BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS052E04

Length=538
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009787672.1|  PREDICTED: BEL1-like homeodomain protein 1         108   5e-24   Nicotiana sylvestris
ref|XP_009628712.1|  PREDICTED: BEL1-like homeodomain protein 1         104   2e-22   Nicotiana tomentosiformis
emb|CDP10596.1|  unnamed protein product                              89.4    4e-17   Coffea canephora [robusta coffee]
ref|XP_003519115.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  88.2    8e-17   Glycine max [soybeans]
ref|XP_006348466.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  87.0    2e-16   Solanum tuberosum [potatoes]
gb|KEH41936.1|  BEL1-related homeotic protein                         86.7    2e-16   Medicago truncatula
ref|XP_003535815.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  86.7    3e-16   Glycine max [soybeans]
ref|XP_011094236.1|  PREDICTED: BEL1-like homeodomain protein 1       85.1    1e-15   
ref|XP_010263012.1|  PREDICTED: BEL1-like homeodomain protein 1       82.4    7e-15   Nelumbo nucifera [Indian lotus]
ref|XP_004497655.1|  PREDICTED: BEL1-like homeodomain protein 1-like  82.4    8e-15   Cicer arietinum [garbanzo]
dbj|BAE71188.1|  BEL1-like homeodomain transcription factor           81.6    1e-14   Trifolium pratense [peavine clover]
ref|XP_010247184.1|  PREDICTED: BEL1-like homeodomain protein 1       79.0    1e-13   
ref|XP_004228612.1|  PREDICTED: BEL1-like homeodomain protein 1       77.4    3e-13   Solanum lycopersicum
ref|XP_007027982.1|  BEL1-like homeodomain protein 1 isoform 1        75.9    1e-12   
gb|EPS74374.1|  hypothetical protein M569_00381                       74.3    2e-12   Genlisea aurea
gb|KDP36113.1|  hypothetical protein JCGZ_08757                       74.3    4e-12   Jatropha curcas
ref|XP_004494251.1|  PREDICTED: BEL1-like homeodomain protein 1-like  73.2    9e-12   Cicer arietinum [garbanzo]
ref|XP_009420594.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...  72.8    1e-11   
ref|XP_009404911.1|  PREDICTED: BEL1-like homeodomain protein 1       72.8    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784116.1|  PREDICTED: BEL1-like homeodomain protein 1       72.4    2e-11   Phoenix dactylifera
ref|XP_007162972.1|  hypothetical protein PHAVU_001G195800g           72.0    3e-11   Phaseolus vulgaris [French bean]
ref|XP_010912386.1|  PREDICTED: BEL1-like homeodomain protein 1       71.6    3e-11   
ref|XP_002266838.1|  PREDICTED: BEL1-like homeodomain protein 1       71.2    4e-11   Vitis vinifera
emb|CAN63083.1|  hypothetical protein VITISV_015358                   70.9    5e-11   Vitis vinifera
ref|XP_008442920.1|  PREDICTED: BEL1-like homeodomain protein 1       70.9    6e-11   Cucumis melo [Oriental melon]
ref|XP_003521496.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  69.3    2e-10   Glycine max [soybeans]
emb|CBI24428.3|  unnamed protein product                              68.6    3e-10   Vitis vinifera
ref|XP_002275098.1|  PREDICTED: BEL1-like homeodomain protein 1       68.6    3e-10   Vitis vinifera
gb|KJB62029.1|  hypothetical protein B456_009G396900                  67.8    5e-10   Gossypium raimondii
ref|XP_011467196.1|  PREDICTED: BEL1-like homeodomain protein 1       67.8    5e-10   Fragaria vesca subsp. vesca
emb|CAN69527.1|  hypothetical protein VITISV_027380                   67.8    5e-10   Vitis vinifera
ref|XP_007145789.1|  hypothetical protein PHAVU_007G267900g           67.0    9e-10   Phaseolus vulgaris [French bean]
ref|XP_004171976.1|  PREDICTED: BEL1-like homeodomain protein 1-like  66.6    2e-09   
ref|XP_004136516.1|  PREDICTED: BEL1-like homeodomain protein 1-like  66.6    2e-09   
gb|KHN08605.1|  BEL1-like homeodomain protein 1                       65.9    3e-09   Glycine soja [wild soybean]
ref|XP_003554466.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  65.5    4e-09   Glycine max [soybeans]
ref|XP_002524053.1|  bel1 homeotic protein, putative                  65.1    4e-09   Ricinus communis
ref|XP_008449596.1|  PREDICTED: BEL1-like homeodomain protein 1       64.7    5e-09   
gb|KHG11906.1|  BEL1-like homeodomain protein 1                       63.9    1e-08   Gossypium arboreum [tree cotton]
ref|XP_010107002.1|  hypothetical protein L484_016932                 60.5    3e-08   
gb|EYU25630.1|  hypothetical protein MIMGU_mgv11b017830mg             60.8    4e-08   Erythranthe guttata [common monkey flower]
ref|XP_004140170.1|  PREDICTED: BEL1-like homeodomain protein 1-like  62.0    4e-08   
gb|KHG11905.1|  BEL1-like homeodomain protein 1                       62.0    4e-08   Gossypium arboreum [tree cotton]
gb|KJB36260.1|  hypothetical protein B456_006G149100                  60.5    1e-07   Gossypium raimondii
gb|KHG01894.1|  BEL1-like homeodomain protein 1                       60.5    1e-07   Gossypium arboreum [tree cotton]
gb|KJB55565.1|  hypothetical protein B456_009G082700                  60.1    2e-07   Gossypium raimondii
gb|KJB09137.1|  hypothetical protein B456_001G125400                  59.7    2e-07   Gossypium raimondii
ref|XP_010059079.1|  PREDICTED: BEL1-like homeodomain protein 1       59.7    2e-07   Eucalyptus grandis [rose gum]
ref|XP_009403681.1|  PREDICTED: BEL1-like homeodomain protein 1       59.3    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008799712.1|  PREDICTED: BEL1-like homeodomain protein 1       58.5    6e-07   Phoenix dactylifera
ref|XP_008387112.1|  PREDICTED: BEL1-like homeodomain protein 1       58.2    7e-07   
gb|KHF99976.1|  BEL1-like homeodomain protein 1                       58.2    8e-07   Gossypium arboreum [tree cotton]
gb|KJB35453.1|  hypothetical protein B456_006G115600                  57.8    9e-07   Gossypium raimondii
ref|XP_008391977.1|  PREDICTED: BEL1-like homeodomain protein 1       57.8    9e-07   
gb|KHG12855.1|  BEL1-like homeodomain protein 1                       57.8    1e-06   Gossypium arboreum [tree cotton]
ref|XP_007204250.1|  hypothetical protein PRUPE_ppa002158mg           57.8    1e-06   
gb|KHG12856.1|  BEL1-like homeodomain protein 1                       57.8    1e-06   Gossypium arboreum [tree cotton]
ref|XP_011090301.1|  PREDICTED: BEL1-like homeodomain protein 1       57.4    1e-06   Sesamum indicum [beniseed]
ref|XP_010031566.1|  PREDICTED: BEL1-like homeodomain protein 1       57.0    2e-06   Eucalyptus grandis [rose gum]
ref|XP_008360598.1|  PREDICTED: BEL1-like homeodomain protein 1       57.0    2e-06   
ref|XP_007015671.1|  BEL1 homeodomain 1, putative                     57.0    2e-06   
ref|XP_008241058.1|  PREDICTED: BEL1-like homeodomain protein 1       56.6    2e-06   Prunus mume [ume]
gb|KEH24245.1|  BEL1-related homeotic protein                         54.7    9e-06   Medicago truncatula
ref|XP_009348973.1|  PREDICTED: BEL1-like homeodomain protein 1       54.7    1e-05   Pyrus x bretschneideri [bai li]
ref|XP_009629592.1|  PREDICTED: BEL1-like homeodomain protein 1       52.8    4e-05   Nicotiana tomentosiformis
gb|KJB16539.1|  hypothetical protein B456_002G234900                  52.0    8e-05   Gossypium raimondii
emb|CDP15553.1|  unnamed protein product                              52.0    9e-05   Coffea canephora [robusta coffee]
ref|XP_004978737.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  51.6    9e-05   
ref|XP_010931060.1|  PREDICTED: BEL1-like homeodomain protein 1       50.8    2e-04   Elaeis guineensis
ref|XP_002450321.1|  hypothetical protein SORBIDRAFT_05g003750        50.8    2e-04   Sorghum bicolor [broomcorn]
ref|XP_009141535.1|  PREDICTED: BEL1-like homeodomain protein 1       50.1    3e-04   
ref|XP_006410764.1|  hypothetical protein EUTSA_v10016349mg           48.9    9e-04   



