BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS051C06

Length=618
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009803270.1|  PREDICTED: scarecrow-like protein 15               200   5e-57   Nicotiana sylvestris
ref|XP_009590475.1|  PREDICTED: scarecrow-like protein 15               195   2e-55   Nicotiana tomentosiformis
ref|XP_004232383.1|  PREDICTED: scarecrow-like protein 15               189   3e-53   Solanum lycopersicum
ref|XP_006363143.1|  PREDICTED: scarecrow-like protein 15-like          188   1e-52   Solanum tuberosum [potatoes]
gb|ABU45198.1|  unknown                                                 184   3e-51   Petunia integrifolia subsp. inflata
gb|ABU45212.1|  unknown                                                 183   6e-51   Solanum bulbocastanum [ornamental nightshade]
gb|ABU45178.1|  unknown                                                 180   9e-50   Solanum melongena [aubergine]
ref|XP_011097216.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    164   7e-44   
emb|CDP02813.1|  unnamed protein product                                152   2e-39   Coffea canephora [robusta coffee]
gb|EYU28571.1|  hypothetical protein MIMGU_mgv1a003577mg                151   4e-39   Erythranthe guttata [common monkey flower]
ref|XP_011099583.1|  PREDICTED: scarecrow-like protein 15               150   6e-39   Sesamum indicum [beniseed]
ref|XP_002310797.1|  hypothetical protein POPTR_0007s12480g             147   1e-37   Populus trichocarpa [western balsam poplar]
ref|XP_011025728.1|  PREDICTED: scarecrow-like protein 15               145   4e-37   Populus euphratica
ref|XP_010999954.1|  PREDICTED: scarecrow-like protein 15               140   2e-35   Populus euphratica
ref|XP_006383233.1|  scarecrow transcription factor family protein      140   3e-35   
ref|XP_007203757.1|  hypothetical protein PRUPE_ppa003675mg             129   2e-31   Prunus persica
gb|KDO36173.1|  hypothetical protein CISIN_1g048701mg                   129   2e-31   Citrus sinensis [apfelsine]
ref|XP_007156910.1|  hypothetical protein PHAVU_002G027500g             128   3e-31   Phaseolus vulgaris [French bean]
gb|KDP31796.1|  hypothetical protein JCGZ_12257                         128   5e-31   Jatropha curcas
ref|XP_006425721.1|  hypothetical protein CICLE_v10025246mg             128   6e-31   Citrus clementina [clementine]
gb|EPS63021.1|  hypothetical protein M569_11763                         127   1e-30   Genlisea aurea
ref|XP_002525108.1|  DELLA protein GAIP-B, putative                     127   2e-30   Ricinus communis
ref|XP_008241642.1|  PREDICTED: scarecrow-like protein 15               126   3e-30   Prunus mume [ume]
ref|XP_002268445.1|  PREDICTED: scarecrow-like protein 15               125   6e-30   Vitis vinifera
emb|CBI17555.3|  unnamed protein product                                125   6e-30   Vitis vinifera
ref|XP_006297491.1|  hypothetical protein CARUB_v10013509mg             124   1e-29   Capsella rubella
ref|XP_008363118.1|  PREDICTED: scarecrow-like protein 15               124   2e-29   
ref|XP_010467682.1|  PREDICTED: scarecrow-like protein 15               124   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_008393455.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    124   2e-29   Malus domestica [apple tree]
ref|XP_003538842.1|  PREDICTED: scarecrow-like protein 15-like          123   3e-29   Glycine max [soybeans]
ref|XP_003517241.1|  PREDICTED: scarecrow-like protein 15-like          122   4e-29   Glycine max [soybeans]
ref|XP_010531168.1|  PREDICTED: scarecrow-like protein 15               119   9e-28   Tarenaya hassleriana [spider flower]
ref|XP_010099836.1|  hypothetical protein L484_009050                   119   2e-27   Morus notabilis
ref|XP_006409136.1|  hypothetical protein EUTSA_v10023133mg             117   3e-27   Eutrema salsugineum [saltwater cress]
gb|KJB17813.1|  hypothetical protein B456_003G016500                    117   4e-27   Gossypium raimondii
ref|XP_007046999.1|  GRAS family transcription factor, putative         118   6e-27   
ref|XP_004300613.1|  PREDICTED: scarecrow-like protein 15               116   1e-26   Fragaria vesca subsp. vesca
ref|XP_008453725.1|  PREDICTED: scarecrow-like protein 15               115   2e-26   Cucumis melo [Oriental melon]
ref|XP_010489558.1|  PREDICTED: scarecrow-like protein 15               115   2e-26   Camelina sativa [gold-of-pleasure]
gb|EPS73060.1|  hypothetical protein M569_01698                         112   1e-25   Genlisea aurea
ref|XP_009114695.1|  PREDICTED: scarecrow-like protein 15               112   1e-25   Brassica rapa
ref|XP_004509243.1|  PREDICTED: scarecrow-like protein 15-like          112   2e-25   Cicer arietinum [garbanzo]
gb|KGN53268.1|  GRAS family transcription factor                        112   4e-25   Cucumis sativus [cucumbers]
ref|XP_004146542.1|  PREDICTED: scarecrow-like protein 15-like          112   4e-25   
ref|XP_004172401.1|  PREDICTED: scarecrow-like protein 15-like          111   5e-25   
emb|CDY43895.1|  BnaA07g01720D                                          110   6e-25   Brassica napus [oilseed rape]
ref|XP_003629479.1|  GRAS family transcription factor                   110   2e-24   Medicago truncatula
emb|CDY13032.1|  BnaC07g03310D                                          108   3e-24   Brassica napus [oilseed rape]
ref|XP_010548348.1|  PREDICTED: scarecrow-like protein 15               108   1e-23   Tarenaya hassleriana [spider flower]
gb|EYU44670.1|  hypothetical protein MIMGU_mgv1a026210mg                107   1e-23   Erythranthe guttata [common monkey flower]
ref|XP_004146541.1|  PREDICTED: scarecrow-like protein 15-like          107   1e-23   Cucumis sativus [cucumbers]
ref|XP_010667697.1|  PREDICTED: scarecrow-like protein 15               106   7e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008453726.1|  PREDICTED: scarecrow-like protein 15               103   3e-22   Cucumis melo [Oriental melon]
gb|KFK40237.1|  hypothetical protein AALP_AA3G348400                    101   8e-22   Arabis alpina [alpine rockcress]
ref|XP_009356715.1|  PREDICTED: scarecrow-like protein 15             99.4    9e-22   
ref|XP_009142446.1|  PREDICTED: scarecrow-like protein 15               102   1e-21   Brassica rapa
ref|XP_003519903.1|  PREDICTED: scarecrow-like protein 15-like          102   1e-21   Glycine max [soybeans]
emb|CDX69238.1|  BnaC01g02150D                                          101   1e-21   
ref|XP_009374236.1|  PREDICTED: scarecrow-like protein 15               102   2e-21   
gb|KJB71048.1|  hypothetical protein B456_011G102400                    100   3e-21   Gossypium raimondii
ref|XP_006283643.1|  hypothetical protein CARUB_v10004700mg           99.0    1e-20   Capsella rubella
gb|AAT75161.1|  SCARECROW-like protein                                97.4    3e-20   Brassica napus [oilseed rape]
ref|XP_006411970.1|  hypothetical protein EUTSA_v10025054mg           97.1    6e-20   Eutrema salsugineum [saltwater cress]
ref|XP_010432142.1|  PREDICTED: scarecrow-like protein 15             95.5    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010437311.1|  PREDICTED: scarecrow-like protein 15 isoform X1  95.5    2e-19   
ref|XP_010437312.1|  PREDICTED: scarecrow-like protein 15 isoform X2  95.5    2e-19   Camelina sativa [gold-of-pleasure]
dbj|BAP91520.1|  gras family protein                                  95.5    3e-19   Glycine max [soybeans]
ref|XP_010446751.1|  PREDICTED: scarecrow-like protein 15 isoform X3  95.1    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010446749.1|  PREDICTED: scarecrow-like protein 15 isoform X1  95.1    4e-19   
ref|XP_003547994.1|  PREDICTED: scarecrow-like protein 15-like        94.4    8e-19   Glycine max [soybeans]
ref|NP_195389.4|  scarecrow-like protein 15                           93.6    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869027.1|  hypothetical protein ARALYDRAFT_490963           93.6    1e-18   
emb|CAB16826.1|  SCARECROW-like protein                               93.2    1e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30292.1|  hypothetical protein AALP_AA7G242600                  93.2    2e-18   Arabis alpina [alpine rockcress]
ref|XP_010070042.1|  PREDICTED: scarecrow-like protein 15             90.5    1e-17   Eucalyptus grandis [rose gum]
ref|XP_007156025.1|  hypothetical protein PHAVU_003G252200g           89.7    3e-17   Phaseolus vulgaris [French bean]
gb|KDO59927.1|  hypothetical protein CISIN_1g007284mg                 88.6    8e-17   Citrus sinensis [apfelsine]
ref|XP_006428037.1|  hypothetical protein CICLE_v10025197mg           87.4    3e-16   Citrus clementina [clementine]
ref|XP_010255200.1|  PREDICTED: scarecrow-like protein 15             83.6    3e-15   Nelumbo nucifera [Indian lotus]
gb|ACB31517.1|  SCL6-IV                                               57.8    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191926.1|  protein LOST MERISTEMS 3                            57.4    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872967.1|  hypothetical protein ARALYDRAFT_490555           57.4    2e-06   
gb|AAD24406.1|AF036303_1  scarecrow-like 6                            56.6    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287420.1|  hypothetical protein CARUB_v10000626mg           56.2    4e-06   Capsella rubella
ref|XP_009394367.1|  PREDICTED: scarecrow-like protein 15             56.2    4e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010426616.1|  PREDICTED: scarecrow-like protein 6 isoform X1   55.8    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010456318.1|  PREDICTED: scarecrow-like protein 6              55.8    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010419547.1|  PREDICTED: scarecrow-like protein 6 isoform X2   55.8    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010426622.1|  PREDICTED: scarecrow-like protein 6 isoform X2   55.8    6e-06   
gb|KFK30592.1|  hypothetical protein AALP_AA6G001700                  55.5    8e-06   Arabis alpina [alpine rockcress]
ref|XP_010419546.1|  PREDICTED: scarecrow-like protein 6 isoform X1   54.7    1e-05   
ref|XP_008795618.1|  PREDICTED: scarecrow-like protein 15             54.7    1e-05   Phoenix dactylifera
ref|XP_004163758.1|  PREDICTED: scarecrow-like protein 6-like         54.7    2e-05   
ref|XP_008458131.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...  54.7    2e-05   Cucumis melo [Oriental melon]
ref|XP_004140608.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...  54.7    2e-05   
ref|XP_010943177.1|  PREDICTED: scarecrow-like protein 15             54.3    2e-05   Elaeis guineensis
gb|KJB49198.1|  hypothetical protein B456_008G106000                  54.3    2e-05   Gossypium raimondii
ref|XP_007052139.1|  GRAS family transcription factor                 53.9    2e-05   
ref|XP_006856053.1|  hypothetical protein AMTR_s00059p00091580        53.5    3e-05   Amborella trichopoda
gb|KJB49199.1|  hypothetical protein B456_008G106100                  53.5    3e-05   Gossypium raimondii
ref|XP_010544366.1|  PREDICTED: scarecrow-like protein 6              53.1    5e-05   Tarenaya hassleriana [spider flower]
ref|XP_010661679.1|  PREDICTED: scarecrow-like protein 27             52.4    8e-05   Vitis vinifera
ref|XP_007220242.1|  hypothetical protein PRUPE_ppa001781mg           52.4    9e-05   Prunus persica
ref|XP_010934970.1|  PREDICTED: scarecrow-like protein 27             52.4    1e-04   Elaeis guineensis
ref|XP_002511661.1|  hypothetical protein RCOM_1610560                52.4    1e-04   
ref|XP_008232583.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...  52.0    1e-04   
ref|XP_008341645.1|  PREDICTED: scarecrow-like protein 22             52.0    1e-04   Malus domestica [apple tree]
ref|XP_006855813.1|  hypothetical protein AMTR_s00044p00228020        52.0    1e-04   Amborella trichopoda
gb|KDP28794.1|  hypothetical protein JCGZ_14565                       51.6    1e-04   Jatropha curcas
ref|XP_008796953.1|  PREDICTED: scarecrow-like protein 6              51.2    2e-04   
ref|XP_010110817.1|  hypothetical protein L484_011800                 50.8    3e-04   Morus notabilis
ref|XP_009395624.1|  PREDICTED: scarecrow-like protein 15             50.8    3e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010258971.1|  PREDICTED: scarecrow-like protein 6              50.8    3e-04   Nelumbo nucifera [Indian lotus]
ref|XP_009382417.1|  PREDICTED: scarecrow-like protein 27             50.8    3e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003538071.1|  PREDICTED: scarecrow-like protein 6-like         50.8    3e-04   
ref|XP_004306953.1|  PREDICTED: scarecrow-like protein 6              50.4    4e-04   Fragaria vesca subsp. vesca
gb|KJB51923.1|  hypothetical protein B456_008G238300                  50.4    4e-04   Gossypium raimondii
ref|XP_009374164.1|  PREDICTED: scarecrow-like protein 27             50.4    4e-04   Pyrus x bretschneideri [bai li]
gb|AJC52498.1|  SCL12                                                 50.4    4e-04   Pinus radiata
ref|XP_009342426.1|  PREDICTED: scarecrow-like protein 6              50.4    4e-04   
ref|XP_008371269.1|  PREDICTED: scarecrow-like protein 6              50.1    5e-04   
ref|XP_008448862.1|  PREDICTED: scarecrow-like protein 6              50.1    5e-04   Cucumis melo [Oriental melon]
ref|XP_006573232.1|  PREDICTED: scarecrow-like protein 27-like        50.1    5e-04   Glycine max [soybeans]
ref|XP_009349895.1|  PREDICTED: scarecrow-like protein 6              50.1    5e-04   Pyrus x bretschneideri [bai li]
ref|XP_009375779.1|  PREDICTED: scarecrow-like protein 22             50.1    6e-04   
ref|XP_007210362.1|  hypothetical protein PRUPE_ppa001561mg           50.1    6e-04   
gb|AFR66646.1|  scarecrow-like 6                                      49.7    7e-04   Larix kaempferi [karamatsu]
ref|XP_008238556.1|  PREDICTED: scarecrow-like protein 27             49.7    7e-04   Prunus mume [ume]
ref|XP_004147202.1|  PREDICTED: scarecrow-like protein 27-like        49.7    7e-04   Cucumis sativus [cucumbers]
ref|XP_010662422.1|  PREDICTED: scarecrow-like protein 22 isoform X1  49.7    8e-04   Vitis vinifera
gb|KGN55872.1|  hypothetical protein Csa_3G020600                     49.7    8e-04   Cucumis sativus [cucumbers]
ref|XP_004169643.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...  49.7    8e-04   
ref|XP_011033505.1|  PREDICTED: scarecrow-like protein 22 isoform X2  49.7    8e-04   Populus euphratica
ref|XP_011033489.1|  PREDICTED: scarecrow-like protein 22 isoform X1  49.3    9e-04   Populus euphratica
ref|XP_010056372.1|  PREDICTED: scarecrow-like protein 22             49.3    0.001   Eucalyptus grandis [rose gum]



