
 gb|AAA33856.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=485

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT++GREYKVKDMS ADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQT VLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS AVFAWKGETLQEYWWCTER
Sbjct  64   TIQTGVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSCAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVL+IIRD
Sbjct  124  ALDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKSGAIPDPASTDNAEFQIVLSIIRD  183

Query  586  GLKADP  603
            GLK+DP
Sbjct  184  GLKSDP  189



>ref|XP_003629610.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89237.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AET04086.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            TVEKT +GREYKV+D+SQADFGRLE+ELAE+EMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    TVEKTQAGREYKVRDLSQADFGRLEIELAEIEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPSSTDNAEFQ+VLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGEVPDPSSTDNAEFQLVLTIIRD  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKTDP  189



>gb|AAP92452.1| S-adenosyl-L-homocystein hydrolase [Petunia x hybrida]
Length=485

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+GTVPDP+STDN EFQ+VL II++ 
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKDGTVPDPTSTDNVEFQLVLGIIKES  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_011102207.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFG SQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGASQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKMPDPTSTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKVDP  189



>ref|XP_006421018.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
 gb|ESR34258.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
Length=485

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +V+K++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRD  183

Query  586  GLKADP  603
            GLKADP
Sbjct  184  GLKADP  189



>ref|XP_011003627.1| PREDICTED: adenosylhomocysteinase [Populus euphratica]
Length=485

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|ABB55380.1| S-adenosyl-L-homocysteine hydrolase-like [Solanum tuberosum]
Length=484

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGT+PDP+STDN EFQ+VLTII++ 
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPTSTDNVEFQLVLTIIKES  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_011083449.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFG SQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGASQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKMPDPTSTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKVDP  189



>gb|KDP39327.1| hypothetical protein JCGZ_01084 [Jatropha curcas]
Length=485

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
             VEKT+ GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAE+GPSQPFKGA+ITGSLHM
Sbjct  4    VVEKTTGGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEYGPSQPFKGAKITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGQLPDPSSTDNAEFQIVLTIIRD  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKTDP  189



>sp|P93253.1|SAHH_MESCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Mesembryanthemum 
crystallinum]
 gb|AAB38499.1| S-adenosyl-L-homocystein hydrolase [Mesembryanthemum crystallinum]
Length=485

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWG GGGPDLIVDDGGDATLLIHEGVKAEEEY KNGT+PDP+STDN EFQ+VL +IRD 
Sbjct  125  LDWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGTIPDPTSTDNPEFQLVLGLIRDS  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKVDP  189



>gb|KCW59951.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=517

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G +PDP+STDNAEFQ+VLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGKLPDPASTDNAEFQLVLTIIRD  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKTDP  189



>gb|AIG62149.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|NP_001078387.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83348.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=325

 Score =   328 bits (841),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>gb|AGX26655.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AGX26683.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AGX26652.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AGX26650.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AGX26646.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26648.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26658.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26659.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26668.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26670.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26675.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26680.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26688.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AGX26651.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AIG62171.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AIG62150.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62153.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_008222807.1| PREDICTED: adenosylhomocysteinase isoform X1 [Prunus mume]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKLPDPASTDNQEFQLVLTIIRD  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKTDP  189



>gb|AGX26663.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>ref|XP_007222610.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
 gb|EMJ23809.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKLPDPASTDNQEFQLVLTIIRD  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKTDP  189



>gb|AGX26685.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AGX26672.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AGX26669.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AIG62179.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_007153624.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
 gb|ESW25618.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT++GREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP+STDNAEFQIVLTII+D
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEELFEKTGELPDPTSTDNAEFQIVLTIIKD  183

Query  586  GLKADP  603
            GLK+DP
Sbjct  184  GLKSDP  189



>gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AGX26645.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AIG62173.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AGX26666.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AIG62159.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AGX26664.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AIG62155.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AGX26684.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AIG62169.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AIG62188.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AGX26682.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AGX26678.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AGX26661.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AFW60834.1| adenosyl homocysteine hydrolase1 [Zea mays]
Length=259

 Score =   325 bits (834),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
             LDWG  GGPDLIVDDGGDATLLIHEGVKAEE+Y K G +PDP STDNAEF+IVLTIIRD
Sbjct  124  CLDWGEAGGPDLIVDDGGDATLLIHEGVKAEEDYEKTGKIPDPESTDNAEFKIVLTIIRD  183

Query  586  GLKADP  603
            GLKADP
Sbjct  184  GLKADP  189



>gb|AGW81844.1| S-(5'-adenosyl)-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26660.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AIG62187.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AIG62158.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|KJB37873.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=485

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRD
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVLTIIRD  183

Query  586  GLKADP  603
            GLKADP
Sbjct  184  GLKADP  189



>gb|AIG62148.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62175.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62192.1| S-adenosyl-L-homocysteine hydrolase [Populus alba x Populus glandulosa]
Length=485

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AER92590.1| putative S-adenosyl-L-homocysteinase [Linum usitatissimum]
Length=561

 Score =   335 bits (860),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            V+KT++GREYKVKDMSQADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  81   VDKTTTGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  140

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  141  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  200

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVLTIIRDG
Sbjct  201  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKIPDPASTDNAEFQIVLTIIRDG  260

Query  589  LKADP  603
            LK DP
Sbjct  261  LKTDP  265



>gb|ADR30776.1| S-adenosyl-L-homocysteine hydrolase [Cucumis sativus]
Length=485

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT++GRE KVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTAAGRENKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGALPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AIG62180.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|KHG10896.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRD
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVLTIIRD  183

Query  586  GLKADP  603
            GLKADP
Sbjct  184  GLKADP  189



>gb|AIG62152.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEVELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AIG62151.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKV+DMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVEDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_002300147.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|EEE84952.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G  PDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGASPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AGX26679.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (853),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLL+HEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLVHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AGX26676.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   333 bits (853),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            +QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   VQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>dbj|BAE71233.1| putative adenosylhomocysteinase [Trifolium pratense]
 dbj|BAE71257.1| putative adenosylhomocysteinase [Trifolium pratense]
Length=485