>ref|XP_009787672.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009787673.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009787674.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
Length=707

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 79/115 (69%), Gaps = 14/115 (12%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQ----PAAGTNFAFLNSITSGGN  385
            MA YF GNSEIQGG DGLQTLILMNPAGY  VGFS+TQ    PA G+N  F NS    GN
Sbjct  1    MAAYFPGNSEIQGGNDGLQTLILMNPAGY--VGFSETQHHQPPAGGSNLVFFNS-NPPGN  57

Query  386  AVTLSHAppppsqsqqFVGIPLATAA----GSHQEAHASAVHSQQHDITALHGFI  538
            ++ LSHA  PPS  QQFVGIPLAT+A     S        VHS QHDI+ALHGF+
Sbjct  58   SLNLSHA--PPSSQQQFVGIPLATSAFTAPSSQDGTTTPTVHS-QHDISALHGFL  109



>ref|XP_009628712.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628714.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628715.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
Length=700

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 76/113 (67%), Gaps = 10/113 (9%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQ--PAAGTNFAFLNSITSGGNAV  391
            MA YF GNSEIQGG DGLQTLILMNPAGY  VGFS+TQ  PA G+N  F NS    GN++
Sbjct  1    MAAYFDGNSEIQGGNDGLQTLILMNPAGY--VGFSETQQPPAGGSNLVFFNS-NPLGNSL  57

Query  392  TLSHAppppsqsqqFVGIPLA----TAAGSHQEAHASAVHSQQHDITALHGFI  538
             L HA  P SQ QQFVGIPLA    TA  S  +   +     QHDI+ALHGF+
Sbjct  58   NLPHA-RPSSQQQQFVGIPLATSVFTAPSSFPDGTTTPTVHSQHDISALHGFL  109



>emb|CDP10596.1| unnamed protein product [Coffea canephora]
Length=680

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 84/128 (66%), Gaps = 26/128 (20%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGD--GLQTLILMNPAGYVNVGFSDT-QPA--------AGTNFAFLN  364
            MATYFHGNSEIQGGG   GLQTLILMN AGYV  G+SDT QP           +NF FLN
Sbjct  1    MATYFHGNSEIQGGGGDHGLQTLILMNHAGYVG-GYSDTHQPPPHVQVQVQPPSNFVFLN  59

Query  365  SITS-------GGNAVTLSHAppppsqsqqFVGIPL-ATAAGSHQ--EAHASAVHSQQHD  514
            S  +       G N++ + HAPPPPS +QQFVGIPL ATAA S Q  + HA++V     D
Sbjct  60   SSNTPGPSAAPGANSLNVHHAPPPPSPTQQFVGIPLTATAATSSQDHQPHAASV----QD  115

Query  515  ITALHGFI  538
            I+ALH F+
Sbjct  116  ISALHAFL  123



>ref|XP_003519115.1| PREDICTED: BEL1-like homeodomain protein 1-like isoformX1 [Glycine 
max]
 ref|XP_006575286.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006575287.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
Length=664

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 70/108 (65%), Gaps = 9/108 (8%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAA-GTNFAFLNSITSGGNAVT  394
            MATYFH NSEIQ G DGLQTL+LMNP GYV   +SDT P   G N  FLNS     +   
Sbjct  1    MATYFHSNSEIQAGADGLQTLVLMNP-GYVQ--YSDTPPPPHGGNLVFLNSAAGNASLQN  57

Query  395  LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
            LSHA  PP  +QQFVG+PL+ AA        +++H   HD++ALHGF+
Sbjct  58   LSHA--PPPHTQQFVGVPLSAAAAHEPPPPPASMH---HDVSALHGFL  100



>ref|XP_006348466.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006348467.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Solanum 
tuberosum]
Length=704

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 77/116 (66%), Gaps = 14/116 (12%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQ------PAAGT--NFAFLNSIT  373
            MA+YFHGNSEIQ G DGLQTLILMNP GY  VGFS+TQ      P  G+  N  F NS  
Sbjct  1    MASYFHGNSEIQEGNDGLQTLILMNP-GY--VGFSETQHHHAPPPPGGSSNNIVFFNS-N  56

Query  374  SGGNAVTLSHAppppsqsqq-FVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
              GN++ LSHAPPPP   QQ FVGIPLATAA +   +  S  ++    I+ALHGF+
Sbjct  57   PLGNSINLSHAPPPPPPPQQHFVGIPLATAAFT-APSQDSGNNNNNESISALHGFL  111



>gb|KEH41936.1| BEL1-related homeotic protein [Medicago truncatula]
Length=649

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 61/108 (56%), Gaps = 11/108 (10%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  397
            MATYFH NSEIQGG DGLQTLI MNP+GY+N   +   P    N  FLNS  +     +L
Sbjct  1    MATYFHNNSEIQGGSDGLQTLIFMNPSGYINYSDAPQPPPHAGNLVFLNSAANHPGNTSL  60

Query  398  SHAppppsq--sqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGF  535
             H           QFVG+PL+        A   +VH+  HD++ALHGF
Sbjct  61   HHQQQQSLSHAPPQFVGVPLS--------AEQQSVHA-HHDVSALHGF  99



>ref|XP_003535815.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006588872.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=661

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 69/108 (64%), Gaps = 13/108 (12%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAA-GTNFAFLNSITSGGNAVT  394
            MATYFH NSEIQ G DGLQTL+LMNP GYV   +SDT P   G N  FLNS     +  +
Sbjct  1    MATYFHSNSEIQAGADGLQTLVLMNP-GYVQ--YSDTPPPPHGGNLVFLNSAAGNASLQS  57

Query  395  LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
            L HA  PP  +QQFVG+PL+ AA    E  AS      HD++ALHGF+
Sbjct  58   LPHA--PPPHTQQFVGVPLSAAA---HEPPASM----HHDVSALHGFL  96



>ref|XP_011094236.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
Length=710

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 74/114 (65%), Gaps = 12/114 (11%)
 Frame = +2

Query  218  MATYFHGNSEIQGGG-DGLQTLILMNPAGYVNVGFSDT---QPAAGTNFAFLNSITSGGN  385
            MATYFHGNSEIQGGG DGLQTLILMNPA    VG+SDT   QP   +NF FLNS +SG N
Sbjct  1    MATYFHGNSEIQGGGGDGLQTLILMNPA---YVGYSDTQQQQPPPSSNFVFLNSNSSGNN  57

Query  386  AVTLSHAppppsqsqqFVGIPL---ATAAGSHQEAHASAVHSQQHDITALHGFI  538
               + HA  PP+Q+Q FVG PL    +A        A     QQ D++ALHGF+
Sbjct  58   GHNIPHA--PPTQTQHFVGFPLQGTTSAPAPPPAPAAPPQDPQQQDVSALHGFL  109



>ref|XP_010263012.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010263013.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
Length=739

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 72/113 (64%), Gaps = 17/113 (15%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  397
            MATYFHG SEIQ   DGLQTL LMNP GY  VG+SDTQP +  N  FLNS  +  N  +L
Sbjct  1    MATYFHGTSEIQ--ADGLQTLYLMNP-GY--VGYSDTQPPS--NMVFLNSAGNTLNPASL  53

Query  398  SHAppppsqsqqFVGIPL------ATAAGSHQEAHASAVHSQQHDITALHGFI  538
            SHA      SQ  VGIPL      A AA + Q+ +  +VHSQQ D++ +HGF+
Sbjct  54   SHA---AQTSQHLVGIPLQATAVAAGAAAASQDPNRPSVHSQQ-DMSTIHGFV  102



>ref|XP_004497655.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=667

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 63/110 (57%), Gaps = 21/110 (19%)
 Frame = +2

Query  218  MATYFHGNSEIQGG-GDGLQTLILMNPAGYVNVGFSDTQPAAGT---NFAFLNSITSGGN  385
            MATYFH NSEIQGG  DGLQTLI MNP+GY+N  +SDT P       N  FLNS      
Sbjct  1    MATYFHNNSEIQGGSADGLQTLIFMNPSGYIN--YSDTPPQQSQHAGNLVFLNSA-----  53

Query  386  AVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGF  535
            A T  H         QFVG+PL TA  S Q AH        HDI+ALHGF
Sbjct  54   ANTSIHQQNLSHAPPQFVGVPL-TAEQSVQ-AH--------HDISALHGF  93



>dbj|BAE71188.1| BEL1-like homeodomain transcription factor [Trifolium pratense]
Length=651