>ref|XP_009803270.1| PREDICTED: scarecrow-like protein 15 [Nicotiana sylvestris]
Length=543

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 131/252 (52%), Positives = 159/252 (63%), Gaps = 56/252 (22%)
 Frame = +3

Query  12   MKVPVASNENWNS------------------AAGNG---WYEPKSVLELRRSPSPVLDQK  128
            MKVP +SN+N +S                  AA NG    YEPKSVLELRRSPSP+++++
Sbjct  1    MKVPFSSNDNVSSKPLINNNNNNNLRNATFPAAANGPNLCYEPKSVLELRRSPSPIVEKQ  60

Query  129  AAPAGNFDV---SDDPLELADNLLTNFEDWDSFMKELGLQDDRNI--KPDHNLLFTPSSE  293
                 +F      DDPL+L D++L+NFEDWDS M+ELGLQDD     K +H  L    SE
Sbjct  61   VITNPDFSALCGGDDPLQLGDHVLSNFEDWDSLMRELGLQDDSASLSKSNHPQLSLTQSE  120

Query  294  SQTHQFEFTHSLPEF------VPSSDFNFS-----QFQ----GN-INSFD-------ENW  404
            S T QF   H+L EF       P+SDF+FS     QFQ    GN IN+ D        NW
Sbjct  121  SLT-QF---HNLSEFSADSTQFPTSDFSFSENFPQQFQSVNQGNYINALDLSGDIHQNNW  176

Query  405  SFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLT  584
            + GFDY+DELI+FAECF++NA QLA VIL +LNQ+L SAAG PL+RAAFYFKEALQ+ L 
Sbjct  177  NVGFDYVDELIRFAECFETNAFQLAHVILARLNQRLRSAAGKPLQRAAFYFKEALQAQLA  236

Query  585  GS---TRPASSS  611
            GS   TRPASSS
Sbjct  237  GSTRQTRPASSS  248



>ref|XP_009590475.1| PREDICTED: scarecrow-like protein 15 [Nicotiana tomentosiformis]
Length=541

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 124/249 (50%), Positives = 153/249 (61%), Gaps = 52/249 (21%)
 Frame = +3

Query  12   MKVPVASNENWNS-----------------AAGNG---WYEPKSVLELRRSPSPVLDQKA  131
            MKVP +SN+N +S                 AA NG    YEPKSVLELRRSPSP+++++ 
Sbjct  1    MKVPFSSNDNVSSKPLISNNNNNLQNATFPAATNGPNLCYEPKSVLELRRSPSPIVEKQV  60

Query  132  APAGNFDV---SDDPLELADNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQT  302
                +F      DDPL+L D++L+NFEDWDS M+ELGLQDD       N   + +     
Sbjct  61   ITNPDFSALCGGDDPLQLGDHVLSNFEDWDSLMRELGLQDDSASLSKSNPQLSLTQSESL  120

Query  303  HQFEFTHSLPEF------VPSSDFNFS-----QFQ----GN-INSFD-------ENWSFG  413
             QF   H+L EF       P+SDF+FS     QFQ    GN IN+ D        NW+ G
Sbjct  121  TQF---HNLSEFSADSTQFPTSDFSFSENFPQQFQSVNQGNYINALDLSGDIHQNNWNVG  177

Query  414  FDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGS-  590
            FDY+DELI+F ECF++NA QLA VIL +LNQ+L SAAG PL+RAAFYFKEALQ+ L GS 
Sbjct  178  FDYVDELIRFTECFETNAFQLAHVILARLNQRLRSAAGKPLQRAAFYFKEALQAQLAGST  237

Query  591  --TRPASSS  611
              TRPASSS
Sbjct  238  RQTRPASSS  246



>ref|XP_004232383.1| PREDICTED: scarecrow-like protein 15 [Solanum lycopersicum]
 gb|AAG01129.1|AF273333_14 BAC19.14 [Solanum lycopersicum]
Length=536

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 149/239 (62%), Gaps = 41/239 (17%)
 Frame = +3

Query  12   MKVPVASNENWNS-------------AAGNG---WYEPKSVLELRRSPSPVLDQKAAPAG  143
            MKVP ++N+N +S             AA NG    YEPKSVLELRRSPSP++D++     
Sbjct  1    MKVPFSTNDNVSSKPLVNSNNSFTFPAATNGSNLCYEPKSVLELRRSPSPIVDKQIITT-  59