 Score =   333 bits (853),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            TVEKT++GREYKVKD+SQADFGRLE+ELAE+EMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    TVEKTTAGREYKVKDLSQADFGRLEIELAEIEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPSSTDN EFQ+VLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGEVPDPSSTDNVEFQLVLTIIRD  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKTDP  189



>ref|XP_007034216.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY05142.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=510

 Score =   333 bits (855),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKAD  600
            LK D
Sbjct  185  LKTD  188



>gb|AIG62182.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   333 bits (853),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDL VDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLTVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AGX26649.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   332 bits (852),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGV+AEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVRAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica 
Group]
 gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group]
 gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group]
 gb|AIR95993.1| adenosylhomocysteinase [Oryza sativa Japonica Group]
Length=485

 Score =   332 bits (852),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDNAEF+IVLTIIRD
Sbjct  124  CLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNAEFKIVLTIIRD  183

Query  586  GLKADP  603
            GLK+DP
Sbjct  184  GLKSDP  189



>gb|AHA84211.1| S-adenosyl-L-homocysteine hydrolase [Phaseolus vulgaris]
Length=485

 Score =   332 bits (852),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT++GREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP+STDNAEFQIVLTII+D
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEELFEKTGELPDPASTDNAEFQIVLTIIKD  183

Query  586  GLKADP  603
            GLK+DP
Sbjct  184  GLKSDP  189



>gb|AGV54286.1| adenosylhomocysteinase [Phaseolus vulgaris]
Length=485

 Score =   332 bits (852),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP+STDNAEFQIVLTII+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELFEKTGELPDPTSTDNAEFQIVLTIIKDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AIG62176.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP+QPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPAQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_009135865.1| PREDICTED: adenosylhomocysteinase 2-like [Brassica rapa]
Length=485

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDPSSTDN EFQIVL+II+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPSSTDNPEFQIVLSIIKDG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>gb|ABQ18314.1| S-adenosyl-L-homocysteine hydrolase [Chrysanthemum x morifolium]
Length=485

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            TVEKT+SGREYKVKDMS ADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    TVEKTTSGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQT VLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTGVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK+G +PDP+STDNAEFQIVL+II++
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKSGKLPDPTSTDNAEFQIVLSIIKE  183

Query  586  GLKADP  603
            GL  DP
Sbjct  184  GLSTDP  189



>gb|AGX26654.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQA+FGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQANFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>ref|XP_010532739.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPSSTDN EFQIVL II+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGQVPDPSSTDNPEFQIVLQIIKDG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>ref|XP_004502244.1| PREDICTED: adenosylhomocysteinase-like [Cicer arietinum]
Length=485

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VE T+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWC+ERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGD TLLIHEGVKAEE Y KNG +PDPSSTDNAEFQI+LTIIRDG
Sbjct  125  LDWGPTGGPDLIVDDGGDVTLLIHEGVKAEELYEKNGQLPDPSSTDNAEFQIILTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AGX26687.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAW+GETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWEGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>emb|CDY01177.1| BnaA04g06420D [Brassica napus]
Length=485

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    VVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKE  183

Query  586  GLKADP  603
            GL+ DP
Sbjct  184  GLQVDP  189



>ref|XP_009139575.1| PREDICTED: adenosylhomocysteinase 1 [Brassica rapa]
Length=485

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    VVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKE  183

Query  586  GLKADP  603
            GL+ DP
Sbjct  184  GLQVDP  189



>gb|AIG62190.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDA LLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDAALLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>emb|CDX85127.1| BnaC07g07790D [Brassica napus]
Length=475

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDP+STDN EFQIVL+II+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPTSTDNPEFQIVLSIIKDG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>ref|XP_006283635.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
 ref|XP_010435212.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450125.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450146.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 gb|EOA16533.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
Length=485

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>gb|AAP92454.1| S-adenosyl-L-homocystein hydrolase [Brassica oleracea var. alboglabra]
Length=466

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>gb|AGX26656.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTA LIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAALIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AAX16000.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>ref|XP_006373090.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|ABK96105.1| unknown [Populus trichocarpa]
 gb|ERP50887.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGR YKVKD+SQADFGRLE+ELAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGRAYKVKDLSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>ref|XP_002870350.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46609.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>gb|AAX15998.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>gb|AAX15999.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>ref|NP_193130.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 sp|O23255.1|SAHH1_ARATH RecName: Full=Adenosylhomocysteinase 1; Short=AdoHcyase 1; AltName: 
Full=Protein EMBRYO DEFECTIVE 1395; AltName: Full=Protein 
HOMOLOGY-DEPENDENT GENE SILENCING 1; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase 1; Short=SAH hydrolase 1 [Arabidopsis 
thaliana]
 gb|AAG40389.1|AF325037_1 AT4g13940 [Arabidopsis thaliana]
 emb|CAB10173.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAC14714.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
 emb|CAB78436.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK68806.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK83621.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAL90945.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAM10030.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAO00764.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AEE83345.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>gb|KFK36278.1| hypothetical protein AALP_AA4G101800 [Arabis alpina]
Length=485

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPNSTDNPEFQIVLSIIKEG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>gb|AAM62888.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>gb|AIG62174.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVL ETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLTETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_008222808.1| PREDICTED: adenosylhomocysteinase isoform X2 [Prunus mume]
Length=547

 Score =   333 bits (854),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VLTIIRD
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKLPDPASTDNQEFQLVLTIIRD  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKTDP  189



>gb|AGX26686.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDW PGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWSPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>ref|XP_010527457.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPSSTDN EFQIVL II+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGQVPDPSSTDNPEFQIVLQIIKDG  184

Query  589  LKADP  603
            L  DP
Sbjct  185  LPVDP  189



>gb|AGX26677.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPG M+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGSMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AGT16642.1| Adenosylhomocysteinase [Saccharum hybrid cultivar R570]
Length=485

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP STDNAEF+IVLTIIRD
Sbjct  124  CLDWGEGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKIPDPESTDNAEFKIVLTIIRD  183