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 64/115 (56%), Gaps = 25/115 (22%)
 Frame = +2

Query  218  MATYFHGNSEIQGG-GDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNS-ITSGGNAV  391
            MATYFH NSEIQGG  DGLQTLI MNP+GY+N   +   P    N  FLNS  T  GN  
Sbjct  1    MATYFHNNSEIQGGSADGLQTLIFMNPSGYINYSDTPQPPPHAGNLVFLNSAATLAGNGN  60

Query  392  T-------LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGF  535
            T       LSHA        QFVG+PL  +A    +AH        HDI+ALHGF
Sbjct  61   TSIQQQHNLSHA------PPQFVGVPL--SAEQSVQAH--------HDISALHGF  99



>ref|XP_010247184.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247191.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247201.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247208.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247219.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247226.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247233.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
Length=729

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 74/114 (65%), Gaps = 18/114 (16%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  397
            MATYFHG SEIQ   DGLQTL LMNP GY  VG++DTQP   +N  FLNS  +  N  +L
Sbjct  1    MATYFHGTSEIQ--ADGLQTLYLMNP-GY--VGYTDTQPP--SNMVFLNSTGNTLNPASL  53

Query  398  SHAppppsqsqqFVGIPLA-------TAAGSHQEAHASAVHSQQHDITALHGFI  538
             +A   P Q+Q  VGIPL        +AA + Q+ +  +VH+QQ +++A+HGF+
Sbjct  54   VNA---PQQNQHLVGIPLQAAAVPPGSAAAAAQDPNRPSVHNQQ-EMSAVHGFV  103



>ref|XP_004228612.1| PREDICTED: BEL1-like homeodomain protein 1 [Solanum lycopersicum]
Length=700

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 74/118 (63%), Gaps = 15/118 (13%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSD----------TQPAAGTNFAFLNS  367
            MA+YFHGNSEIQ G DGLQTLILMNP GY  VGFS+           Q   G+N  F NS
Sbjct  1    MASYFHGNSEIQEGNDGLQTLILMNP-GY--VGFSEAQHHHAPPPPPQGGGGSNIVFFNS  57

Query  368  ITSGGNAVTLSHA-ppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
                GN++ LSHA PPPPSQ QQFVGIPLATAA +     +   ++     + LHGF+
Sbjct  58   -NPLGNSINLSHAPPPPPSQQQQFVGIPLATAAFTAPSQDSGNNNNNNESFSGLHGFL  114



>ref|XP_007027982.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007027983.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007027984.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08484.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08485.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08486.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
Length=668

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 65/107 (61%), Gaps = 19/107 (18%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  397
            MATYFHGN EIQ   DGLQTL+LMNPA YV   +SDT P    N  FLNS     N+++ 
Sbjct  1    MATYFHGNPEIQ-APDGLQTLVLMNPA-YVQ--YSDTAPPPANNLVFLNS-----NSLS-  50

Query  398  SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
             HA  P   +QQFVGIPL   + ++Q+  +       HDI+ LHG +
Sbjct  51   PHA--PSPHTQQFVGIPLPATSSANQDPSS-------HDISPLHGLV  88



>gb|EPS74374.1| hypothetical protein M569_00381 [Genlisea aurea]
Length=404

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 67/115 (58%), Gaps = 21/115 (18%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAA-------GTNFAFLNS-IT  373
            M TY+HG+SEIQGGGDGLQTLILMNPA    VG+ D Q A        G NF FLNS   
Sbjct  1    MGTYYHGDSEIQGGGDGLQTLILMNPA---FVGYGDGQQAPPSGAVAQGNNFVFLNSGSA  57

Query  374  SGGNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
            + G    LSH    P Q+Q FVGIPL      H+   +S       D++ALHGF+
Sbjct  58   AAGVGNNLSHG--APPQTQHFVGIPL------HRPPPSSPQQQ--QDVSALHGFM  102



>gb|KDP36113.1| hypothetical protein JCGZ_08757 [Jatropha curcas]
Length=676

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 62/111 (56%), Gaps = 27/111 (24%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVT-  394
            MATYFHGN EIQ   +GLQTL+LMNP  YV   +SDT P    N  FLN   SG N ++ 
Sbjct  1    MATYFHGNPEIQASAEGLQTLVLMNPT-YVQ--YSDTPPPPSNNLVFLN---SGTNHLSP  54

Query  395  ---LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
               LSHA   P  +QQFVGIPL     SH            HD +ALHG +
Sbjct  55   PPHLSHA---PPNTQQFVGIPLDPT--SH------------HDASALHGLV  88



>ref|XP_004494251.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=686

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 67/114 (59%), Gaps = 14/114 (12%)
 Frame = +2

Query  218  MATYFHGN--SEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGT-----NFAFLNSITS  376
            MATYFHGN  S+  GG DGLQTL+LMNP  Y+    +  QP   +     N  FLNS T+
Sbjct  1    MATYFHGNNNSDQSGGADGLQTLVLMNPT-YIQYSDTTQQPPPPSHSSTGNLVFLNSTTT  59

Query  377  GGNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
              N+ +  HA  PPS +QQFVGIPL T +      H+   H   HD+ +LHGF+
Sbjct  60   NNNSYS-PHA--PPSHTQQFVGIPLTTNSQDINNQHSIHAH---HDVPSLHGFL  107



>ref|XP_009420594.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
1 [Musa acuminata subsp. malaccensis]
Length=669

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 62/107 (58%), Gaps = 12/107 (11%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  397
            MATYFHG  EIQ   DGLQTL LMNP+    VG++D   AA  N  FLNS  +  N++ L
Sbjct  1    MATYFHGAPEIQ--PDGLQTLYLMNPS---YVGYTDA--AAPANMVFLNSTMNSVNSINL  53

Query  398  SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
            +       Q Q FVGIPL +AA  H    +  +H+  HD+ A+ G +
Sbjct  54   AQT----GQQQHFVGIPLQSAAQPHDSHRSQPIHA-SHDVPAVQGLL  95



>ref|XP_009404911.1| PREDICTED: BEL1-like homeodomain protein 1 [Musa acuminata subsp. 
malaccensis]
Length=674

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 64/109 (59%), Gaps = 10/109 (9%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  397
            MATYFHG  EIQ   DGLQTL LMNP+    VG+SD   AA  N   LNS  +  N + L
Sbjct  1    MATYFHGAPEIQP--DGLQTLYLMNPS---YVGYSDA--AAPANMVLLNSTLNSMNPINL  53

Query  398  SHApppps-qsqqFVGIPLATAAGSHQEAHASAVHSQQHDIT-ALHGFI  538
            + A  P   Q QQFVGIPL TAA  H+      +H+  HD++ A+ G I
Sbjct  54   AQASQPNHHQQQQFVGIPLQTAAQPHESYRPPPIHA-PHDLSAAVQGLI  101



>ref|XP_008784116.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008784117.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008784118.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
Length=660

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 60/107 (56%), Gaps = 13/107 (12%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  397
            MATYFHG  EIQ   DGLQTL LMNP  YV  G+SDT  A G N   LNS+ S      +
Sbjct  1    MATYFHGAPEIQP--DGLQTLYLMNP-NYV--GYSDTAAAQG-NMVLLNSMNSLN---PM  51

Query  398  SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
            +H      Q Q FVGIPL     SH+      + +  HD++A+HG +
Sbjct  52   NH----HQQQQHFVGIPLQPTVASHESNRPQPIQAPAHDVSAIHGLV  94



>ref|XP_007162972.1| hypothetical protein PHAVU_001G195800g [Phaseolus vulgaris]
 gb|ESW34966.1| hypothetical protein PHAVU_001G195800g [Phaseolus vulgaris]
Length=679

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 71/114 (62%), Gaps = 14/114 (12%)
 Frame = +2

Query  218  MATYFH-GNSEIQ-GGGDGLQTLILMNPAGYVNVGFSDTQPA---AGTNFAFLNS-ITSG  379
            MATYFH GNSEIQ G  DGLQTL+LMNP GY++   + +QP    A  N  FLNS   +G
Sbjct  1    MATYFHHGNSEIQSGAADGLQTLVLMNP-GYIHYSDAPSQPPPSHAAGNLVFLNSAAVAG  59

Query  380  GNAVTLSHAppppsqsqqFVGIPLATAAG-SHQEAHASAVHSQQHDITALHGFI  538
             N+    +   PPS +QQFVGIPL+ +   +H   HA       HD++ALHGF+
Sbjct  60   TNSNNSFNPHAPPSHTQQFVGIPLSASQDLNHHSMHA------HHDVSALHGFL  107