Query  144  NFDVS-----DDPLELADNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQ  308
            N D+S     +DPL+L D++L+NFEDWDS M+ELGL DD       N L    S +Q H 
Sbjct  60   NPDLSALCGGEDPLQLGDHVLSNFEDWDSLMRELGLHDDSASLSKTNPLTHSESLTQFHN  119

Query  309  F-EFTHSLPEFVPSSDFNFS------QF-----QGNINSFD------ENWSFGFDYIDEL  434
              EF+    +F PS DF+FS      QF        IN+ D      +NWS GFDY+DEL
Sbjct  120  LSEFSAESNQF-PSPDFSFSDTNFPQQFPTVNQASFINALDLSGDIHQNWSVGFDYVDEL  178

Query  435  IQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRPASSS  611
            I+FAECF++NA QLA VIL +LNQ+L SAAG PL+RAAFYFKEALQ+ L GS R   SS
Sbjct  179  IRFAECFETNAFQLAHVILARLNQRLRSAAGKPLQRAAFYFKEALQAQLAGSARQTRSS  237



>ref|XP_006363143.1| PREDICTED: scarecrow-like protein 15-like [Solanum tuberosum]
Length=545

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 124/253 (49%), Positives = 155/253 (61%), Gaps = 57/253 (23%)
 Frame = +3

Query  12   MKVPVASNENWNS------------------AAGNG---WYEPKSVLELRRSPSPVLDQK  128
            MKVP ++N+N +S                  AA NG    YEPKSVLELRRSPSP++D++
Sbjct  1    MKVPFSTNDNVSSKPLISSNNNNLRNNVTFPAATNGSNLCYEPKSVLELRRSPSPIVDKQ  60

Query  129  AAPAGNFDVS------DDPLELADNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSS  290
                 N D+S      +DPL+L D++LTNFEDWDS M+ELGL DD       N    P S
Sbjct  61   IITT-NPDLSALCGGGEDPLQLGDHVLTNFEDWDSLMRELGLHDDSASLSKTN---PPLS  116

Query  291  ESQTHQFEFTHSLPEFVPSS------DFNFS------QF----QGN-INSFD------EN  401
             +Q+      H+L EF   S      DF+FS      QF    QG+ IN+ D      +N
Sbjct  117  LTQSESLTQFHNLSEFSADSTQFANPDFSFSESTFPQQFPAVNQGSFINALDLSGDIHQN  176

Query  402  WSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            W+ GFDY+DELI+FAECF++NA QLA VIL +LNQ+L SAAG PL+RAAFYFKEALQ+ L
Sbjct  177  WNVGFDYVDELIRFAECFETNAFQLAHVILARLNQRLRSAAGKPLQRAAFYFKEALQAQL  236

Query  582  TGS---TRPASSS  611
             GS   TRP+SSS
Sbjct  237  AGSARQTRPSSSS  249



>gb|ABU45198.1| unknown [Petunia integrifolia subsp. inflata]
Length=548

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 152/251 (61%), Gaps = 55/251 (22%)
 Frame = +3

Query  12   MKVPVASNENWNS-----------------AAGNG---WYEPKSVLELRRSPSPVLDQKA  131
            MKVP +SN+N +S                 AA N     YEPKSVLELRRSPSP+LD K 
Sbjct  1    MKVPFSSNDNVSSKPLNNSNNNNLRNSSFPAATNSPNLCYEPKSVLELRRSPSPILDNKQ  60

Query  132  APAGNFDVS------DDPLELADNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSE  293
                N D S      +DPL+L D++L+NFEDWDS M+ELGLQ+D       N   T +  
Sbjct  61   VIT-NPDYSTLCGGGEDPLQLGDHVLSNFEDWDSLMRELGLQEDSASLAKSNPQLTLTQT  119

Query  294  SQTHQFEFTHSLPEF------VPSSDFNFS-----QF----QGN-INSFD------ENWS  407
                QF   H+L E+        SS+F+FS     QF    QGN IN+ D       NW+
Sbjct  120  ESLTQF---HTLSEYSADSAQFGSSEFSFSENYPHQFPAVNQGNYINALDLATGDNNNWN  176

Query  408  FGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTG  587
             GFDY+DELI+FAECF++NA QLA VIL +LNQ+L SA+G PL+RAAFYFKEALQ+ L G
Sbjct  177  LGFDYVDELIRFAECFETNAFQLAHVILARLNQRLRSASGKPLQRAAFYFKEALQAQLAG  236

Query  588  S---TRPASSS  611
            S   TRP+SSS
Sbjct  237  STRQTRPSSSS  247



>gb|ABU45212.1| unknown [Solanum bulbocastanum]
Length=545

 Score =   183 bits (465),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 147/234 (63%), Gaps = 41/234 (18%)
 Frame = +3

Query  3    LREMKVPVASNENWNSAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVS-----DDP  167
            LR +  P A+N +      N  YEPKSVLELRRSPSP++D++     N D+S     +DP
Sbjct  26   LRNVTFPAATNSS------NLCYEPKSVLELRRSPSPIVDKQIITT-NPDLSALCGGEDP  78

Query  168  LELADNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPS  347
            L+L D++L+NFEDWDS M+ELGL DD       N   + +      QF   H+L EF   
Sbjct  79   LQLGDHVLSNFEDWDSLMRELGLHDDSASLSKTNPQLSLTQSESLTQF---HNLSEFSAD  135

Query  348  S------DFNFS------QF----QGN-INSFD------ENWSFGFDYIDELIQFAECFD  458
            S      DF+FS      QF    QG+ IN+ D      +NW+ GFDY+DELI FAECF+
Sbjct  136  STQFANPDFSFSESTFPQQFPAVNQGSFINALDLSGDIHQNWNVGFDYVDELICFAECFE  195

Query  459  SNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGS---TRPASSS  611
            +NA QLA VIL +LNQ+L SAAG PL+RAAFYFKEALQ+ L GS   TRP+SSS
Sbjct  196  TNAFQLAHVILARLNQRLRSAAGKPLQRAAFYFKEALQAQLAGSARQTRPSSSS  249



>gb|ABU45178.1| unknown [Solanum melongena]
Length=547

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 147/234 (63%), Gaps = 40/234 (17%)
 Frame = +3

Query  3    LREMKVPVASNENWNSAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVS-----DDP  167
            LR +  PVA     N       YEPKSVL+LRRSPSP+++++     N D+S     +DP
Sbjct  28   LRNVTFPVAVTNGPNLC-----YEPKSVLDLRRSPSPIVEKQIVTT-NPDLSALCGGEDP  81

Query  168  LELADNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPS  347
            L+L D++L+NFEDWDS M+ELGL DD       N    P S +QT      H+L +F   
Sbjct  82   LQLGDHVLSNFEDWDSLMRELGLHDDSASLSKTN---PPLSLAQTESLTQFHNLSDFSGD  138

Query  348  S------DFNFS------QF----QGN-INSFD------ENWSFGFDYIDELIQFAECFD  458
            S      DF+FS      QF    QG+ IN+ D      +NW+ GFDY+DELI+FAECF+
Sbjct  139  STQFANPDFSFSDSTFPQQFPAVNQGSFINALDLSGDIHQNWNVGFDYVDELIRFAECFE  198

Query  459  SNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGS---TRPASSS  611
            +NA Q+A VIL +LNQ+L SAAG PL+RAAFYFKEALQ+ L GS   TRP+SSS
Sbjct  199  TNAFQVAHVILARLNQRLRSAAGKPLQRAAFYFKEALQAQLAGSTRQTRPSSSS  252



>ref|XP_011097216.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 15 [Sesamum 
indicum]
Length=516

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 132/219 (60%), Gaps = 41/219 (19%)
 Frame = +3

Query  69   YEPKSVLELRRSPSPVLDQKAAP----AGNFDVSDDPLELAD--NLLTNFEDWDSFMKEL  230
            YEPKSVLELR SPSPV D K A     A +  ++DDPL+L    ++L N ++WDS+M+EL
Sbjct  43   YEPKSVLELRSSPSPVSDHKPASNNTCAADILLADDPLQLDQDHHMLINPQEWDSWMREL  102

Query  231  GLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVP---SSDFNFSQF----------  371
            GL DD        L    S   Q+HQ  +++ L EF P   S D N  QF          
Sbjct  103  GLHDDSTTPVSKQL---TSHSDQSHQNHYSNDLLEFPPAISSLDSNHDQFVPVDFGLLPD  159

Query  372  ------QGNINSFD--------ENWSF-GFDYIDELIQFAECFDSNAVQLAQVILPQLNQ  506
                    ++NSFD         NW+  GFDY+DELI+ AECF++N++QL QVIL +LNQ
Sbjct  160  IPINHNSNSLNSFDALSVDLNSSNWNVVGFDYVDELIRLAECFETNSLQLGQVILARLNQ  219

Query  507  KLSSAAGNPLRRAAFYFKEALQSLLTGSTR----PASSS  611
            +L S  G PL+RAAFYFKEALQSLLTGS R    PA+SS
Sbjct  220  RLRSPIGKPLQRAAFYFKEALQSLLTGSARLAHQPANSS  258



>emb|CDP02813.1| unnamed protein product [Coffea canephora]
Length=554

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 130/225 (58%), Gaps = 52/225 (23%)
 Frame = +3

Query  69   YEPKSVLELRRSPSPVLDQKAAPAGNFDVS----DDPLELADNLLTNFE-DWDSFMKELG  233
            YEPKSVLELR+SPSPV +    P+ N D+S    D  L+L D++L +FE DWDS M+ELG
Sbjct  45   YEPKSVLELRQSPSPVTE---IPSSNTDISTVWDDTGLQLEDHVLNHFEVDWDSLMRELG  101

Query  234  LQDDRNIKPDH------NLLFTPSSESQTHQFEFTHSLPEFVPS-----------SDFNF  362
            L +D N  P        +  FTPS      Q +F  +LPEF P+           SD   
Sbjct  102  LHEDSNPTPTSRPTTFSHSQFTPSGS----QVQF-QNLPEFPPTHNSFDSTLFVPSDITL  156