Query  586  GLKADP  603
            GLKADP
Sbjct  184  GLKADP  189



>ref|XP_006297468.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
 gb|EOA30366.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
Length=507

 Score =   332 bits (850),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  27   VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  86

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  87   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  146

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II+DG
Sbjct  147  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSIIKDG  206

Query  589  LKADP  603
            L+ DP
Sbjct  207  LQVDP  211



>ref|XP_010908558.1| PREDICTED: adenosylhomocysteinase [Elaeis guineensis]
Length=485

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G VPDP+STDNAEFQIVL +IRD 
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKVPDPASTDNAEFQIVLGLIRDS  184

Query  589  LKADP  603
            +K DP
Sbjct  185  IKVDP  189



>gb|AIG62168.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   331 bits (848),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLH T
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHTT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_006848518.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
 gb|ERN10099.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
Length=485

 Score =   331 bits (848),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+ST N EFQIVL II+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKLPDPASTTNPEFQIVLGIIKDG  184

Query  589  LKADP  603
            LKADP
Sbjct  185  LKADP  189



>ref|XP_002278000.1| PREDICTED: adenosylhomocysteinase-like [Vitis vinifera]
Length=485

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP QPFKGARITGSLHM
Sbjct  4    VVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPQQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEY ++G +PDP+STDNAEFQIVL II++
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYERSGKLPDPASTDNAEFQIVLGIIKE  183

Query  586  GLKADP  603
            GL  DP
Sbjct  184  GLSVDP  189



>gb|AIG62186.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGA VRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAGVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AGX26671.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQ HAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQGHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AGX26647.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+ P
Sbjct  185  LKSGP  189



>gb|AIG62163.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+IT SLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITDSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_010247578.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            V+KTSSGREYKVKDMSQADFGRLE++LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VDKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEE+ K G  PDPSST+NAEFQIVLT+I+DG
Sbjct  125  LDWGPSGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKFPDPSSTNNAEFQIVLTLIKDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AGX26674.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIR G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRGG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AAL16259.1|AF428329_1 AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   330 bits (847),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C AEFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVAEFGPSQPLKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSIIKDG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>gb|AGX26673.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   330 bits (847),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDAT LIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATPLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AGX26653.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   330 bits (847),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGR YKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGRGYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>emb|CDY47309.1| BnaAnng08830D [Brassica napus]
Length=486

 Score =   330 bits (847),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>ref|XP_004973012.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   330 bits (847),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEEY K G VPDP STDNAEF+IVLTIIRD
Sbjct  124  CLDWGEGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKVPDPESTDNAEFKIVLTIIRD  183

Query  586  GLKADP  603
            GLK+DP
Sbjct  184  GLKSDP  189



>gb|AHL20280.1| S-adenosylhomocysteine hydrolase [Kalanchoe daigremontiana]
Length=485

 Score =   330 bits (847),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR+EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRSEFGPSQPLKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFS+QDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSSQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLI DDGGDA++LIHEGVKAEEE+AKNGTVPDP ST N +FQIVLTIIRDG
Sbjct  125  LDWGPSGGPDLIFDDGGDASMLIHEGVKAEEEFAKNGTVPDPHSTTNPDFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_004953493.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   330 bits (846),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFAGARISGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDP STDNAEF+IVLTIIRD
Sbjct  124  CLDWGEGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKIPDPESTDNAEFKIVLTIIRD  183

Query  586  GLKADP  603
            GLK+DP
Sbjct  184  GLKSDP  189



>gb|AGX26657.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   330 bits (845),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            +QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   VQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPSGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            L++DP
Sbjct  185  LRSDP  189



>ref|XP_010551666.1| PREDICTED: adenosylhomocysteinase 1-like [Tarenaya hassleriana]
Length=485

 Score =   330 bits (845),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPS TDN EFQIVL II+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGQVPDPSCTDNPEFQIVLQIIKDG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>emb|CDX77483.1| BnaA07g06210D [Brassica napus]
Length=460

 Score =   329 bits (843),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDP+STDN EFQIVL+II+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPTSTDNPEFQIVLSIIKDG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>emb|CDY50423.1| BnaCnng19320D [Brassica napus]
Length=485

 Score =   330 bits (845),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    VVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPG GPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++
Sbjct  124  ALDWGPGAGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKE  183

Query  586  GLKADP  603
            GL+ DP
Sbjct  184  GLQVDP  189



>gb|AGX26665.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   330 bits (845),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWW TERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWSTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AGX26667.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFG SQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGLSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AGX26662.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   329 bits (844),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMFCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVD GGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDGGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>sp|P50249.1|SAHH_PHASS RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Phalaenopsis sp.]
 emb|CAA56278.1| S-adenosylhomocysteine hydrolase [Phalaenopsis sp. 'pSPORT1']
Length=485

 Score =   329 bits (844),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            L+WG GGGPDLIVDDGGDATLLIHEGVKAEEEY KNG +PDP+STDNAEFQIVL +IRD 
Sbjct  125  LEWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGKIPDPASTDNAEFQIVLGLIRDS  184

Query  589  LKADP  603
            L  DP
Sbjct  185  LSVDP  189



>ref|XP_006414844.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
 gb|ESQ56297.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
Length=588

 Score =   332 bits (852),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  108  VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  167

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  168  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  227

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  228  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPNSTDNPEFQIVLSIIKEG  287

Query  589  LKADP  603
            L+ DP
Sbjct  288  LQVDP  292



>sp|P50246.1|SAHH_MEDSA RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Medicago sativa]
 gb|AAB41814.1| adenosylhomocysteinase [Medicago sativa]
Length=485

 Score =   329 bits (844),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VE T+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWC+ERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE + K G +PDPSSTDNAE QIVLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDVTLLIHEGVKAEEVFEKTGQLPDPSSTDNAEMQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>emb|CDY58805.1| BnaC08g46780D [Brassica napus]
Length=475

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>gb|AGX26681.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LD GPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDRGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum]
Length=485

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+A DSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIAHDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAE+ Y K G +PDPSSTDNAEFQIVLTIIRD
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEQVYEKTGQLPDPSSTDNAEFQIVLTIIRD  183