>ref|XP_010912386.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
Length=663

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 59/107 (55%), Gaps = 14/107 (13%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  397
            MATYFHG  EIQ   DGLQTL LMNP  Y  VG+SDT  AA  N   LNS+ S      +
Sbjct  1    MATYFHGTPEIQ--TDGLQTLYLMNP-NY--VGYSDTAAAAPANMVLLNSMNSLN---PI  52

Query  398  SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
            +H      Q Q FVGIPL     SH+ +    +    HD++ +HG +
Sbjct  53   NH-----QQQQHFVGIPLQPTVASHESSRPQPIEV-PHDVSTVHGLV  93



>ref|XP_002266838.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653287.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653288.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653289.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653290.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653292.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
Length=696

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 68/110 (62%), Gaps = 11/110 (10%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAG--TNFAFLNSITSGGNAV  391
            MATYFHGNSEIQ   DGLQTLILMNPA    VG+SD  P      NF FLNS  +     
Sbjct  1    MATYFHGNSEIQ--ADGLQTLILMNPA---YVGYSDAPPPPPLHPNFVFLNSAAASLAPS  55

Query  392  TLSHAppppsqsqqFVGIPL-ATAAGSHQEAHASAVHSQQHDITALHGFI  538
             LSHA  PP Q+QQFV IPL ATA  +  +    +VH+  H+I  L GFI
Sbjct  56   NLSHA--PPPQTQQFVSIPLSATAPSASSDPSPPSVHA-HHEIPGLPGFI  102



>emb|CAN63083.1| hypothetical protein VITISV_015358 [Vitis vinifera]
Length=709

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 68/110 (62%), Gaps = 11/110 (10%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAG--TNFAFLNSITSGGNAV  391
            MATYFHGNSEIQ   DGLQTLILMNPA    VG+SD  P      NF FLNS  +     
Sbjct  1    MATYFHGNSEIQ--ADGLQTLILMNPA---YVGYSDAPPPPPLHPNFVFLNSAAASLAPS  55

Query  392  TLSHAppppsqsqqFVGIPL-ATAAGSHQEAHASAVHSQQHDITALHGFI  538
             LSHA  PP Q+QQFV IPL ATA  +  +    +VH+  H+I  L GFI
Sbjct  56   NLSHA--PPPQTQQFVSIPLSATAPSASSDPSPPSVHA-HHEIPGLPGFI  102



>ref|XP_008442920.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
Length=713

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 64/115 (56%), Gaps = 11/115 (10%)
 Frame = +2

Query  218  MATYFHGNS-EIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGT-----NFAFLNSITSG  379
            MATY HGNS + Q    GLQTL+LMNP  YV   FSDT P         N  F NS TS 
Sbjct  1    MATYLHGNSDQFQSSDGGLQTLVLMNPT-YVQ--FSDTPPPPPPPPSHPNLVFFNSPTSA  57

Query  380  GNAVTLSHAppppsqsqqFVGIPLAT--AAGSHQEAHASAVHSQQHDITALHGFI  538
             N  T     PP S +QQFVGIPL T  AA    + H S   +  HDI+ALHGF+
Sbjct  58   ANTFTALTQAPPSSHTQQFVGIPLQTTSAASPTSQDHNSHPLNPHHDISALHGFV  112



>ref|XP_003521496.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006577097.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006577098.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
 ref|XP_006577099.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X4 [Glycine 
max]
Length=679

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 73/118 (62%), Gaps = 22/118 (19%)
 Frame = +2

Query  218  MATYFH-GNSEIQ-GGGDGLQTLILMNPAGYVNVGFSDTQPAAGT------NFAFLN-SI  370
            MATYFH GNSEIQ GG DGLQTL+LMNP GY++  +SD  P          N  FLN + 
Sbjct  1    MATYFHHGNSEIQSGGADGLQTLVLMNP-GYIH--YSDAPPPQQQTSQTAGNLVFLNPAA  57

Query  371  TSGGNAVTLS-HAppppsqsqqFVGIPLATAAG-SHQEAHASAVHSQQHDITALHGFI  538
             +GGN  + + HA  PPS +QQFVGIPL  +   +H   HA       HD++ALHGF+
Sbjct  58   VAGGNNNSFNPHA--PPSHTQQFVGIPLPNSQDLNHHSMHA------HHDVSALHGFL  107



>emb|CBI24428.3| unnamed protein product [Vitis vinifera]
Length=573

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 66/108 (61%), Gaps = 10/108 (9%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  397
            MATYFHG+SEIQ   DGLQTL LMNP  Y  +G+SDTQ  +  N  FLN+  +  N   L
Sbjct  1    MATYFHGSSEIQ--ADGLQTLYLMNP-NY--IGYSDTQQPSAANMLFLNATPNSLNPTNL  55

Query  398  SHAppppsqsqqFVGIPLATA-AGSHQEAHASAVHSQQHDITALHGFI  538
             +      Q+Q FVGIPL    + +  + + S++H+ Q ++++L G +
Sbjct  56   PN---MSLQNQHFVGIPLPNMGSANSDDQNRSSLHA-QPEMSSLQGIV  99



>ref|XP_002275098.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
Length=728

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 66/108 (61%), Gaps = 10/108 (9%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  397
            MATYFHG+SEIQ   DGLQTL LMNP  Y  +G+SDTQ  +  N  FLN+  +  N   L
Sbjct  1    MATYFHGSSEIQ--ADGLQTLYLMNP-NY--IGYSDTQQPSAANMLFLNATPNSLNPTNL  55

Query  398  SHAppppsqsqqFVGIPLAT-AAGSHQEAHASAVHSQQHDITALHGFI  538
             +      Q+Q FVGIPL    + +  + + S++H+ Q ++++L G +
Sbjct  56   PN---MSLQNQHFVGIPLPNMGSANSDDQNRSSLHA-QPEMSSLQGIV  99



>gb|KJB62029.1| hypothetical protein B456_009G396900 [Gossypium raimondii]
Length=653

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 58/108 (54%), Gaps = 23/108 (21%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAA-GTNFAFLNSITSGGNAVT  394
            MATYFHGN EIQ   DGLQTL+LMNPA YV   +SDT P    +N  F N      N+++
Sbjct  1    MATYFHGNPEIQASTDGLQTLVLMNPA-YVQ--YSDTPPPPQASNLLFFNP-----NSLS  52

Query  395  LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
                       QQ VGIPL   + ++Q   +       HDI+ LHG +
Sbjct  53   PPQT-------QQLVGIPLPATSAANQGPTS-------HDISPLHGLV  86



>ref|XP_011467196.1| PREDICTED: BEL1-like homeodomain protein 1 [Fragaria vesca subsp. 
vesca]
Length=704

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 72/120 (60%), Gaps = 21/120 (18%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSD------TQPAAGTN--FAFLNSIT  373
            MATY+HGNSEIQ    GLQTL+LMN  GY  V +SD      +  AA TN    FLNS  
Sbjct  1    MATYYHGNSEIQSPDGGLQTLVLMNHGGY--VPYSDATQQQHSPSAAATNQQLVFLNS--  56

Query  374  SGGN-----AVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
            +G N     A TL HA  PPS +QQFVGIPL T + +   +++  +H   HD+ ALH F+
Sbjct  57   AGANNQLAQASTLPHA--PPSHTQQFVGIPLPTVS-TQDPSNSQGMHP-HHDMAALHAFM  112



>emb|CAN69527.1| hypothetical protein VITISV_027380 [Vitis vinifera]
Length=728

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 61/107 (57%), Gaps = 8/107 (7%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  397
            MATYFHG+SEIQ   DGLQTL LMNP  Y  +G+SDTQ  +  N  FLN+  +  N   L
Sbjct  1    MATYFHGSSEIQ--ADGLQTLYLMNP-NY--IGYSDTQQPSAANMLFLNATPNSLNPTNL  55

Query  398  SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
             +      Q+Q FVGIPL     ++ +    +    Q ++++L G +
Sbjct  56   PN---MXLQNQHFVGIPLPNMGSANSDDQNRSXLHAQPEMSSLQGIV  99



>ref|XP_007145789.1| hypothetical protein PHAVU_007G267900g [Phaseolus vulgaris]
 gb|ESW17783.1| hypothetical protein PHAVU_007G267900g [Phaseolus vulgaris]
Length=649

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 61/109 (56%), Gaps = 12/109 (11%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPA-AGTNFAFLNS-ITSGGNAV  391
            MATYF  N +IQ G DGLQTL+LMN + YV   +SD  P   G N  FLNS  T   N  
Sbjct  1    MATYFQSNPKIQSGADGLQTLVLMN-SDYVQ--YSDAPPPHHGGNHLFLNSAATVANNTS  57