Query  363  SQFQGNINSFDEN-------------------WSFGFDYIDELIQFAECFDSNAVQLAQV  485
                   +SF+++                   W+ GFDY+DELI+ AECF++N++ L  V
Sbjct  157  PDISTYPSSFNDSSINSLGLSHDAHHHNTNLTWNPGFDYVDELIRLAECFETNSLHLTHV  216

Query  486  ILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTR---PASSS  611
            IL +LNQ+L    G PL+RAAFYFKEALQ+LLTGSTR   P++SS
Sbjct  217  ILGRLNQRLRGPTGKPLQRAAFYFKEALQTLLTGSTRLTQPSTSS  261



>gb|EYU28571.1| hypothetical protein MIMGU_mgv1a003577mg [Erythranthe guttata]
Length=576

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 125/230 (54%), Gaps = 61/230 (27%)
 Frame = +3

Query  69   YEPKSVLELRRSPSPVLDQKAAPAGNFDVS-------DDPLELADNLLTN-----FEDWD  212
            YEPKSVLELR SPSPV      P  +F +        D  +EL D++L N      EDWD
Sbjct  49   YEPKSVLELRGSPSPV---SGKPNSDFLIGGGGGGGGDRLIELEDHVLNNIEHPQLEDWD  105

Query  213  SFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHS--------------LPEFVPSS  350
            S M++LGL DD N  P      + S    THQ   TH+              L EF P +
Sbjct  106  SLMRDLGLHDDFN--PVSKPFSSSSQSDLTHQI--THNINNNNNNNNIHYSELAEFPPVT  161

Query  351  DFNFSQF--------------------------QGNINSFDENWSFGFDYIDELIQFAEC  452
             F  +QF                           G+ N  + NW+ GFDY+DELI+ AEC
Sbjct  162  SFESTQFAAADFGLLPDIPIYSSAAPPTSFEGLSGDAN--NNNWNVGFDYVDELIRLAEC  219

Query  453  FDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRPA  602
            F++N++QL QVIL +LNQ+L S AG P++RAAFYFKEALQSLLTGSTRP+
Sbjct  220  FETNSLQLGQVILARLNQRLRSPAGKPIQRAAFYFKEALQSLLTGSTRPS  269



>ref|XP_011099583.1| PREDICTED: scarecrow-like protein 15 [Sesamum indicum]
Length=524

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 121/209 (58%), Gaps = 33/209 (16%)
 Frame = +3

Query  69   YEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTN--FEDWDSFMKELGLQD  242
            YEPKSVL+LRRSPSPV D K    G   V    LE AD+ L N   E WDS M+ELGL D
Sbjct  29   YEPKSVLDLRRSPSPVAD-KPVSTGPLPV----LEEADHELINQHLEGWDSLMRELGLHD  83

Query  243  DR-------NIKPDHNLLFTPSSESQTHQFE------FTHSLPEFVPSSDFN-----FSQ  368
            D        NI         P + S  +QF       F+   P +  ++  N      S 
Sbjct  84   DSPPDSKPVNIPCTTLPELPPVTSSFDNQFVSADFGLFSDIPPAYTTTTPLNHNSDAISS  143

Query  369  FQGNINSFDE----NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPL  536
            F+G    F+     NW+ GFDY+DELI+ AECF++N++QL  VIL +LNQ+LSS  G PL
Sbjct  144  FEGLSGDFNGGGAGNWNVGFDYVDELIRLAECFETNSLQLGHVILARLNQRLSSPTGKPL  203

Query  537  RRAAFYFKEALQSLLTGST----RPASSS  611
            +RAAFYFKEALQSLL GST    RP SSS
Sbjct  204  QRAAFYFKEALQSLLAGSTLPDHRPVSSS  232



>ref|XP_002310797.1| hypothetical protein POPTR_0007s12480g [Populus trichocarpa]
 gb|EEE91247.1| hypothetical protein POPTR_0007s12480g [Populus trichocarpa]
Length=546

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 118/207 (57%), Gaps = 36/207 (17%)
 Frame = +3

Query  60   NGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQ  239
            N  YEP SVL+LRRSPSP    K APA      +DP+E  D++L    DWDS M++L   
Sbjct  43   NLCYEPTSVLDLRRSPSPARAGKPAPA------NDPIEWDDHVLQTL-DWDSIMRDLDFH  95

Query  240  DDRNIKPDHNL-LFTPSSESQTHQFEFTHSLPEFVPSSDFNFSQF--------------Q  374
            DD       N   F P SESQ      +H+LPEF  S   + +QF               
Sbjct  96   DDSAPALIKNFPQFGPCSESQIQ----SHNLPEFTASHQMDATQFLHSDFNDMYINSIPT  151

Query  375  GNINSFD---------ENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAG  527
             N+ S D          NW+ GFD+I ELI+ A+CFD+N +QLAQ IL +LN +L S  G
Sbjct  152  HNLTSLDLSHSFHNNIGNWNAGFDFIQELIKAADCFDTNELQLAQAILERLNHRLQSPIG  211

Query  528  NPLRRAAFYFKEALQSLL-TGSTRPAS  605
             PL+RAAF+FK+ALQSLL TGSTRP +
Sbjct  212  KPLQRAAFFFKDALQSLLATGSTRPQT  238



>ref|XP_011025728.1| PREDICTED: scarecrow-like protein 15 [Populus euphratica]
Length=546

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 118/207 (57%), Gaps = 36/207 (17%)
 Frame = +3

Query  60   NGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQ  239
            N  YEP SVL+LRRSPSP      A AG    ++DP+E  D++L    DWDS M++L   
Sbjct  43   NLCYEPTSVLDLRRSPSP------ARAGKPASANDPIEWDDHVLQTL-DWDSIMRDLDFH  95

Query  240  DDRNIKPDHNL-LFTPSSESQTHQFEFTHSLPEFVPSSDFNFSQF--------------Q  374
            DD       N   F P SESQ      +H+LPEF  S   + +QF               
Sbjct  96   DDSAPALIKNFPQFGPCSESQIQ----SHNLPEFTASHQMDATQFLHSDFNDMYINSIPT  151

Query  375  GNINSFD---------ENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAG  527
             N+ S D          NW+ GFD+I ELI+ A+CFD+N +QLAQ IL +LN +L S  G
Sbjct  152  HNLTSLDLSHSFHNNIGNWNAGFDFIQELIKAADCFDTNELQLAQAILERLNHRLQSPIG  211

Query  528  NPLRRAAFYFKEALQSLL-TGSTRPAS  605
             PL+RAAF+FKEALQSLL TGSTRP +
Sbjct  212  KPLQRAAFFFKEALQSLLATGSTRPQT  238



>ref|XP_010999954.1| PREDICTED: scarecrow-like protein 15 [Populus euphratica]
Length=554

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/207 (45%), Positives = 115/207 (56%), Gaps = 36/207 (17%)
 Frame = +3

Query  60   NGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQ  239
            N  YEP SVL+LRRSPSP      A AG      DP+   D++L    DWDS M+EL   
Sbjct  44   NSCYEPTSVLDLRRSPSP------ARAGKPASVTDPIGWEDHVLQTL-DWDSIMRELDFH  96

Query  240  DDRNIKPDHNL-LFTPSSESQTHQFEFTHSLPEFVPSSDFNFSQF--------------Q  374
            DD      +N   F P SE Q H    +H+LPEF  S   + +QF               
Sbjct  97   DDSAPALINNFPQFGPCSEPQIH----SHNLPEFTASQQIDATQFLNSEFNDMYINSITT  152

Query  375  GNINSFD---------ENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAG  527
             N+ S D          NW+ G D+I ELI+ A+CFDSN +QLAQVIL +L+ +L S  G
Sbjct  153  HNLTSLDLSHSFHNNIGNWNAGSDFIRELIKAADCFDSNELQLAQVILERLSHRLQSPNG  212

Query  528  NPLRRAAFYFKEALQSLLT-GSTRPAS  605
             PL+RAAF+FKEALQ LLT GSTRP +
Sbjct  213  KPLQRAAFFFKEALQCLLTSGSTRPQT  239



>ref|XP_006383233.1| scarecrow transcription factor family protein [Populus trichocarpa]
 gb|ERP61030.1| scarecrow transcription factor family protein [Populus trichocarpa]
Length=548

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 119/214 (56%), Gaps = 36/214 (17%)
 Frame = +3

Query  39   NWNSAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSF  218
            ++N +  N  YEP SVL+LRRSPSP      A AG    + DP+E  D++L    DWDS 
Sbjct  37   SFNPSNRNLCYEPTSVLDLRRSPSP------ARAGKPASATDPIEWEDHVLQTL-DWDSI  89

Query  219  MKELGLQDDRNIKPDHNL-LFTPSSESQTHQFEFTHSLPEFVPSSDFNFSQF--------  371
            M+EL   DD       N   F P SE Q      +H+LPEF  S   + +QF        
Sbjct  90   MRELDFHDDSAPALIKNFPQFGPCSEPQIQ----SHNLPEFTASQQIDATQFLNSEFNDM  145

Query  372  ------QGNINSFD---------ENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQ  506
                    N+ S D          NW+ G D+I ELI+ A+CFDSN +Q+AQVIL +LN 
Sbjct  146  YINSIPTHNLTSLDLSHSFHNNIGNWNAGSDFIQELIKAADCFDSNELQVAQVILERLNH  205

Query  507  KLSSAAGNPLRRAAFYFKEALQSLL-TGSTRPAS  605
            +  S  G PL+RAAF+FKEALQSLL TGSTRP +
Sbjct  206  RHQSPNGKPLQRAAFFFKEALQSLLTTGSTRPQT  239