Query  586  GLKADP  603
            GLKADP
Sbjct  184  GLKADP  189



>emb|CDP15078.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQP KGARITGSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPLKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGA VRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGASVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWG  GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDPSST+NAEFQIVL IIRD
Sbjct  124  ALDWGSEGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTENAEFQIVLGIIRD  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKVDP  189



>gb|AIG62170.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCS NIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSRNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AAK92718.1| putative S-adenosyl-L-homocysteinas protein [Arabidopsis thaliana]
Length=485

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSIIKDG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>ref|NP_189023.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
 sp|Q9LK36.1|SAHH2_ARATH RecName: Full=Adenosylhomocysteinase 2; Short=AdoHcyase 2; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase 1; AltName: 
Full=SAH hydrolase 2 [Arabidopsis thaliana]
 dbj|BAB01858.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAL24370.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAM13384.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAN12996.1| putative S-adenosyl-L-homocysteinase [Arabidopsis thaliana]
 gb|AEE76817.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
Length=485

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSIIKDG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>gb|AGX26689.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGS HMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSFHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEV WCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVPWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>ref|XP_009107496.1| PREDICTED: adenosylhomocysteinase 1-like [Brassica rapa]
Length=478

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>dbj|BAH19670.1| AT4G13940 [Arabidopsis thaliana]
Length=325

 Score =   323 bits (828),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRL LELAEVEMPGLMACR  FGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLGLELAEVEMPGLMACRTGFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEVFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>ref|XP_009102577.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPF GARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFTGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDP+STDN EFQIVL+II+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPTSTDNPEFQIVLSIIKDG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>ref|NP_001148534.1| adenosylhomocysteinase [Zea mays]
 gb|ACG31873.1| adenosylhomocysteinase [Zea mays]
Length=485

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
             LDWG  GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP STDNAEF+IVLTIIRD
Sbjct  124  CLDWGEAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKIPDPESTDNAEFKIVLTIIRD  183

Query  586  GLKADP  603
            GLKADP
Sbjct  184  GLKADP  189



>ref|XP_010905139.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR+EFGPSQPFKGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEFGPSQPFKGARISGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDN+EFQIVL +IRD 
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPTSTDNSEFQIVLGLIRDS  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKVDP  189



>emb|CAJ01707.1| putative S-adenosylhomocystein hydrolase 2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ88218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKTSSGREYKVKD+SQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDN EF+IVLTIIRD
Sbjct  124  CLDWGAGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVLTIIRD  183

Query  586  GLKAD  600
            GLK D
Sbjct  184  GLKTD  188



>ref|XP_008776857.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDN EFQIVL +IRD 
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPTSTDNVEFQIVLGLIRDS  184

Query  589  LKADP  603
            +K +P
Sbjct  185  IKVNP  189



>gb|KFK28004.1| hypothetical protein AALP_AA8G459100 [Arabis alpina]
Length=485

 Score =   328 bits (841),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWG GGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125  LDWGTGGGPDLIVDDGGDATLLIHEGVKAEEVFEKTGQVPDPNSTDNPEFQIVLSIIKEG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>gb|AAP92453.1| S-adenosyl-L-homocystein hydrolase [Arabidopsis thaliana]
Length=485

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTS GREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSGGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>ref|NP_001234012.1| adenosylhomocysteinase [Solanum lycopersicum]
 sp|Q9SWF5.1|SAHH_SOLLC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Solanum lycopersicum]
 gb|AAD50775.1|AF161705_1 S-adenosyl-l-homocysteine hydrolase [Solanum lycopersicum]
Length=485

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA RAEFGPSQP KGA+IT SLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPVKGAKITCSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTA LIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAFLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGTVPDP+STDN EFQ+VLTII++ 
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTVPDPTSTDNVEFQLVLTIIKES  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AIG62185.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   328 bits (840),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII  G
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYDKTGAVPDPASTDNAEFQIVLTIITHG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_002883461.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59720.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=485

 Score =   328 bits (840),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K GT PDP+STDN EFQIVL IIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGTFPDPTSTDNPEFQIVLAIIRDG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>dbj|BAP47516.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   328 bits (840),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            V+KT++GREYKVKDMSQADFGRLE+ELAEVEMPGLM+ R EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VDKTTTGREYKVKDMSQADFGRLEIELAEVEMPGLMSSRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAA +ARD AAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAATIARDCAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGD TLLIHEGVKAEEE+  +GT+PDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDTTLLIHEGVKAEEEFKTSGTMPDPNSTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|ACN34730.1| unknown [Zea mays]
 gb|AFW60832.1| adenosyl homocysteine hydrolase1 isoform 1 [Zea mays]
 gb|AFW60833.1| adenosyl homocysteine hydrolase1 isoform 2 [Zea mays]
Length=485

 Score =   327 bits (839),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
             LDWG  GGPDLIVDDGGDATLLIHEGVKAEE+Y K G +PDP STDNAEF+IVLTIIRD
Sbjct  124  CLDWGEAGGPDLIVDDGGDATLLIHEGVKAEEDYEKTGKIPDPESTDNAEFKIVLTIIRD  183

Query  586  GLKADP  603
            GLKADP
Sbjct  184  GLKADP  189



>ref|XP_006418835.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
 gb|ESQ37271.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
Length=485

 Score =   327 bits (839),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G  PDP+STDN EFQIVL+II+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQFPDPTSTDNPEFQIVLSIIKDG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>gb|ABK25129.1| unknown [Picea sitchensis]
Length=485

 Score =   327 bits (838),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +1

Query  52   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  231
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRVEFGPAQPFKGARITGSLHMTI  65

Query  232  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  411
            QTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  412  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGL  591
            DWGPGGGPDLIVDDGGD TLLIHEGVKAEEE+AK G VPDP+ST N EFQIVL +I++ L
Sbjct  126  DWGPGGGPDLIVDDGGDTTLLIHEGVKAEEEFAKTGKVPDPASTTNVEFQIVLALIKESL  185