Query  392  TLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
             L+    P   +QQFVG+PL+  A   QE          HD++ALHGF+
Sbjct  58   LLNLPHAPSPHTQQFVGVPLSATA---QEPPPPMP----HDVSALHGFL  99



>ref|XP_004171976.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 gb|KGN59214.1| hypothetical protein Csa_3G782620 [Cucumis sativus]
Length=716

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 65/115 (57%), Gaps = 11/115 (10%)
 Frame = +2

Query  218  MATYFHGNS-EIQGGGDGLQTLILMNPAGYVNVGFSDT-----QPAAGTNFAFLNSITSG  379
            MATY HGNS + Q    GLQTL+LMNP  YV   FSDT      P +  N  F NS +S 
Sbjct  1    MATYLHGNSDQFQSSDGGLQTLVLMNPT-YVQ--FSDTTPPPPPPPSHPNLLFFNSPSST  57

Query  380  GNAVTLSHAppppsqsqqFVGIPLAT--AAGSHQEAHASAVHSQQHDITALHGFI  538
             N  T    PPP S +QQFVGIPL T  AA    + H S   +  HDI+ LHGF+
Sbjct  58   ANTFTTLVQPPPSSHTQQFVGIPLQTTSAASPTSQDHNSHPLNPHHDISPLHGFV  112



>ref|XP_004136516.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
Length=716

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 65/115 (57%), Gaps = 11/115 (10%)
 Frame = +2

Query  218  MATYFHGNS-EIQGGGDGLQTLILMNPAGYVNVGFSDT-----QPAAGTNFAFLNSITSG  379
            MATY HGNS + Q    GLQTL+LMNP  YV   FSDT      P +  N  F NS +S 
Sbjct  1    MATYLHGNSDQFQSSDGGLQTLVLMNPT-YVQ--FSDTTPPPPPPPSHPNLLFFNSPSST  57

Query  380  GNAVTLSHAppppsqsqqFVGIPLAT--AAGSHQEAHASAVHSQQHDITALHGFI  538
             N  T    PPP S +QQFVGIPL T  AA    + H S   +  HDI+ LHGF+
Sbjct  58   ANTFTTLVQPPPSSHTQQFVGIPLQTTSAASPTSQDHNSHPLNPHHDISPLHGFV  112



>gb|KHN08605.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=679

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 70/118 (59%), Gaps = 22/118 (19%)
 Frame = +2

Query  218  MATYFH-GNSEIQ-GGGDGLQTLILMNPAGYVNVGFSDTQPA------AGTNFAFLN--S  367
            MATYFH GNSEIQ GG DGLQTL+LMNP GY++  +SD          A  N  FLN  +
Sbjct  1    MATYFHHGNSEIQSGGADGLQTLVLMNP-GYIH--YSDAPQQQQQSSLAAGNLVFLNPAA  57

Query  368  ITSGGNAVTLSHAppppsqsqqFVGIPLATAAG-SHQEAHASAVHSQQHDITALHGFI  538
            +  G N     HA  PPS +QQFVG+PL  +   +H   HA       HD++ALHGF+
Sbjct  58   VAGGNNNSFNPHA--PPSHTQQFVGVPLPNSQDLNHHSMHA------HHDVSALHGFL  107



>ref|XP_003554466.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006604654.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=680

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 73/120 (61%), Gaps = 25/120 (21%)
 Frame = +2

Query  218  MATYFH-GNSEIQ-GGGDGLQTLILMNPAGYVNVGFSD--------TQPAAGTNFAFLN-  364
            MATYFH GNSEIQ GG DGLQTL+LMNP GY++  +SD        +  AAG N  FLN 
Sbjct  1    MATYFHHGNSEIQSGGADGLQTLVLMNP-GYIH--YSDAPQQQQQQSSLAAG-NLVFLNP  56

Query  365  -SITSGGNAVTLSHAppppsqsqqFVGIPLATAAG-SHQEAHASAVHSQQHDITALHGFI  538
             ++  G N     HA  PPS +QQFVG+PL  +   +H   HA       HD++ALHGF+
Sbjct  57   AAVAGGNNNSFNPHA--PPSHTQQFVGVPLPNSQDLNHHSMHA------HHDVSALHGFL  108



>ref|XP_002524053.1| bel1 homeotic protein, putative [Ricinus communis]
 gb|EEF38263.1| bel1 homeotic protein, putative [Ricinus communis]
Length=679

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 56/109 (51%), Gaps = 22/109 (20%)
 Frame = +2

Query  218  MATYFHGNSEIQ-GGGDGLQTLILMNPAGYVNVGFSDTQPA-AGTNFAFLNSITSGGNAV  391
            MATYFHGN EIQ    +GLQTL+LMNP  YV   +SDT P    +N  FLNS  S  N  
Sbjct  1    MATYFHGNPEIQAAAAEGLQTLVLMNPT-YVQ--YSDTPPPQPSSNLVFLNSAAS--NLT  55

Query  392  TLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
               H    P  +QQFVGIPL   +               HD + LHG +
Sbjct  56   PPPHFSHAPPSTQQFVGIPLDPNS---------------HDTSTLHGLV  89



>ref|XP_008449596.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
 ref|XP_008449597.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
Length=693

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 49/90 (54%), Gaps = 7/90 (8%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLN-SITSGGNAVT  394
            MATYFHG SEIQ   DG+ TL LMNP  Y  V +SDT   +  N  FLN S T   N  T
Sbjct  1    MATYFHGGSEIQTNSDGIHTLYLMNP-NY--VPYSDTHSQSSHNMLFLNPSSTHALNPST  57

Query  395  LSHAppppsqsqqFVGIPLATAAGSHQEAH  484
            L HA   P  +  FVGIPL T   S    H
Sbjct  58   LPHA---PPSNNHFVGIPLPTTDSSRPSFH  84



>gb|KHG11906.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=680

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 60/114 (53%), Gaps = 26/114 (23%)
 Frame = +2

Query  209  QRK---MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITS  376
            QRK   M+TYFHGN EIQ   DGLQTL+LMNPA YV   +SDT  P    N  F N    
Sbjct  22   QRKQHPMSTYFHGNPEIQASTDGLQTLVLMNPA-YVQ--YSDTPPPPPANNLLFFNP---  75

Query  377  GGNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
              N+++           QQ VGIPL   + ++Q   +       HDI+ LHG +
Sbjct  76   --NSLSPPQT-------QQLVGIPLPATSAANQGPTS-------HDISPLHGLV  113



>ref|XP_010107002.1| hypothetical protein L484_016932 [Morus notabilis]
 gb|EXC13000.1| hypothetical protein L484_016932 [Morus notabilis]
Length=241

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 38/56 (68%), Gaps = 8/56 (14%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGD-GLQTLILMNPAGYVNVGFSDTQP-----AAGTNFAFLNS  367
            MATYFHGNSEIQ   D GLQTL+LMNP GY+   +SD+ P     AA  N  FLNS
Sbjct  1    MATYFHGNSEIQAATDGGLQTLVLMNPTGYIP--YSDSPPPPHSAAAQGNLFFLNS  54



>gb|EYU25630.1| hypothetical protein MIMGU_mgv11b017830mg, partial [Erythranthe 
guttata]
Length=295

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 71/119 (60%), Gaps = 21/119 (18%)
 Frame = +2

Query  218  MATYFHGNSEIQ-----GGGDGLQTLILMNPAGYVNVGFSD---TQPAAGTNFAFLNSIT  373
            MATYFHGNSE Q     GGGDGLQTLILMNP GYV  G+SD    Q    +NF FLNS  
Sbjct  1    MATYFHGNSENQGGGGGGGGDGLQTLILMNP-GYVG-GYSDNNNNQHPPNSNFVFLNSNN  58

Query  374  SGGNAVT----LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
              GN       L HA PP SQ+Q FVGIPL   A       AS    QQ D++ALHGF+
Sbjct  59   ISGNNNNSSHHLPHA-PPSSQTQHFVGIPLQGTAS------ASGQDPQQQDVSALHGFL  110



>ref|XP_004140170.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 ref|XP_004156066.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 gb|KGN48050.1| hypothetical protein Csa_6G426360 [Cucumis sativus]
Length=698

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 46/81 (57%), Gaps = 7/81 (9%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLN-SITSGGNAVT  394
            MATYFHG SEIQ   DG+ TL LMNP  Y  V +SDT   +  N  FLN S T   N  T
Sbjct  1    MATYFHGGSEIQNNSDGIHTLYLMNP-NY--VPYSDTHSQSSHNMLFLNPSSTHALNPST  57