>ref|XP_007203757.1| hypothetical protein PRUPE_ppa003675mg [Prunus persica]
 gb|EMJ04956.1| hypothetical protein PRUPE_ppa003675mg [Prunus persica]
Length=557

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 123/207 (59%), Gaps = 34/207 (16%)
 Frame = +3

Query  60   NGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSD--------DPLELADNLLTNFEDWDS  215
            N  YEP SVL+LR SPSPV +QK  PA    VSD        DPLE  +  L N  DWDS
Sbjct  43   NLCYEPTSVLDLRHSPSPVAEQK--PAKISAVSDVLSHSNHHDPLEWDEQALHNL-DWDS  99

Query  216  FMKELGLQDDRNIKPDHNLLFTPSSESQ-THQFEFTHSLPEFVPS----SDFNFS-----  365
             M++LGL DD       ++    S++SQ +H  ++ H  P F P+    SDFN +     
Sbjct  100  IMRDLGLHDDSVPNLKTSIPQLNSTDSQISHLSDYPHPQP-FDPTQLVHSDFNINLSEVY  158

Query  366  ---QFQGNINSFDE----NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA  524
                F    ++F +    NW+ GFD+I+ELI+ A+CFDS+ +QLAQ IL +LNQ+L S++
Sbjct  159  STQNFTNTTHNFYDHQPGNWNVGFDFIEELIRAADCFDSDELQLAQGILDRLNQRLRSSS  218

Query  525  -----GNPLRRAAFYFKEALQSLLTGS  590
                 G PL+RAA YF++A+QS+L GS
Sbjct  219  PSKPVGKPLQRAAVYFRDAIQSILIGS  245



>gb|KDO36173.1| hypothetical protein CISIN_1g048701mg, partial [Citrus sinensis]
Length=520

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 121/231 (52%), Gaps = 46/231 (20%)
 Frame = +3

Query  54   AGNGWYEPKSVLELRRSPSPVLDQK--------AAPAGNFDVSDDP-LELADNLLTNFED  206
            + N  YEP SVLELRRSPSPV + +         A   + ++S DP +E  +++L    D
Sbjct  43   SSNKCYEPTSVLELRRSPSPVAENEKPATVASACATEISANISSDPSIEWEEHVLRTM-D  101

Query  207  WDSFMKELGLQD--------------DRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVP  344
            W+S MK+LGL D              D +++   NL  T S       + F  ++P+  P
Sbjct  102  WESAMKDLGLDDYYSSVPSNPTTSDPDPHLQIRQNLTLTDSVHLLDQSY-FNFNIPDICP  160

Query  345  SSDF---------NFSQFQGNINSFDENWS------------FGFDYIDELIQFAECFDS  461
            SS           NFS    + NS   N S            F FD+I EL++ A+CFDS
Sbjct  161  SSSQHDQGFIVGNNFSAVDVSSNSLVINASSSATGTNIVNVGFEFDFIQELLRAADCFDS  220

Query  462  NAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRPASSSF  614
            N ++LAQ+IL +LNQ+L S AG PL RAAF+FKEAL SLL G TRP   S 
Sbjct  221  NELRLAQIILARLNQRLRSPAGKPLERAAFFFKEALNSLLNGLTRPTCLSL  271



>ref|XP_007156910.1| hypothetical protein PHAVU_002G027500g [Phaseolus vulgaris]
 gb|ESW28904.1| hypothetical protein PHAVU_002G027500g [Phaseolus vulgaris]
Length=517

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 120/225 (53%), Gaps = 38/225 (17%)
 Frame = +3

Query  12   MKVPVASNENWNSAAGNG---------------WYEPKSVLELRRSPSPVLDQKAAPAGN  146
            M+VPV S+   N    N                 YEP SVL+L RSPSP  ++       
Sbjct  1    MRVPVPSSPQTNPKPTNNVVRTIALPNLNTTGLCYEPTSVLDLCRSPSPGSEKPTDHTVV  60

Query  147  FDVSDDPLELADNLLTNFEDWDSFMKELGLQDDRNIK-------PDHNLLFTPSSESQTH  305
               S D L+L D+ L N  DWDS MK+LGL DD           PD+N    P  +    
Sbjct  61   VTDSQDCLDLDDHALHNL-DWDSIMKDLGLHDDSGAHLLKTIPHPDNN--NNPCDDFTIA  117

Query  306  QFEFTHSLPEFVPSSD--------FNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDS  461
             FE  H+L EF   SD        F+F+    + ++   N   GFD+I+ELI+ A+CFD+
Sbjct  118  PFE--HAL-EFSTLSDIYSNQNLAFDFNHLVHDFSNHHHN--NGFDFIEELIRAADCFDT  172

Query  462  NAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTR  596
              + +AQVIL +LNQ+L S  G PL+RAAFYFKEALQSLL+GS R
Sbjct  173  KQLHVAQVILERLNQRLRSPVGKPLQRAAFYFKEALQSLLSGSNR  217



>gb|KDP31796.1| hypothetical protein JCGZ_12257 [Jatropha curcas]
Length=523

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 95/235 (40%), Positives = 121/235 (51%), Gaps = 52/235 (22%)
 Frame = +3

Query  12   MKVPVASNEN-------------WNSAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFD  152
            MKVPV+S +N              ++   N  YEP SVL+LRRSPSP      A      
Sbjct  1    MKVPVSSPQNPKHTNIARNIAFHTDNTTPNLTYEPTSVLDLRRSPSP------ASGKPVS  54

Query  153  VSDDPLELADNLLTNFEDWDSFMKELGLQDD--------------RNIKPDHNLL-FTPS  287
             +D  LE  +++L NF DWDS MKEL   +D               +I  + NL  FT  
Sbjct  55   ATDHSLEWEEHVLQNF-DWDSIMKELDFHEDSAPTFKTFPQVGSCESIVHNQNLQEFTLP  113

Query  288  SESQTHQFEFTHS---------LPEFVPSSDFNFSQFQGNINSFDENWSFGFDYIDELIQ  440
            S +   QF   HS         LP    S+  + S   GN N+F      G+D I E I+
Sbjct  114  SHADPAQF--LHSDFNDISFNVLPTQNLSTTLDLSHSTGNWNNF------GYDLIQEFIR  165

Query  441  FAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRPAS  605
             A+C DSN +QLA VIL +LN +L +  G PL+RAAF+FKEALQSLLTGSTR  +
Sbjct  166  AADCIDSNELQLAHVILDRLNHRLQAPVGKPLKRAAFFFKEALQSLLTGSTRSVT  220



>ref|XP_006425721.1| hypothetical protein CICLE_v10025246mg [Citrus clementina]
 ref|XP_006466756.1| PREDICTED: scarecrow-like protein 15-like [Citrus sinensis]
 gb|ESR38961.1| hypothetical protein CICLE_v10025246mg [Citrus clementina]
Length=578

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 121/231 (52%), Gaps = 46/231 (20%)
 Frame = +3

Query  54   AGNGWYEPKSVLELRRSPSPVLDQK--------AAPAGNFDVSDDP-LELADNLLTNFED  206
            + N  YEP SVLELRRSPSPV + +         A   + ++S DP +E  +++L    D
Sbjct  43   SSNKCYEPTSVLELRRSPSPVAENEKPATVASACATEISANISSDPSIEWEEHVLRTM-D  101

Query  207  WDSFMKELGLQD--------------DRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVP  344
            W+S MK+LGL D              D +++   NL  T S       + F  ++P+  P
Sbjct  102  WESAMKDLGLDDYYSSVPSNPTTSDPDPHLQIRQNLTLTDSVHLLDQSY-FNFNIPDICP  160

Query  345  SSDF---------NFSQFQGNINSFDENWS------------FGFDYIDELIQFAECFDS  461
            SS           NFS    + NS   N S            F FD+I EL++ A+CFDS
Sbjct  161  SSSQHDQGFIVGNNFSAVDVSSNSLVINASSSATGTNIVNVGFEFDFIQELLRAADCFDS  220

Query  462  NAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRPASSSF  614
            N ++LAQ+IL +LNQ+L S AG PL RAAF+FKEAL SLL G TRP   S 
Sbjct  221  NELRLAQIILARLNQRLRSPAGKPLERAAFFFKEALNSLLNGLTRPTCLSL  271



>gb|EPS63021.1| hypothetical protein M569_11763 [Genlisea aurea]
Length=527

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 117/200 (59%), Gaps = 23/200 (12%)
 Frame = +3

Query  69   YEPKSVLELRRSPSPVLDQ-KAAPAGNFDVSDDPLELADNLLT-NFEDWDSFMKELGL--  236
            YEPKSVLE+R SPSPV ++  +A AG+  V  +  E    L+    EDWD +M ELGL  
Sbjct  30   YEPKSVLEIRGSPSPVTEKPSSAAAGDSSVRPEGTESNHALMNPQVEDWD-WMTELGLND  88

Query  237  ------------QDDRNIKPDHNLLFTPSSESQTHQF---EFTHSLPEFVPSSDFNFSQF  371
                        +++       NL+  P+    + QF   EF   LP+F P+   +    
Sbjct  89   DDDDGSSSPVSRREELPAVQYQNLIDFPAGSFDSGQFPEMEFG-LLPDFPPAYGDSVEGL  147

Query  372  QGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAF  551
             G + +   NW+ GFD++DELI+ AECF++N+ QLA +IL +LN++L S AG PL+R AF
Sbjct  148  SGELAT--GNWNAGFDFVDELIRLAECFETNSAQLAHMILARLNERLRSPAGKPLQRIAF  205

Query  552  YFKEALQSLLTGSTRPASSS  611
            YFKEALQSLLT +   ++ S
Sbjct  206  YFKEALQSLLTAAPHASAGS  225



>ref|XP_002525108.1| DELLA protein GAIP-B, putative [Ricinus communis]
 gb|EEF37235.1| DELLA protein GAIP-B, putative [Ricinus communis]
Length=539

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 98/235 (42%), Positives = 125/235 (53%), Gaps = 46/235 (20%)
 Frame = +3