Query  592  KADP  603
            K DP
Sbjct  186  KVDP  189



>gb|ABI95857.1| S-adenosyl-homocysteine hydrolase [Nicotiana suaveolens]
Length=485

 Score =   327 bits (838),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFG LE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGGLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF  +GETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFRVEGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLI+EGVKAEEE+AKNGT+PDP+STDNAEFQ+VLTII++ 
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIYEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTIIKES  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AIG62177.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   327 bits (838),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQD AAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDRAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|ABK24229.1| unknown [Picea sitchensis]
 gb|ACN40819.1| unknown [Picea sitchensis]
Length=485

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +1

Query  52   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  231
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRVEFGPAQPFKGARITGSLHMTI  65

Query  232  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  411
            QTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  412  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGL  591
            DWGPGGGPDLIVDDGGD TLLIHEGVKAEEE+AK G VPDP+ST N EFQIVL +I++ L
Sbjct  126  DWGPGGGPDLIVDDGGDTTLLIHEGVKAEEEFAKTGKVPDPASTTNVEFQIVLALIKESL  185

Query  592  KADP  603
            K DP
Sbjct  186  KVDP  189



>gb|AIG62161.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAE EMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEAEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQD AAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDRAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDG
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_008794647.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            V KTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR+EFGPSQP KGARI+GSLHMT
Sbjct  5    VGKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEFGPSQPLKGARISGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS AVFAWKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSVAVFAWKGETLQEYWWCTERC  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL +IRD 
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPASTDNAEFQIVLGLIRDS  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKVDP  189



>ref|XP_003538528.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDM+QADFGRLE+ELAEVEMPGLM+ R EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMTQADFGRLEIELAEVEMPGLMSSRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE + K G  PDP+S+DNAEFQIVL+IIRDG
Sbjct  125  LDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIFEKTGQFPDPASSDNAEFQIVLSIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>gb|AAM19782.1| AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  +AKNGT PDP+STDN EFQIVL+II+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEAIFAKNGTFPDPTSTDNPEFQIVLSIIKDG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>ref|XP_009403608.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
             VEKTS+GREYKVKD+SQADFGRLE+ELAEVEMPGLM+CRAEFGPSQPF GARITGSLHM
Sbjct  4    VVEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFAGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLAEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEEE+ K G +PDP+STDNAEFQIVL IIRD
Sbjct  124  CLDWGPTGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKLPDPASTDNAEFQIVLGIIRD  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKVDP  189



>ref|XP_008803686.1| PREDICTED: adenosylhomocysteinase [Phoenix dactylifera]
Length=485

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKD+SQADFGRLELELAEVEMPGLMACR+E+GPSQPFKGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRSEYGPSQPFKGARISGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            L+WGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL +IRD 
Sbjct  125  LEWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPASTDNAEFQIVLGLIRDS  184

Query  589  LKADP  603
            LK +P
Sbjct  185  LKVNP  189



>gb|KJB28098.1| hypothetical protein B456_005G027700 [Gossypium raimondii]
Length=485

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +V+KTS GREYKVKDMSQADFGRLE++LAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVDKTSGGREYKVKDMSQADFGRLEIDLAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAA +ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSASVFAWKGETLQEYWWCTEK  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            +LDWG GGGPDLIVDDGGD T+LIHEGVKAEE Y K G VPDP+S+DNAEFQIVLTII+D
Sbjct  124  SLDWGAGGGPDLIVDDGGDVTMLIHEGVKAEEAYEKTGKVPDPTSSDNAEFQIVLTIIKD  183

Query  586  GLKADP  603
            GL A+P
Sbjct  184  GLTANP  189



>ref|XP_003601687.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89238.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AES71938.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VE T+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWC+ERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWG GGGPDLIVDDGGD TLLIHEGVKAEE + K G +PDPSSTDNAE QIVLTIIRDG
Sbjct  125  LDWGTGGGPDLIVDDGGDVTLLIHEGVKAEEVFEKTGQLPDPSSTDNAEMQIVLTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_006662925.1| PREDICTED: adenosylhomocysteinase-like [Oryza brachyantha]
Length=485

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWW TER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWGTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K G VP+P STDNAEF+IVLTIIRD
Sbjct  124  CLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKVPNPDSTDNAEFKIVLTIIRD  183

Query  586  GLKADP  603
            GLK+DP
Sbjct  184  GLKSDP  189



>emb|CDY53211.1| BnaC03g74050D [Brassica napus]
Length=476

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCCTEFGPSQPLKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDPSSTDN EFQIVL+II+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPSSTDNPEFQIVLSIIKDG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>ref|XP_004296983.1| PREDICTED: adenosylhomocysteinase [Fragaria vesca subsp. vesca]
Length=485

 Score =   325 bits (834),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEK SSGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKHSSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRVEFGPSQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGD TLLIHEGVKAEE + K G +PDP+STDNAEFQIVL+II++
Sbjct  124  ALDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIFEKTGQLPDPTSTDNAEFQIVLSIIKE  183

Query  586  GLKADP  603
            GLK DP
Sbjct  184  GLKTDP  189



>gb|EMT01272.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=485

 Score =   325 bits (834),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKTSSGREYKVKD+SQADFGRLEL+LAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELDLAEVEMPGLMACRTEFGPSQPFKGARISGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDN EF+IVLTIIRD
Sbjct  124  CLDWGAGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVLTIIRD  183

Query  586  GLKAD  600
            GLK D
Sbjct  184  GLKTD  188



>ref|XP_010673385.1| PREDICTED: adenosylhomocysteinase [Beta vulgaris subsp. vulgaris]
 dbj|BAE07182.1| S-adenosyl-L-homocysteine hydrolase [Beta vulgaris]
Length=487

 Score =   325 bits (834),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGA+ITGSLHM
Sbjct  6    SVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGAKITGSLHM  65

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  66   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  125

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VL +I++
Sbjct  126  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKIPDPTSTDNVEFQLVLGLIKE  185

Query  586  GLKADP  603
             LK DP
Sbjct  186  SLKVDP  191



>ref|XP_009415939.1| PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis]
Length=485