Query  395  LSHAppppsqsqqFVGIPLAT  457
            L H    P  +  FVGIPL T
Sbjct  58   LPHP---PPSNNHFVGIPLPT  75



>gb|KHG11905.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=653

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 57/108 (53%), Gaps = 23/108 (21%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITSGGNAVT  394
            M+TYFHGN EIQ   DGLQTL+LMNPA YV   +SDT  P    N  F N      N+++
Sbjct  1    MSTYFHGNPEIQASTDGLQTLVLMNPA-YVQ--YSDTPPPPPANNLLFFNP-----NSLS  52

Query  395  LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
                       QQ VGIPL   + ++Q   +       HDI+ LHG +
Sbjct  53   PPQT-------QQLVGIPLPATSAANQGPTS-------HDISPLHGLV  86



>gb|KJB36260.1| hypothetical protein B456_006G149100 [Gossypium raimondii]
Length=644

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 60/108 (56%), Gaps = 24/108 (22%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  397
            MATYFHGN EIQ   D LQTL+LMNPA YV+   +   P    N  F+NS++    +   
Sbjct  1    MATYFHGNPEIQ-AADDLQTLVLMNPA-YVHYSNTPPPPPPSNNLVFVNSLSPNAPS---  55

Query  398  SHAppppsqsqqFVGIPL-ATAAGSHQEAHASAVHSQQHDITALHGFI  538
            SH+       QQ VGIPL A  +GS+Q+A           I++LHG +
Sbjct  56   SHS-------QQLVGIPLPAVTSGSNQDA-----------ISSLHGLV  85



>gb|KHG01894.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=634

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 56/107 (52%), Gaps = 25/107 (23%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  397
            MATYFHGN EIQ   DGLQTL+LMNPA YV   +SDT P    N           +A   
Sbjct  1    MATYFHGNPEIQ-APDGLQTLVLMNPA-YVQ--YSDTTPPPQPNNLVF-------HAPPP  49

Query  398  SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
             H        QQFVG+PL   + ++Q+  +       H+I+ LHG +
Sbjct  50   PHT-------QQFVGVPLTATSTANQDPPS-------HEISPLHGLV  82



>gb|KJB55565.1| hypothetical protein B456_009G082700 [Gossypium raimondii]
 gb|KJB55566.1| hypothetical protein B456_009G082700 [Gossypium raimondii]
Length=721

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 51/84 (61%), Gaps = 9/84 (11%)
 Frame = +2

Query  218  MATYFHGNSEIQGG---GDGLQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITSGGN  385
            MATY HG+SE Q      DG+QTL LMNP  YV   +SDT QPA  TN  FLN   +  N
Sbjct  1    MATYIHGSSEFQAAPAASDGMQTLYLMNP-NYV--PYSDTHQPATATNMFFLNPAGNSLN  57

Query  386  AVTLSHAppppsqsqqFVGIPLAT  457
             ++L HA  PPS    F+G+PL +
Sbjct  58   PISLPHA--PPSNYNHFLGLPLPS  79



>gb|KJB09137.1| hypothetical protein B456_001G125400 [Gossypium raimondii]
 gb|KJB09138.1| hypothetical protein B456_001G125400 [Gossypium raimondii]
 gb|KJB09139.1| hypothetical protein B456_001G125400 [Gossypium raimondii]
Length=693

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 59/112 (53%), Gaps = 14/112 (13%)
 Frame = +2

Query  218  MATYFHGNSEIQGGG----DGLQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITSGG  382
            MATYFHG+SE Q       DG+QTL LMNP  Y  + +SDT QP A TN  FLN   +  
Sbjct  1    MATYFHGSSEFQAASVASPDGMQTLYLMNP-NY--IPYSDTNQPFAATNLFFLNPAGNAL  57

Query  383  NAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
            N  +  H   PP      +G+PL T   S   A+++  H      ++LHG +
Sbjct  58   NPSSFPHT--PPPNYHHLLGLPLPTPTASIVPANSNETHRP----SSLHGIV  103



>ref|XP_010059079.1| PREDICTED: BEL1-like homeodomain protein 1 [Eucalyptus grandis]
 gb|KCW90459.1| hypothetical protein EUGRSUZ_A02588 [Eucalyptus grandis]
 gb|KCW90460.1| hypothetical protein EUGRSUZ_A02588 [Eucalyptus grandis]
Length=703

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 59/108 (55%), Gaps = 19/108 (18%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFA-FLNSITSGGNAVT  394
            MATY+H +S    G   LQTL+LMNPA YV+  +SD  P      A FLNS T+G  A  
Sbjct  1    MATYYHQSSSDPDGA--LQTLVLMNPASYVH--YSDAPPPHQQPSAIFLNSSTAGPPASQ  56

Query  395  LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
                         FVGIPL    GS  ++  S++H   HD++++HGF+
Sbjct  57   TQQ----------FVGIPL---PGSAADSQPSSMHV-NHDLSSMHGFM  90



>ref|XP_009403681.1| PREDICTED: BEL1-like homeodomain protein 1 [Musa acuminata subsp. 
malaccensis]
Length=540

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 56/109 (51%), Gaps = 15/109 (14%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNP--AGYVNVGFSDTQPAAGTNFAFLNSITSGGNAV  391
            MAT+ HG  E+Q   DGLQTL LMNP  AGY++        AA  N   LNS  +  N +
Sbjct  1    MATFIHGAPEVQP--DGLQTLFLMNPGYAGYMDA-------AAPANMVLLNSTMNSLNPI  51

Query  392  TLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHD---ITALH  529
             L+ A  P  Q Q FVGIPL  AA          +H+  HD   +T LH
Sbjct  52   ILAQAGQPNQQQQDFVGIPLQPAARLRDSDRPLPIHA-SHDASVLTRLH  99



>ref|XP_008799712.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008799713.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
Length=673

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 56/105 (53%), Gaps = 10/105 (10%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  397
            MATYFHG  E Q   DGLQTL LMNP  Y  VG+SDT  AA  N   LNS  +  N V L
Sbjct  1    MATYFHGAPEFQ--ADGLQTLYLMNP-NY--VGYSDT--AAPANMILLNSAMNSLNPVNL  53

Query  398  SH--AppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITAL  526
             H  A   P+Q Q   GIP      SH+    S + +  HD +A+
Sbjct  54   GHCAAMAQPNQQQHLAGIPPQPTVASHESNRLSFIQA-SHDGSAI  97



>ref|XP_008387112.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008387113.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008387114.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=703

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 67/125 (54%), Gaps = 26/125 (21%)
 Frame = +2

Query  218  MATYFH---GNS-EIQGGGD-GLQTLILMNPAGYVNVGFSDTQPA-----------AGTN  349
            MATYFH   GNS EIQ   D  LQTL+LMNP+    V +SDT P            A TN
Sbjct  1    MATYFHHHRGNSSEIQASSDSALQTLVLMNPS---YVPYSDTPPPPQQQQQPQTPPAATN  57

Query  350  FAFLNSITSG--GNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITA  523
              FLNS  +    +  TLSHAPP   Q   FVGIPLA    S+    + ++H   HDI+ 
Sbjct  58   LVFLNSAANSLTHHPSTLSHAPPSHHQQ--FVGIPLAQDPNSNS---SQSMHHPHHDIST  112

Query  524  LHGFI  538
            LH F+
Sbjct  113  LHAFM  117



>gb|KHF99976.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=693

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 58/112 (52%), Gaps = 14/112 (13%)
 Frame = +2

Query  218  MATYFHGNSEIQGGG----DGLQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITSGG  382
            MATY HG+SE Q       DG+QTL LMNP  Y+   +SDT QP A TN  FLN   +  
Sbjct  1    MATYSHGSSEFQAASVAAPDGMQTLYLMNP-NYI--PYSDTNQPVAATNLLFLNPAGNAL  57

Query  383  NAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
            N  +  H   PP      +G+PL T   S   A+++  H      ++LHG +
Sbjct  58   NPSSFPHT--PPPNYHHLLGLPLPTPTASIVPANSNETHRP----SSLHGIV  103



>gb|KJB35453.1| hypothetical protein B456_006G115600 [Gossypium raimondii]
Length=717

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 53/95 (56%), Gaps = 10/95 (11%)
 Frame = +2

Query  218  MATYFHGNSEIQGG-GDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVT  394
            MATYFHG+S+ Q    DGLQTL LMNP  YV    +  QP+A TN  FLN  TS   A  
Sbjct  1    MATYFHGSSDFQAASADGLQTLYLMNP-NYVPYADTHQQPSAATNMFFLNP-TSLPQAPP  58