Query  12   MKVPVASNENWN-----------------------SAAGNGWYEPKSVLELRRSPSPVLD  122
            MKVPV+S++N N                       S+A N  YEP SVL+LRRSPSPV  
Sbjct  1    MKVPVSSSQNNNHRQSQSANLKNSTNSRNIGFHNSSSAPNLCYEPTSVLDLRRSPSPVSG  60

Query  123  QKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQT  302
            + A+   +       LE  +++L NF DWD  MKEL   +D +     N+    S ES  
Sbjct  61   KPASGPEH----HHSLEWDEHVLQNF-DWDFIMKELDFHED-STPTLKNIPQVNSCESII  114

Query  303  HQF----EFT----HSLPEFVPSSDFN---FSQFQGNINSFD-----ENWS-FGFDYIDE  431
            H      EFT    +  P  +   DFN   F+     +NS D      NWS FGFD I E
Sbjct  115  HSHNNLQEFTAPSNNDPPHLLHHPDFNDICFNIPTQKLNSLDLSHNIGNWSNFGFDLIQE  174

Query  432  LIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTR  596
            LI+ A+C DS+ +QLA VIL +LN +L S  G PL+RAAF+FKEALQ+LL GS R
Sbjct  175  LIRAADCIDSSEIQLANVILDRLNHRLQSPVGKPLQRAAFFFKEALQNLLAGSPR  229



>ref|XP_008241642.1| PREDICTED: scarecrow-like protein 15 [Prunus mume]
Length=561

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 122/207 (59%), Gaps = 34/207 (16%)
 Frame = +3

Query  60   NGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSD--------DPLELADNLLTNFEDWDS  215
            N  YEP SVL+L  SPSPV +QK  PA    VSD        DPLE  +  L N  DWDS
Sbjct  42   NLCYEPTSVLDLCHSPSPVAEQK--PAKISAVSDVLSHSNHHDPLEWDEQALHNL-DWDS  98

Query  216  FMKELGLQDDRNIKPDHNLLFTPSSESQ-THQFEFTHSLPEFVPS----SDFNFS-----  365
             M++LGL DD       ++    S++SQ +H  ++ H  P F P+    SDFN +     
Sbjct  99   IMRDLGLHDDSVPNLKTSIPQLNSTDSQISHLSDYPHPQP-FDPTQLVHSDFNINLSEVY  157

Query  366  ---QFQGNINSFDE----NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA  524
                F    ++F +    NW+ GFD+I+ELI+ A+CFDS+ +QLAQ IL +LNQ+L S++
Sbjct  158  STQNFTNATHNFYDHQPGNWNVGFDFIEELIRAADCFDSDELQLAQGILDRLNQRLRSSS  217

Query  525  -----GNPLRRAAFYFKEALQSLLTGS  590
                 G PL+RAA YF++ALQS+L GS
Sbjct  218  PSKPVGKPLQRAAVYFRDALQSILNGS  244



>ref|XP_002268445.1| PREDICTED: scarecrow-like protein 15 [Vitis vinifera]
Length=538

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 110/208 (53%), Gaps = 31/208 (15%)
 Frame = +3

Query  60   NGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELA--------DNLLTNFEDWDS  215
            N  YEP SVL+LRRSPSPV D+ A   G   VSD  L L+        D+ + N +DWD 
Sbjct  38   NVCYEPTSVLDLRRSPSPVADKAATFPGITAVSDVSLPLSEEPGFQWEDHGMHNLDDWDP  97

Query  216  FMKELGLQDDRNIKPDHNLLFTPSSES----------------QTHQFEFTHSLPEFVPS  347
             + +  L+DD            P                     T    F  +L E   +
Sbjct  98   TVWDFVLRDDSAPVFGSVPQLGPCDPQFPHLPLPDLPPSQPIYHTQLLPFDFTLSEISSN  157

Query  348  SDFNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAG  527
             + NF     N+NSF  +W+ G ++++ELI+ AECF SN  QLAQ IL +LNQ+L +  G
Sbjct  158  QNHNF-----NLNSF--HWNVGSEFVEELIRAAECFGSNNSQLAQAILARLNQRLRAPVG  210

Query  528  NPLRRAAFYFKEALQSLLTGSTRPASSS  611
             PL+RAAFYFKEAL SLLTGS R + SS
Sbjct  211  KPLQRAAFYFKEALHSLLTGSNRKSHSS  238



>emb|CBI17555.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 110/208 (53%), Gaps = 31/208 (15%)
 Frame = +3

Query  60   NGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELA--------DNLLTNFEDWDS  215
            N  YEP SVL+LRRSPSPV D+ A   G   VSD  L L+        D+ + N +DWD 
Sbjct  69   NVCYEPTSVLDLRRSPSPVADKAATFPGITAVSDVSLPLSEEPGFQWEDHGMHNLDDWDP  128

Query  216  FMKELGLQDDRNIKPDHNLLFTPSSES----------------QTHQFEFTHSLPEFVPS  347
             + +  L+DD            P                     T    F  +L E   +
Sbjct  129  TVWDFVLRDDSAPVFGSVPQLGPCDPQFPHLPLPDLPPSQPIYHTQLLPFDFTLSEISSN  188

Query  348  SDFNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAG  527
             + NF     N+NSF  +W+ G ++++ELI+ AECF SN  QLAQ IL +LNQ+L +  G
Sbjct  189  QNHNF-----NLNSF--HWNVGSEFVEELIRAAECFGSNNSQLAQAILARLNQRLRAPVG  241

Query  528  NPLRRAAFYFKEALQSLLTGSTRPASSS  611
             PL+RAAFYFKEAL SLLTGS R + SS
Sbjct  242  KPLQRAAFYFKEALHSLLTGSNRKSHSS  269



>ref|XP_006297491.1| hypothetical protein CARUB_v10013509mg [Capsella rubella]
 gb|EOA30389.1| hypothetical protein CARUB_v10013509mg [Capsella rubella]
Length=501

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 105/180 (58%), Gaps = 18/180 (10%)
 Frame = +3

Query  72   EPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLE--LADNLLTNFEDWDSFMKELGLQDD  245
            EP SVL+LRRSPSP   ++  P GN + +  P+E     + +    DWDS MKEL L DD
Sbjct  22   EPTSVLDLRRSPSPATAEEK-PVGNNNTNQFPIEDDHHHHHVMRSMDWDSIMKELELDDD  80

Query  246  RNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDFNFSQFQGNINSFDEN---WSFGF  416
                       TP+ +S    F  +  LP F     F+  +F G+ + F +N      GF
Sbjct  81   S----------TPTLKSNFPTFAISPPLPVF--PDQFHPPEFPGHGHGFIDNNNEGGGGF  128

Query  417  DYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTR  596
            D++++LI+   C DS+ +QLAQVIL +LNQ+L S  G PL RAAFYFKEAL SL+TG+ R
Sbjct  129  DFVEDLIRVVNCVDSDELQLAQVILSRLNQRLRSPTGRPLERAAFYFKEALGSLITGTNR  188



>ref|XP_008363118.1| PREDICTED: scarecrow-like protein 15 [Malus domestica]
Length=543

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 119/208 (57%), Gaps = 39/208 (19%)
 Frame = +3

Query  63   GWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSD-------DPLELADNLLTNFEDWDSFM  221
            G YEP SVL+LR SPSPV  +K  P+    +SD       DP+E  + +     DWDS M
Sbjct  38   GGYEPTSVLDLRHSPSPVSAEK--PSKILAISDVLSHSNHDPVEWEEQV-----DWDSIM  90

Query  222  KELGLQDDRNIKPDHNLLFTPSSESQTHQF-EFTHSLPEFVPS----SDF--NFSQFQGN  380
            K+LGL DD N+    N +  P   S   Q  E+ H  P F P+    SD+  N S+   +
Sbjct  91   KDLGLHDD-NVPNLKNSI--PQLNSNDPQISEYLHPQP-FDPTQLVHSDYSINLSEVYSS  146

Query  381  INSFDE---------NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA---  524
             N +D          NW+ G D+I+ELI+ A+CFDS+ +QLAQVIL +LN ++ S++   
Sbjct  147  QNCYDHAINDFHQSGNWNVGVDFIEELIRAADCFDSDELQLAQVILDRLNNRMRSSSPSK  206

Query  525  --GNPLRRAAFYFKEALQSLLTGSTRPA  602
              G PL+RAA YFK+ALQSLL GS   A
Sbjct  207  PVGKPLQRAAVYFKDALQSLLNGSDTAA  234



>ref|XP_010467682.1| PREDICTED: scarecrow-like protein 15 [Camelina sativa]
Length=501

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 114/198 (58%), Gaps = 19/198 (10%)
 Frame = +3

Query  12   MKVPVASNENWNSAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDD-PLELADNL  188
            M+VP +S+   NS     + EP SVL+LRRSPSP      A      VSD  PL+  D++
Sbjct  1    MRVPASSDTTSNSNL-VCFNEPTSVLDLRRSPSP----STAEEKPLLVSDQFPLDDDDHV  55

Query  189  LTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVP--SSDFNF  362
            + +  DWDS MKEL L DD N+KP+      PSS      F  T   P  +P      + 
Sbjct  56   MRSM-DWDSIMKELDLDDD-NLKPNF-----PSSP----HFAATAVDPPLLPIFPDQLHP  104

Query  363  SQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRR  542
             +F G+   F+     G D++++LI+   C DS+ +QLAQVIL +LNQ+L S  G PL R
Sbjct  105  PEFPGHGYGFNNEGGGGLDFVEDLIRVVNCVDSDELQLAQVILSRLNQRLRSPTGRPLER  164

Query  543  AAFYFKEALQSLLTGSTR  596
            AAFYFKEAL SL+TG+ R
Sbjct  165  AAFYFKEALGSLITGTNR  182



>ref|XP_008393455.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 15 [Malus 
domestica]
Length=548