 Score =   325 bits (833),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTS+GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP++PF GARI+GSLHMT
Sbjct  5    VEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPAKPFAGARISGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL EYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLAEYWWCTERC  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL IIRDG
Sbjct  125  LDWGPNGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPASTDNAEFQIVLGIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKVDP  189



>sp|Q9SP37.1|SAHH_LUPLU RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Lupinus luteus]
 gb|AAD56048.1|AF185635_1 S-adenosyl-L-homocysteinase [Lupinus luteus]
Length=485

 Score =   325 bits (832),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R+EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE Y K+G  PDP STDNAEF+IVL+II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIYEKSGQFPDPDSTDNAEFKIVLSIIKEG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_009413566.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   325 bits (832),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTS+GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHMT
Sbjct  5    VEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIE+LTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL EYWWCTER 
Sbjct  65   IQTAVLIESLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLAEYWWCTERC  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL +IRDG
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPASTDNAEFQIVLGLIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKVDP  189



>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3OND|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3ONE|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONE|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONF|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
 pdb|3ONF|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
Length=488

 Score =   325 bits (832),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R+EFGPSQPFKGA+ITGSLHMT
Sbjct  8    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGSLHMT  67

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  68   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  127

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE Y K+G  PDP STDNAEF+IVL+II++G
Sbjct  128  LDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIYEKSGQFPDPDSTDNAEFKIVLSIIKEG  187

Query  589  LKADP  603
            LK DP
Sbjct  188  LKTDP  192



>ref|NP_001265954.1| adenosylhomocysteinase-like [Cicer arietinum]
 emb|CAI56440.1| S-adenosyl-L-homocysteine hydrolase [Cicer arietinum]
Length=485

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT++GREYKVKD+SQADFGRLE+ELAE+EMPGL++ R EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTNTGREYKVKDLSQADFGRLEIELAEIEMPGLISSRTEFGPSQPFKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE + K G VPDPSSTDNAEFQIVL+IIR+G
Sbjct  125  LDWGPGGGPDLIVDDGGDVTLLIHEGVKAEELFEKTGEVPDPSSTDNAEFQIVLSIIREG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_002987608.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
 ref|XP_002987645.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11220.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11444.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
Length=485

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGARITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGE LQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGENLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWG GGGPDLIVDDGGDATLLIHEGVKAE+E+ KNGT+PDPSST N EFQIVL I+++
Sbjct  124  ALDWGVGGGPDLIVDDGGDATLLIHEGVKAEKEFEKNGTLPDPSSTTNQEFQIVLGILKE  183

Query  586  GLKADP  603
            GL+ DP
Sbjct  184  GLQVDP  189



>gb|EPS72602.1| adenosylhomocysteinase, partial [Genlisea aurea]
Length=567

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKT++GRE+KVKDMSQADFGRLE+ELAEVEMPGLM+ R+EFGPSQPFKGARITGSLHMT
Sbjct  87   VEKTTAGREFKVKDMSQADFGRLEIELAEVEMPGLMSSRSEFGPSQPFKGARITGSLHMT  146

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  147  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  206

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAE EY K G +PDP+STDNAEFQ+VL +IRDG
Sbjct  207  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEAEYEKTGKLPDPNSTDNAEFQLVLGLIRDG  266

Query  589  LKADP  603
            LK DP
Sbjct  267  LKTDP  271



>emb|CCC55421.1| S-adenosyl-L-homocysteine hydrolase [Pinus pinaster]
Length=485

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +1

Query  52   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  231
            EKT SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  232  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  411
            QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  412  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGL  591
            DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP+ST N EFQ+VL +I+D +
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPASTTNLEFQMVLGLIKDSI  185

Query  592  KADP  603
            K DP
Sbjct  186  KVDP  189



>sp|P32112.1|SAHH_WHEAT RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
 gb|AAA34303.1| S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
Length=485

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKTSSGREYKVKD+ QADFGRLELELAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLFQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFS+QDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSSQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDN EF+IVLTIIRD
Sbjct  124  CLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVLTIIRD  183

Query  586  GLKAD  600
            GLK D
Sbjct  184  GLKTD  188



>ref|XP_003577583.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Brachypodium 
distachyon]
Length=485

 Score =   323 bits (827),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKTSSGREYKVKD+SQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSC IFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCXIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP STDN EF+IVLTIIRD
Sbjct  124  CLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKIPDPESTDNPEFKIVLTIIRD  183

Query  586  GLKAD  600
            GLK D
Sbjct  184  GLKTD  188



>ref|XP_008438321.1| PREDICTED: adenosylhomocysteinase-like [Cucumis melo]
Length=485

 Score =   323 bits (827),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            V+KTS+GREYKVKDM+QADFGRLE++LAEVEMPGLMACR E+GPSQPFKGA+ITGSLHMT
Sbjct  5    VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPSQPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER+
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERS  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K GT+PDPSST N+E QIV TIIRDG
Sbjct  125  LDWGPEGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGTLPDPSSTTNSELQIVFTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>emb|CDY50106.1| BnaC01g43540D [Brassica napus]
 emb|CDY18090.1| BnaA01g23510D [Brassica napus]
Length=508

 Score =   323 bits (827),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G +PDP+STDN EFQIVL+II+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQLPDPTSTDNPEFQIVLSIIKDG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>ref|XP_010512939.1| PREDICTED: adenosylhomocysteinase 2-like [Camelina sativa]
Length=485

 Score =   322 bits (826),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K GT+PDP+STDN EFQIVL II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGTLPDPTSTDNPEFQIVLAIIKEG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>gb|KFK39678.1| hypothetical protein AALP_AA3G275000 [Arabis alpina]
Length=485

 Score =   322 bits (825),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G  PDP+STDN EFQIVL+II+DG
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGVFPDPTSTDNPEFQIVLSIIKDG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>gb|ABR16547.1| unknown [Picea sitchensis]
 gb|ABR18363.1| unknown [Picea sitchensis]
Length=485

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +1

Query  52   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  231
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  232  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  411
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  412  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGL  591
            DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I++ +
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLIKESM  185