Query  395  LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVH  499
             +H        Q+F+G+PL T + S +  ++   H
Sbjct  59   PNH-------HQRFLGLPLPTPSTSIKPLNSDDPH  86



>ref|XP_008391977.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008391978.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=708

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 68/126 (54%), Gaps = 27/126 (21%)
 Frame = +2

Query  218  MATYFH---GNS-EIQGGGDG-LQTLILMNPAGYVNVGFSDTQP------------AAGT  346
            MA YFH   GNS EIQ   DG LQTL+LMNP GYV   +SDT P            +A T
Sbjct  1    MAAYFHHHGGNSSEIQASSDGALQTLVLMNP-GYVQ--YSDTPPPPQQQQQQPQPPSAAT  57

Query  347  NFAFLNSITSG--GNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDIT  520
            N  FLNS  +    +  TLSHAPP   Q   F+GIPL      +    + ++H   HDI+
Sbjct  58   NLVFLNSAPNSLTHHPSTLSHAPPSHHQQ--FLGIPLTQDPNGNS---SLSMHHPHHDIS  112

Query  521  ALHGFI  538
            ALH F+
Sbjct  113  ALHAFM  118



>gb|KHG12855.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=644

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 58/108 (54%), Gaps = 24/108 (22%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  397
            MA YFHGN EIQ   D LQTL+LMNPA YV+   +   P    N  FLNS++    +   
Sbjct  1    MAAYFHGNPEIQ-AADDLQTLVLMNPA-YVHYSNTPPPPPPSNNLVFLNSLSPNAPS---  55

Query  398  SHAppppsqsqqFVGIPL-ATAAGSHQEAHASAVHSQQHDITALHGFI  538
            SH+       QQ VGIPL A  + S+Q+A           I++LHG +
Sbjct  56   SHS-------QQLVGIPLPAVTSRSNQDA-----------ISSLHGLV  85



>ref|XP_007204250.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 ref|XP_007204251.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 gb|EMJ05449.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 gb|EMJ05450.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
Length=707

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 71/122 (58%), Gaps = 23/122 (19%)
 Frame = +2

Query  218  MATYFH-GNS-EIQGGGDG-LQTLILMNPAGYVNVGFSDTQPAAGT----------NFAF  358
            MATYFH GNS EIQ   DG LQTL+LMNP GYV   +SDT P              N  F
Sbjct  1    MATYFHHGNSSEIQASSDGALQTLVLMNP-GYVQ--YSDTPPPPPHPQPHQPPSAGNLVF  57

Query  359  LNSITSG--GNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHG  532
            LNS T+    +  TLSHA  PPS  QQFVGIPL+    ++   ++ ++H    D+++LH 
Sbjct  58   LNSPTNSLPHHPSTLSHA--PPSHPQQFVGIPLSHDPNNN---NSPSMHQAHPDLSSLHA  112

Query  533  FI  538
            F+
Sbjct  113  FM  114



>gb|KHG12856.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=763

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 58/108 (54%), Gaps = 24/108 (22%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  397
            MA YFHGN EIQ   D LQTL+LMNPA YV+   +   P    N  FLNS++    +   
Sbjct  120  MAAYFHGNPEIQ-AADDLQTLVLMNPA-YVHYSNTPPPPPPSNNLVFLNSLSPNAPS---  174

Query  398  SHAppppsqsqqFVGIPL-ATAAGSHQEAHASAVHSQQHDITALHGFI  538
            SH+       QQ VGIPL A  + S+Q+A           I++LHG +
Sbjct  175  SHS-------QQLVGIPLPAVTSRSNQDA-----------ISSLHGLV  204



>ref|XP_011090301.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
 ref|XP_011090302.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
Length=629

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 58/108 (54%), Gaps = 16/108 (15%)
 Frame = +2

Query  227  YFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGG----NAVT  394
            YF G+SEIQ   D LQTL LMNP  Y  VG+SD       N  F NS T+      N   
Sbjct  2    YFQGSSEIQA--DALQTLYLMNP-NY--VGYSDNHHQPQPNILFSNSATAATVQALNPAL  56

Query  395  LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
            + HA  PP+Q+Q FVGIPL     SH  +  S+V  QQ DI A H  I
Sbjct  57   MHHA--PPAQAQHFVGIPL-----SHDPSRPSSVLGQQEDIQATHSTI  97



>ref|XP_010031566.1| PREDICTED: BEL1-like homeodomain protein 1 [Eucalyptus grandis]
 gb|KCW50924.1| hypothetical protein EUGRSUZ_J00574 [Eucalyptus grandis]
Length=693

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 56/109 (51%), Gaps = 19/109 (17%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNP--AGYVNVGFSDTQPAAGTNFAFLN---SITSGG  382
            MATYFHG+SEI+   DGLQTL ++NP    Y N     T P    N  FLN   S T   
Sbjct  1    MATYFHGSSEIE-ATDGLQTLYILNPNFIPYSNAAHDATAP----NTLFLNPMGSATQPA  55

Query  383  NAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALH  529
             +  L+H          FVGIPL+  A     A AS VH  +H+I +LH
Sbjct  56   PSPQLNH--------NHFVGIPLSGPAAPFGPA-ASDVHPNRHEIPSLH  95



>ref|XP_008360598.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008360599.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=710

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 68/128 (53%), Gaps = 29/128 (23%)
 Frame = +2

Query  218  MATYFH---GNS-EIQGGGDG-LQTLILMNPAGYVNVGFSDTQP--------------AA  340
            MA YFH   GNS EIQ   DG LQTL+LMNP GYV   +SDT P              +A
Sbjct  1    MAAYFHHHGGNSSEIQASSDGALQTLVLMNP-GYVQ--YSDTPPPPQQQQQQQQPQPPSA  57

Query  341  GTNFAFLNSITSG--GNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHD  514
             TN  FLNS  +    +  TLSHAPP   Q   F+GIPL      +    + ++H   HD
Sbjct  58   ATNLVFLNSAPNSLTHHPSTLSHAPPSHHQQ--FLGIPLTQDPNGNS---SLSMHHPHHD  112

Query  515  ITALHGFI  538
            I+ALH F+
Sbjct  113  ISALHAFM  120



>ref|XP_007015671.1| BEL1 homeodomain 1, putative [Theobroma cacao]
 gb|EOY33290.1| BEL1 homeodomain 1, putative [Theobroma cacao]
Length=732

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 58/105 (55%), Gaps = 16/105 (15%)
 Frame = +2

Query  218  MATYFHGNSEIQGGG----DG-LQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITSG  379
            MATYFHG+SE Q       DG +QTL LMNP  YV   +SDT QPAA TN  FLN   + 
Sbjct  1    MATYFHGSSEFQAASAAAPDGTMQTLYLMNP-NYV--PYSDTHQPAAATNMFFLNPAGNA  57

Query  380  GNAVTLSHAppppsqsqqFVGIPLATAA-----GSHQEAHASAVH  499
             N  +L HA  PP      +G+PL T A     GS  + H  ++H
Sbjct  58   LNPTSLHHA--PPPNHHHLLGLPLPTPAASIGPGSSDDPHRPSLH  100



>ref|XP_008241058.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241059.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241060.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241062.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
Length=710

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 72/125 (58%), Gaps = 26/125 (21%)
 Frame = +2

Query  218  MATYFH-GNS-EIQGGGDG-LQTLILMNPAGYVNVGFSDTQPAAGT-------------N  349
            MATYFH GNS EIQ   DG LQTL+LMNP GYV   +SDT P                 N
Sbjct  1    MATYFHHGNSSEIQASSDGALQTLVLMNP-GYVQ--YSDTPPPPPHQQQQQPHQPPSAGN  57

Query  350  FAFLNSITSG--GNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITA  523
              FLNS T+    +  TLSHA  PPS +QQFVGIPL+    ++   ++ ++H    D+++
Sbjct  58   LVFLNSPTNSLPHHPSTLSHA--PPSHAQQFVGIPLSHDPNNN---NSPSMHQAHPDLSS  112

Query  524  LHGFI  538
            LH F+
Sbjct  113  LHAFM  117



>gb|KEH24245.1| BEL1-related homeotic protein [Medicago truncatula]
Length=660

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 59/92 (64%), Gaps = 20/92 (22%)
 Frame = +2