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 114/207 (55%), Gaps = 32/207 (15%)
 Frame = +3

Query  63   GWYEPKSVLELRRSPSPVLDQK-----AAPAGNFDVSDDPLELADNLLTNFEDWDSFMKE  227
            G YEP SVL+LR SPSPV  +K     A P      + DPLE  +  + +  DWDS M++
Sbjct  38   GGYEPTSVLDLRHSPSPVSAEKPSKISAIPDVLSHSNHDPLEWEEEQVLHNLDWDSIMRD  97

Query  228  LGLQDDR--NIKPDHNLLFTPSSESQTHQF-EFTHSLP----EFVPSS-DFNFSQFQGNI  383
            LGL D+   N+K        P   +   Q  E+ H  P    + V S  D N S+   + 
Sbjct  98   LGLHDENVPNLKTS-----IPQLNANDPQISEYPHPQPFDATQLVHSDWDINLSEVYSSQ  152

Query  384  NSFDE---------NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA----  524
            N +D          NW+ G D+I+ELI+ A+CFD++ +QLAQVIL +LN +L S++    
Sbjct  153  NCYDHVTNDFHQSGNWNVGLDFIEELIRAADCFDTDELQLAQVILDRLNNRLRSSSPSKP  212

Query  525  -GNPLRRAAFYFKEALQSLLTGSTRPA  602
             G PL+R A YFKEALQSLL GS   A
Sbjct  213  VGKPLQRVAVYFKEALQSLLNGSDTAA  239



>ref|XP_003538842.1| PREDICTED: scarecrow-like protein 15-like [Glycine max]
Length=516

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 109/186 (59%), Gaps = 20/186 (11%)
 Frame = +3

Query  69   YEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDP-LELADNLLTNFEDWDSFMKELGLQDD  245
            YEP SVL+L RSPSP      +P      +D   L+L D+ L N  DWDS MK+LGL DD
Sbjct  41   YEPTSVLDLCRSPSP------SPGTEKPTNDHAVLDLDDHALHNL-DWDSIMKDLGLHDD  93

Query  246  RNIKPDHNLLF------TPSSESQT---HQFEFTHSLPEFVPSSDFNFSQFQGNINSFDE  398
                     L        PS +  T   H  EFT SL +   + +  F  F    + F+ 
Sbjct  94   SATPVLKTFLHPDDDNNNPSCDDFTPFDHALEFT-SLSDIYSNQNLAF-DFNHLPHDFNH  151

Query  399  NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSL  578
            + + GFD+I+ELI+ A+CFD+  + +AQVIL +LNQ+L S  G PL+RAAFYFKEALQSL
Sbjct  152  HLN-GFDFIEELIRAADCFDTKQLHVAQVILERLNQRLRSPVGKPLQRAAFYFKEALQSL  210

Query  579  LTGSTR  596
            L+GS R
Sbjct  211  LSGSNR  216



>ref|XP_003517241.1| PREDICTED: scarecrow-like protein 15-like [Glycine max]
Length=525

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 108/194 (56%), Gaps = 26/194 (13%)
 Frame = +3

Query  69   YEPKSVLELRRSPSPVLDQKAAPAGNFDV----SDDPLELADNLLTNFEDWDSFMKELGL  236
            YEP SVL+L RSPSP  ++   P  +  V    S D L+L D+ L N  DWDS MK+LGL
Sbjct  40   YEPTSVLDLCRSPSPGTEK---PTTDHSVLVTNSQDYLDLEDHALHNL-DWDSIMKDLGL  95

Query  237  QDDRNIKPDHNLLF-----------TPSSESQTHQFEFTHSLPEFVPSSDFNFSQ---FQ  374
             DD         L             PS +  T    F H+L EF   SD   +Q   F 
Sbjct  96   HDDSATPVLKTFLHPDDDDDDDNNNNPSCDDFT---LFDHAL-EFTTLSDIYSNQNFAFD  151

Query  375  GNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFY  554
             N    D N   GFD+I+ELI+ A+CFD+  + +AQ+IL +LNQ+L S  G PL RAAFY
Sbjct  152  FNHLPHDFNHLNGFDFIEELIRAADCFDTKQLHVAQLILERLNQRLRSPVGKPLHRAAFY  211

Query  555  FKEALQSLLTGSTR  596
             KEALQSLL+GS R
Sbjct  212  LKEALQSLLSGSNR  225



>ref|XP_010531168.1| PREDICTED: scarecrow-like protein 15 [Tarenaya hassleriana]
Length=547

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 111/207 (54%), Gaps = 27/207 (13%)
 Frame = +3

Query  45   NSAAGNGWYEPKSVLELRRSPSPVLDQKAAP----------AGNFDVSDDPLELADNLLT  194
            N+    G+ EP SVL+LR SPSP    +  P           GN     +   L D+++ 
Sbjct  39   NAGRTLGFGEPTSVLDLRGSPSPAAIAEKPPVEVASLVSVGGGNTGQVSEQFPLDDHVMR  98

Query  195  NFEDWDSFMKELGLQDDRN--IKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDFNFSQ  368
            +  DWDS M+EL L DD    +K        P+      Q    H  P+ +   DF  S+
Sbjct  99   SM-DWDSIMRELELDDDSAPALKTSFAAAAVPTHYGVDSQL---HGFPDQLHPVDFGSSE  154

Query  369  -FQGN-------INSFDENWSF---GFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLS  515
             + GN       +NS D +  F   GFD+I++LI+  +C  S  +QLAQV+L +LNQ+L 
Sbjct  155  VYSGNPVGVGYGLNSVDGSDGFVNGGFDFIEDLIRVVDCVQSEELQLAQVVLARLNQRLR  214

Query  516  SAAGNPLRRAAFYFKEALQSLLTGSTR  596
            S +G PL+RAAFYFKEAL S+LTGSTR
Sbjct  215  SPSGRPLQRAAFYFKEALGSVLTGSTR  241



>ref|XP_010099836.1| hypothetical protein L484_009050 [Morus notabilis]
 gb|EXB80596.1| hypothetical protein L484_009050 [Morus notabilis]
Length=557

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 87/224 (39%), Positives = 113/224 (50%), Gaps = 51/224 (23%)
 Frame = +3

Query  60   NGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQ  239
            N  YEP SVL+LRRSPSPV  + A P       +D LE  +    ++ DWDS M+ELGL 
Sbjct  48   NLCYEPTSVLDLRRSPSPVGGKPAQP-------NDSLEWEEQF--HYLDWDSLMRELGLH  98

Query  240  DDRNIKPDHNLLFTPSSESQTHQFEFT---HSLPEF-----------------VPSSDFN  359
            DD    P      T ++ S  HQ       H +P F                     + N
Sbjct  99   DDS--APAFKTATTNTTNSFAHQLNPNCDPHIIPHFSELISHHQPFDPTQLVHHHHHNLN  156

Query  360  FSQFQ---GNINSFDE----------NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQL  500
            FS+      N+N FD           N + GFD++++LI+ A+CFDS+  QLAQ IL +L
Sbjct  157  FSEINLGDHNLNLFDTTSSGEFHNRGNINVGFDFVEDLIRVADCFDSDNSQLAQAILDRL  216

Query  501  NQKLSS-------AAGNPLRRAAFYFKEALQSLLTGSTRPASSS  611
            NQ+L S         G  L+RAA YFK+ALQSLL+GS R A  S
Sbjct  217  NQRLRSNTSPVGKPVGRALQRAALYFKDALQSLLSGSNRTARLS  260



>ref|XP_006409136.1| hypothetical protein EUTSA_v10023133mg [Eutrema salsugineum]
 gb|ESQ50589.1| hypothetical protein EUTSA_v10023133mg [Eutrema salsugineum]
Length=516

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 82/216 (38%), Positives = 118/216 (55%), Gaps = 28/216 (13%)
 Frame = +3

Query  12   MKVPVASNE-NWNSAAGN--GWYEPKSVLELRRSPSPVL--DQKAAPAGNFDVSDDPLEL  176
            M+V  +S+  N NS   N  G+ EP SVL+LRRSPSP    ++    A      D+   L
Sbjct  1    MRVSASSDTTNSNSGGRNLAGYNEPTSVLDLRRSPSPAAAEEKPVISAAEITGGDNQFPL  60

Query  177  ADNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDF  356
             D+++ +  DWDS MKEL L DD       N L    S + +  F     LP F      
Sbjct  61   DDHVMRSM-DWDSIMKELELDDDSAPNLKSNFL----SSAISPHFAVDQQLPGF--PDQL  113

Query  357  NFSQFQG-NINSFDENWSFG---------------FDYIDELIQFAECFDSNAVQLAQVI  488
            + ++F+  ++    + + F                FD+I++LI+  +C +S+ +QLAQV+
Sbjct  114  HPAEFRSSDVYPGGQGYGFESSNNNNNNEGSVNGGFDFIEDLIRVVDCVESDELQLAQVV  173

Query  489  LPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTR  596
            L +LNQ+L S AG PL+RAAFYFKEAL S+L+GSTR
Sbjct  174  LSRLNQRLRSPAGRPLQRAAFYFKEALGSVLSGSTR  209



>gb|KJB17813.1| hypothetical protein B456_003G016500 [Gossypium raimondii]
Length=533

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 104/180 (58%), Gaps = 18/180 (10%)
 Frame = +3

Query  69   YEPKSVLELRRSPSPVLDQKA---APAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQ  239
            YEP SVLELRRSPSP  D                 PLE  +++L N  DWDS MK+LGL 
Sbjct  45   YEPTSVLELRRSPSPGHDNPVDHHQHQQQQQQHQAPLEWDEHVLRNM-DWDSIMKDLGLD  103

Query  240  DD-----RNIKPDHNLL-----FTPSSESQTHQFEFTHSLPEFVPSSDFNFSQFQG-NIN  386
            D+     + I P  N +     FT  S   TH  EF ++L +F PS + + S       N
Sbjct  104  DESVPSIKTIPPQENHIQNLPEFT--SCELTHPTEF-NNLYDFYPSHNIDISNTTTYGFN  160