Query  592  KADP  603
            K DP
Sbjct  186  KVDP  189



>gb|ACN40278.1| unknown [Picea sitchensis]
Length=485

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +1

Query  52   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  231
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  232  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  411
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  412  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGL  591
            DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I++ +
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLIKESM  185

Query  592  KADP  603
            K DP
Sbjct  186  KVDP  189



>ref|XP_010488460.1| PREDICTED: adenosylhomocysteinase 2 [Camelina sativa]
Length=485

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K GT PDP+STDN EFQIVL II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGTFPDPTSTDNPEFQIVLAIIKEG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>gb|ABR17322.1| unknown [Picea sitchensis]
Length=485

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +1

Query  52   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  231
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  232  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  411
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  412  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGL  591
            DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I++ +
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLIKESM  185

Query  592  KADP  603
            K DP
Sbjct  186  KVDP  189



>ref|XP_001755906.1| predicted protein [Physcomitrella patens]
 gb|EDQ79191.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT+SGREYKV+DMSQADFGRLEL+LAEVEMPGLM+CR EFG +QPFKGA+ITGSLHM
Sbjct  4    SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAE+ YAK+GT+PDP ST NAEF+IVLTI+RD
Sbjct  124  ALDWGPDGGPDLIVDDGGDATLLIHEGVKAEDAYAKDGTLPDPESTTNAEFKIVLTILRD  183

Query  586  GLKADP  603
            G+K +P
Sbjct  184  GMKENP  189



>gb|ABR16573.1| unknown [Picea sitchensis]
Length=485

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +1

Query  52   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  231
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  232  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  411
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  412  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGL  591
            DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I++ +
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLIKESM  185

Query  592  KADP  603
            K DP
Sbjct  186  KVDP  189



>ref|XP_009106322.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLI DDGGDATLLIHEGVKAEE +AK G +PDP+STDN EFQIVL+II+DG
Sbjct  125  LDWGPGGGPDLIGDDGGDATLLIHEGVKAEEIFAKTGQLPDPTSTDNPEFQIVLSIIKDG  184

Query  589  LKADP  603
            L+ DP
Sbjct  185  LQVDP  189



>ref|XP_001755926.1| predicted protein [Physcomitrella patens]
 gb|EDQ79211.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT+SGREYKV+DMSQADFGRLEL+LAEVEMPGLM+CR EFG +QPFKGA+ITGSLHM
Sbjct  4    SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAE+ YAK+GT+PDP ST NAEF+IVLTI+RD
Sbjct  124  ALDWGPDGGPDLIVDDGGDATLLIHEGVKAEDVYAKDGTLPDPESTTNAEFKIVLTILRD  183

Query  586  GLKADP  603
            G+K +P
Sbjct  184  GMKENP  189



>ref|XP_010466740.1| PREDICTED: adenosylhomocysteinase 2-like isoform X1 [Camelina 
sativa]
Length=485

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K GT+PDP+STDN EFQIVL II++G
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGTLPDPTSTDNPEFQIVLAIIKEG  184

Query  589  LKADP  603
            L  DP
Sbjct  185  LPVDP  189



>ref|XP_010913095.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR+E+GPSQP KGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEYGPSQPLKGARISGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTE+ 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTEQC  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWG  GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL +IRD 
Sbjct  125  LDWGAAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPASTDNAEFQIVLGLIRDS  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKVDP  189



>gb|ABR16138.1| unknown [Picea sitchensis]
Length=485

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +1

Query  52   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  231
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  232  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  411
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  412  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGL  591
            DWGPGGGPDLIV+DGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I++ +
Sbjct  126  DWGPGGGPDLIVNDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLIKESM  185

Query  592  KADP  603
            K DP
Sbjct  186  KVDP  189



>ref|XP_001755929.1| predicted protein [Physcomitrella patens]
 gb|EDQ79214.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   317 bits (813),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            +VEKT+SGREYKV+DMSQADFGRLEL+LAEVEMPGLM+CR EFG +QPFKGA+ITGSLHM
Sbjct  4    SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLI+TLT LGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIDTLTDLGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAE+ YAK+GT+PDP ST NAEF+IVLTI+RD
Sbjct  124  ALDWGPDGGPDLIVDDGGDATLLIHEGVKAEDVYAKDGTLPDPESTTNAEFKIVLTILRD  183

Query  586  GLKADP  603
            G+K +P
Sbjct  184  GMKENP  189



>ref|XP_004133979.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN56709.1| hypothetical protein Csa_3G129660 [Cucumis sativus]
Length=485

 Score =   317 bits (813),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            V+KTS+GREYKVKDM+QADFGRLE++LAEVEMPGLMACR E+GP+ PFKGA+ITGSLHMT
Sbjct  5    VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPALPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER+
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERS  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGD TLLIHEGVKAEE Y K GT+PDPSST N+E QIV TIIRDG
Sbjct  125  LDWGPEGGPDLIVDDGGDVTLLIHEGVKAEEIYEKTGTLPDPSSTTNSELQIVFTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_004166113.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Cucumis 
sativus]
Length=485

 Score =   317 bits (812),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            V+KTS+GREYKVKDM+QADFGRLE++LAEVEMPGLMACR E+GP+ PFKGA+ITGSLHMT
Sbjct  5    VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPALPFKGAKITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER+
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERS  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGD TLLIHEGVKAEE Y K GT+PDPSST N+E QIV TIIRDG
Sbjct  125  LDWGPEGGPDLIVDDGGDVTLLIHEGVKAEEIYEKXGTLPDPSSTTNSELQIVFTIIRDG  184

Query  589  LKADP  603
            LK DP
Sbjct  185  LKTDP  189



>ref|XP_007163813.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
 gb|ESW35807.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
Length=485

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            VEKTSSGREYKVKDMS ADFGR+E+ELAEVEMPGL++CR EFG SQPFKG RITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSLADFGRMEIELAEVEMPGLISCRTEFGSSQPFKGTRITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            LDWGP GGPDLIVDDGGD TLLIHEGVKAE+ + K G  PDPSS+DNAEFQIVL+II++G
Sbjct  125  LDWGPDGGPDLIVDDGGDTTLLIHEGVKAEQVFEKTGQSPDPSSSDNAEFQIVLSIIKEG  184