Query  218  MATYFHG-NSEIQ----GGGDGLQTLILMNPAGYVNVGFSD-------TQPAAGT--NFA  355
            MATY+HG NSEIQ    GG DGLQTL+LMNP+ Y+   +SD        QP+  T  N+ 
Sbjct  1    MATYYHGGNSEIQSSGGGGADGLQTLVLMNPS-YIQ--YSDASQQQQAQQPSHATAGNYV  57

Query  356  FLNSITSGGNAVTLSHAppppsqsqqFVGIPL  451
            FLNS  +  N+ +  HA  PPS +QQFVGIPL
Sbjct  58   FLNSTAAENNSFS-PHA--PPSNTQQFVGIPL  86



>ref|XP_009348973.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
 ref|XP_009348980.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
 ref|XP_009348985.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
Length=710

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 70/128 (55%), Gaps = 29/128 (23%)
 Frame = +2

Query  218  MATYFH---GNS-EIQGGGDG-LQTLILMNPAGYVNVGFSDT--------------QPAA  340
            MA YFH   GNS EIQ   DG LQTL+LMNP GYV   +SDT               P+A
Sbjct  1    MAAYFHHHGGNSSEIQASSDGALQTLVLMNP-GYVQ--YSDTPPPPQQQQQQQQPQPPSA  57

Query  341  GTNFAFLNSITSG--GNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHD  514
             TN  FLNS  +    +  TLSHA  PPS  QQF+GIPL      +    + ++H   +D
Sbjct  58   ATNLVFLNSAPNSLTHHPSTLSHA--PPSHHQQFLGIPLTQDPNGNS---SLSMHHPHND  112

Query  515  ITALHGFI  538
            I+ALH F+
Sbjct  113  ISALHAFM  120



>ref|XP_009629592.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009629593.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
Length=730

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 56/107 (52%), Gaps = 16/107 (15%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNP--AGYVNVGFSDTQPAAGTNFAFLNSITSGGNAV  391
            MA Y+ G+SEIQ   DGLQTL LMNP   GY +      Q     N  FLNS T+G    
Sbjct  1    MAMYYQGSSEIQ--ADGLQTLYLMNPNYIGYTDTQQQQQQHLQQANMFFLNSATAGN---  55

Query  392  TLSHAppppsq-sqqFVGIPLATAAGSHQEAHASAVHSQQHDITALH  529
             L+H P P    +Q FVG+PL T+   H  +  S      HD++A H
Sbjct  56   -LAHGPLPSQAHTQHFVGVPLPTSF--HDPSRPSV-----HDVSASH  94



>gb|KJB16539.1| hypothetical protein B456_002G234900 [Gossypium raimondii]
 gb|KJB16540.1| hypothetical protein B456_002G234900 [Gossypium raimondii]
Length=634

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 56/107 (52%), Gaps = 25/107 (23%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  397
            MATYFHGN EIQ   DGLQTL+LMNPA YV   +SDT P    N           +A   
Sbjct  1    MATYFHGNPEIQ-APDGLQTLVLMNPA-YVQ--YSDTTPPPPPNNLVF-------HAPPP  49

Query  398  SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  538
             H        QQFVG+PL   + ++Q+  +       H+I+ LHG +
Sbjct  50   PHT-------QQFVGVPLTATSTANQDPPS-------HEISPLHGLV  82



>emb|CDP15553.1| unnamed protein product [Coffea canephora]
Length=725

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 58/107 (54%), Gaps = 21/107 (20%)
 Frame = +2

Query  218  MATYFHGNSEIQGGGDGLQTLILMNP--AGYVNVGFSD--TQPAAGTNFAFLNSITSGGN  385
            MA Y+ G SEIQ   DGLQTL LMNP  AG    G+SD   QPA   N   LN  T  GN
Sbjct  1    MAMYYQGGSEIQA--DGLQTLYLMNPNYAG----GYSDAQQQPA---NMVILNYAT--GN  49

Query  386  AVTL-SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITA  523
             V L S A     Q+Q  VG+PL  + GS     A+  H  +H+++A
Sbjct  50   TVNLASLASNQQPQTQHLVGVPLQGSLGS-----AANSHELKHEVSA  91



>ref|XP_004978737.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Setaria 
italica]
 ref|XP_004978738.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Setaria 
italica]
 ref|XP_004978739.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Setaria 
italica]
 ref|XP_004978740.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X4 [Setaria 
italica]
 ref|XP_004978741.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X5 [Setaria 
italica]
 ref|XP_004978742.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X6 [Setaria 
italica]
 ref|XP_004978743.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X7 [Setaria 
italica]
 ref|XP_004978744.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X8 [Setaria 
italica]
Length=662

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 44/84 (52%), Gaps = 9/84 (11%)
 Frame = +2

Query  218  MATYFHGN--SEIQGGGDGLQTLILMNP---AGYVNVGFSDTQPAAGTNFAFLNSITSGG  382
            MA Y+HG   ++IQ   DGLQTL LMNP   AGY + G S   PA   N   LNS  S  
Sbjct  1    MAAYYHGGAGTDIQASTDGLQTLYLMNPSYTAGYADAGASPPGPA---NMMLLNSAVSTM  57

Query  383  NAVTLS-HAppppsqsqqFVGIPL  451
               +   H   P +  Q FVGIPL
Sbjct  58   TPASFGHHQQSPSAAQQHFVGIPL  81



>ref|XP_010931060.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
 ref|XP_010931061.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
Length=621

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 55/105 (52%), Gaps = 12/105 (11%)
 Frame = +2

Query  218  MATYFHG-NSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVT  394
            MATYFHG  +E Q   DGLQTL LMNP  Y    +SDT  A   N   LNS+ S  N   
Sbjct  1    MATYFHGAPAEFQA--DGLQTLYLMNP-NY--AAYSDT--AVPANMILLNSVNS-LNPTN  52

Query  395  LSH--AppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITA  523
            L H  A   P+Q Q F GIPL     +H+     ++    HD++A
Sbjct  53   LGHCAATAQPNQHQHFAGIPLQPPVAAHESNRLPSIQP-SHDVSA  96



>ref|XP_002450321.1| hypothetical protein SORBIDRAFT_05g003750 [Sorghum bicolor]
 gb|EES09309.1| hypothetical protein SORBIDRAFT_05g003750 [Sorghum bicolor]
Length=690

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 47/91 (52%), Gaps = 14/91 (15%)
 Frame = +2

Query  218  MATYFHGN--SEIQGGGDGLQTLILMNP--AGYVNVGFSDTQPAAGTNFAFLNSITSGGN  385
            MA Y+HG   ++IQ   DGLQTL LMNP  AGY + G + T P A TN   LNS  +   
Sbjct  1    MAAYYHGGAGTDIQASTDGLQTLYLMNPSYAGYADDGGASTAPGA-TNMMLLNSAVTTMT  59

Query  386  AVTLSH---------AppppsqsqqFVGIPL  451
              + +H         +     Q Q FVGIPL
Sbjct  60   PASFAHHHQQQQSPSSAAHHQQQQHFVGIPL  90



>ref|XP_009141535.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
 ref|XP_009141536.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
 ref|XP_009141537.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
Length=675

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 54/118 (46%), Gaps = 32/118 (27%)
 Frame = +2

Query  218  MATYFHGN-SEIQGGGDG-LQTLILMNPAGYVNVGFSDTQ----------PAAGTNFAFL  361
            MA YFHGN SEI  G DG LQTLILMNP  YV     D                 +F FL
Sbjct  1    MAAYFHGNPSEISAGPDGGLQTLILMNPTTYVQYTQQDDDSNNNNNSNNNANNNNSFVFL  60

Query  362  NSITSGGNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGF  535
            +S     NA            SQQFVGIPL+         H +A  +   +I+ LHG+
Sbjct  61   DSHAPPQNA------------SQQFVGIPLS--------GHEAASITAADNISVLHGY  98



>ref|XP_006410764.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 ref|XP_006410765.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 ref|XP_006410766.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 gb|ESQ52217.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 gb|ESQ52218.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 gb|ESQ52219.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
Length=677

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 55/108 (51%), Gaps = 10/108 (9%)
 Frame = +2

Query  218  MATYFHGNS-EIQGGGDG-LQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAV  391
            MA YFHGN  EI  G DG LQTLILMNP  YV     D       N    N+  +  + V
Sbjct  1    MAAYFHGNPPEISAGSDGGLQTLILMNPTTYVQYTQQDNDSNNNINNNSNNNTNNNNSFV  60

Query  392  TLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGF  535
             L    PP + SQQFVGIPL+         H +A  +   +I+ LHG+
Sbjct  61   FLDSHAPPQNTSQQFVGIPLS--------GHEAASITAADNISVLHGY  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551443513800