Query  589  LKADP  603
            LK+DP
Sbjct  185  LKSDP  189



>gb|AAL33588.1| S-adenosyl-L-homocysteine hydrolase [Zea mays]
Length=232

 Score =   306 bits (783),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +1

Query  97   QADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAE  276
            QADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMTIQTAVLIETLTALGAE
Sbjct  1    QADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAE  60

Query  277  VRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDG  456
            VRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDG
Sbjct  61   VRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDG  120

Query  457  GDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADP  603
            GDATLLIHEGVKAEEE+AKNGT+PDP+STDNAEFQ+VLTII++ LK DP
Sbjct  121  GDATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTIIKESLKTDP  169



>gb|AFY99087.1| S-adenosyl-l-homocysteine hydrolase, partial [Campanula persicifolia]
Length=202

 Score =   304 bits (779),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = +1

Query  91   MSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALG  270
            MS ADFGRLELELAEVEMPGLM+ R EFGPSQPFKGARITGSLHMTIQT VLIETLTALG
Sbjct  1    MSLADFGRLELELAEVEMPGLMSSRTEFGPSQPFKGARITGSLHMTIQTGVLIETLTALG  60

Query  271  AEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVD  450
            AEVRWCSCNIFSTQDHAAAA+ARDS AVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  61   AEVRWCSCNIFSTQDHAAAAIARDSCAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  120

Query  451  DGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADP  603
            DGGDATLLIHEGVKAEEE+ K+G VPDP+STDNAEFQIVLTIIRDGLK DP
Sbjct  121  DGGDATLLIHEGVKAEEEFEKSGAVPDPASTDNAEFQIVLTIIRDGLKTDP  171



>ref|NP_001067845.2| Os11g0455500 [Oryza sativa Japonica Group]
 dbj|BAF28208.2| Os11g0455500, partial [Oryza sativa Japonica Group]
Length=515

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  67   GREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVL  246
            G  +KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHMTIQTAVL
Sbjct  41   GGSFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMTIQTAVL  100

Query  247  IETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPG  426
            IETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER LDWG G
Sbjct  101  IETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGVG  160

Query  427  GGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADP  603
            GGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDNAEF+IVLTIIRDGLK+DP
Sbjct  161  GGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNAEFKIVLTIIRDGLKSDP  219



>gb|AFY99082.1| S-adenosyl-l-homocysteine hydrolase, partial [Clermontia kakeana]
 gb|AFY99083.1| S-adenosyl-l-homocysteine hydrolase, partial [Clermontia arborescens 
subsp. waihiae]
 gb|AFY99084.1| S-adenosyl-l-homocysteine hydrolase, partial [Clermontia fauriei]
 gb|AFY99085.1| S-adenosyl-l-homocysteine hydrolase, partial [Cyanea asplenifolia]
Length=202

 Score =   303 bits (775),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = +1

Query  91   MSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALG  270
            MS ADFGRLELELAEVEMPGLM+ R EFGPSQPFKGARITGSLHMTIQT VLIETLTALG
Sbjct  1    MSLADFGRLELELAEVEMPGLMSSRTEFGPSQPFKGARITGSLHMTIQTGVLIETLTALG  60

Query  271  AEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVD  450
            AEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  61   AEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  120

Query  451  DGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADP  603
            DGGDATLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVLTIIRDGLK DP
Sbjct  121  DGGDATLLIHEGVKAEEEYEKSGALPDPTSTDNAEFQIVLTIIRDGLKEDP  171



>gb|KJB19538.1| hypothetical protein B456_003G108500 [Gossypium raimondii]
Length=485

 Score =   309 bits (792),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            TV +T++GRE+KVKD++QADFGRLE+ELAEVEMPGLMACRAEFGP+QP K ARITGSLHM
Sbjct  4    TVSRTATGREFKVKDIAQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKDARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTEK  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            ALDWGPGGGPDLIVDDGGDATLLIHEG KAEEEY ++G +P+P+ T+NAEF+IVL+II++
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGAKAEEEYERSGKLPNPNETENAEFRIVLSIIKE  183

Query  586  GLKADP  603
            GL  DP
Sbjct  184  GLLIDP  189



>gb|KHG19993.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   308 bits (788),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  49   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  228
            V +T++GRE+KVKD++QADFGRLE+ELAEVEMPGLMACRAEFGP+QP K ARITGSLHMT
Sbjct  5    VSRTATGREFKVKDIAQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKEARITGSLHMT  64

Query  229  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  408
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVFAWKGETL+EYWWCTE+A
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLEEYWWCTEKA  124

Query  409  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG  588
            L+WGPGGGPDLIVDDGGDATLLIHEGVKAE EY ++G +P+P+ T+NAEFQIVL+II++G
Sbjct  125  LEWGPGGGPDLIVDDGGDATLLIHEGVKAEGEYERSGKLPNPNETENAEFQIVLSIIKEG  184

Query  589  LKADP  603
            L  DP
Sbjct  185  LLIDP  189



>ref|XP_007037836.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY22337.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=485

 Score =   308 bits (788),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +1

Query  46   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  225
            T+ +T +GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP+QP K ARITGSLHM
Sbjct  4    TISRTPTGREYKVKDISQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKDARITGSLHM  63

Query  226  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  405
            TIQTAVLIETLTALGA+VRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETL+EYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAQVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLEEYWWCTEK  123

Query  406  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD  585
            AL+WGPGGGPDLIVDDGGDATLLIHEGVKAEE Y ++G +P+P+ T+NAEF+IVL+II++
Sbjct  124  ALEWGPGGGPDLIVDDGGDATLLIHEGVKAEEVYERSGKLPNPNETENAEFRIVLSIIKE  183

Query  586  GLKADP  603
            GL  DP
Sbjct  184  GLLVDP  189



Lambda      K        H        a         alpha
   0.315    0.134    0.415    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370