Query  387  SFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEA  566
            +     + GFD+I+EL++ A+CFD+  +QLAQVIL +L Q+L S +G PL+RAAFYFKEA
Sbjct  161  NMGNFINSGFDFIEELVRAADCFDTQELQLAQVILARLGQRLRSPSGKPLQRAAFYFKEA  220



>ref|XP_007046999.1| GRAS family transcription factor, putative [Theobroma cacao]
 gb|EOX91156.1| GRAS family transcription factor, putative [Theobroma cacao]
Length=684

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 117/205 (57%), Gaps = 30/205 (15%)
 Frame = +3

Query  24   VASNENWNSAAG--NGWYEPKSVLELRRSPSPVLDQKAAPAGNFD--VSDDPL-------  170
            +A N +++   G     YEP SVL+ RRSPSPV ++    + +    +S DP        
Sbjct  29   IARNISFHGLNGVQTSCYEPTSVLDPRRSPSPVPEKPVTNSVDVSNCISSDPHHHQAPSP  88

Query  171  ELADNLLTNFEDWDSFMKELGLQDDRNIKPDHNL---LFTPSSESQTHQFEFTHSLPEFV  341
            E  + +L N  DWDS MK+LGL DD ++ P   +   + +P  E+Q        SLPEF 
Sbjct  89   EWGEYVLRNM-DWDSIMKDLGL-DDESVPPIKTINPQVISPC-ENQIQ------SLPEFT  139

Query  342  PSSDFNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSA  521
             S +        + N+  + +S      +ELI+ A+CFD++ +QLA VIL +LNQ+L S 
Sbjct  140  -SCELTHQSVHSDFNNLYDFYS------EELIRAADCFDTHELQLAHVILARLNQRLRSP  192

Query  522  AGNPLRRAAFYFKEALQSLLTGSTR  596
            +G PL+RAAFYF EALQSL TGSTR
Sbjct  193  SGKPLQRAAFYFNEALQSLFTGSTR  217



>ref|XP_004300613.1| PREDICTED: scarecrow-like protein 15 [Fragaria vesca subsp. vesca]
Length=552

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 115/213 (54%), Gaps = 41/213 (19%)
 Frame = +3

Query  60   NGWYEPKSVLELRRSPSPVLDQKAAPAGNF-DV---SDDPLELADNLLTNFEDWDSFMKE  227
            N  YEP SVL+LR SPSPV   K +      DV    D PLE  + +     DWDS M++
Sbjct  39   NLCYEPTSVLDLRHSPSPVAADKPSKVSPISDVLTHHDQPLEWDEQV-----DWDSIMRD  93

Query  228  LGLQDDR--NIKPDHNLLFTPS----SESQTHQF-EFTHSLPEFVPS----SDFNFSQF-  371
            LGL DD   N+K         +    SE Q H   E+ H  P F P+    SDF+ S+  
Sbjct  94   LGLHDDSVPNLKATTTTNTHLNHHHNSEPQIHHLPEYPHPQP-FDPTQLVHSDFSLSEVY  152

Query  372  ------QGNINSFDE-------NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL  512
                    N+ S+D+       N + GFD+I+ELI+ A+CFDS+ + LAQVIL +LNQ+ 
Sbjct  153  SSQNFSHHNLTSYDQTDTHPSLNSNVGFDFIEELIRAADCFDSDELNLAQVILDRLNQRQ  212

Query  513  ------SSAAGNPLRRAAFYFKEALQSLLTGST  593
                  S   G PL+RAA YFK+ALQSLL  ST
Sbjct  213  RLISPNSKPVGKPLQRAAVYFKDALQSLLNTST  245



>ref|XP_008453725.1| PREDICTED: scarecrow-like protein 15 [Cucumis melo]
Length=533

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 112/199 (56%), Gaps = 29/199 (15%)
 Frame = +3

Query  48   SAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDD-----PLELADNLLTNFEDWD  212
            S A    YEP SVL+LRRSPSPV     AP      SDD     PL+  +  L N  DWD
Sbjct  39   STAATTCYEPTSVLDLRRSPSPV-----APDNPLSSSDDRHNNHPLDWDEQALHNL-DWD  92

Query  213  SFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSL----------PEFVPSSDF-N  359
            S M +LGL DD N    +N     + +   H  EF HS           P+F  S  F N
Sbjct  93   SIMGDLGLHDDSNSSLKNNT----NHDHVPHFPEFLHSQSLDQTSHLLPPDFFLSEPFSN  148

Query  360  FS-QFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL-SSAAGNP  533
             S     + NSF+ N +   D++++L+  A+CFDSN  QLA VIL +LNQ+L S+++ NP
Sbjct  149  HSPTILQSFNSFNPN-NPSLDFLEDLVAAADCFDSNDFQLAHVILERLNQRLQSTSSTNP  207

Query  534  LRRAAFYFKEALQSLLTGS  590
            L RAAF+FKEALQSLL+ S
Sbjct  208  LHRAAFFFKEALQSLLSPS  226



>ref|XP_010489558.1| PREDICTED: scarecrow-like protein 15 [Camelina sativa]
Length=506

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 113/199 (57%), Gaps = 18/199 (9%)
 Frame = +3

Query  12   MKVPVASNENWNSAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDD-PLELADNL  188
            M+VP +S+ N NS     + EP SVL+LRRSPSP      A      VSD  PL+  D+ 
Sbjct  1    MRVPASSDTNSNSNL-VCFNEPTSVLDLRRSPSP--SPSTAEEKPLLVSDQFPLDDDDHG  57

Query  189  LTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVP--SSDFNF  362
            +    DWDS MKEL L DD N+KP+      PSS   +     T + P  +P      + 
Sbjct  58   MRCSMDWDSIMKELDLDDD-NLKPNF-----PSSPHFS-----TAADPPLLPIFPDQLHP  106

Query  363  SQF-QGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLR  539
             +F  G+   F+     G D++++LI+     DS+ +QLAQVIL +LNQ+L S  G PL 
Sbjct  107  PEFPAGHGYGFNNEGGGGLDFVEDLIRVVNYVDSDELQLAQVILSRLNQRLRSPTGRPLE  166

Query  540  RAAFYFKEALQSLLTGSTR  596
            RAAFYFKEAL SL+TG+ R
Sbjct  167  RAAFYFKEALGSLITGTNR  185



>gb|EPS73060.1| hypothetical protein M569_01698, partial [Genlisea aurea]
Length=492

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/202 (40%), Positives = 116/202 (57%), Gaps = 30/202 (15%)
 Frame = +3

Query  72   EPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDS-FMKELGLQDDR  248
            EPKSVLEL+ SP    D++      F+V  + L+L D+L    +DW S +M ELGL  D 
Sbjct  1    EPKSVLELKGSPKLDSDRR------FEV--ETLQLEDHL--EVDDWGSCWMGELGLLKDD  50

Query  249  NIKPDHNLLFTPS------SESQTHQFEFTHSL-PEFVPSSDFNFS-QFQGNINSFDE--  398
              + +              +E++   +EF  S   E  P +DF FS  + G + S +   
Sbjct  51   EEEEEEEEDDDSGFSKCFPAENRQIVYEFPASFDSEQFPGADFEFSPGYGGAVGSLEGFA  110

Query  399  ------NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFK  560
                  NW+ G DY+D+LI+ AECFD +++Q+ +VIL +LN++L S AG PL+RAAFYFK
Sbjct  111  GDLVAGNWNVGLDYVDDLIRLAECFDGDSLQVREVILGRLNERLRSPAGKPLQRAAFYFK  170

Query  561  EALQSLLTG---STRPASSSFE  617
            EA+QS+LT    + R A+ S E
Sbjct  171  EAIQSILTAMAPAVRRAAGSSE  192



>ref|XP_009114695.1| PREDICTED: scarecrow-like protein 15 [Brassica rapa]
Length=491

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 108/199 (54%), Gaps = 20/199 (10%)
 Frame = +3

Query  12   MKVPVASNENWNSAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLL  191
            M+VP +S+ N        + EP SVL LRRSP+P   ++          D+     D+ +
Sbjct  1    MRVPASSDSNSGGKNLVVYDEPTSVLGLRRSPTPTTVEEKPLVSAASGGDNQFPSDDHAM  60

Query  192  TNFEDWDSFMKELGLQDDR--NIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDFNFS  365
             +  DWDS M+EL L DD   N+KP+    F P +    H       LP F      N +
Sbjct  61   RSM-DWDSIMRELELDDDSTPNLKPN----FPPPA----HFAVVDPPLPGF--PDQLNPA  109

Query  366  QFQGNINSFDEN--WSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLR  539
            ++      +D N     GFD I++LI+  +C DS+ +Q AQVIL +LNQ+L S AG PL 
Sbjct  110  EY-----GYDNNNEGGGGFDIIEDLIRVVDCVDSDELQHAQVILSRLNQRLRSPAGRPLL  164

Query  540  RAAFYFKEALQSLLTGSTR  596
            RAAFYFKEAL SLL+GS R
Sbjct  165  RAAFYFKEALGSLLSGSNR  183



>ref|XP_004509243.1| PREDICTED: scarecrow-like protein 15-like [Cicer arietinum]
Length=531

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/201 (39%), Positives = 105/201 (52%), Gaps = 39/201 (19%)
 Frame = +3

Query  69   YEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQDD-  245
            YEP+SVLEL RSPSP    +  P    +V +D   L      N + WDS MK+LGLQDD 
Sbjct  40   YEPRSVLELCRSPSP----EKKPTQQEEVEEDHASLP-----NLDWWDSIMKDLGLQDDS  90

Query  246  ---------RNIK---------------PDHNLLFTPSSESQTHQFEFTHSLPEFVPSSD  353
                      NI                P H+    P   +         +L    P+++
Sbjct  91   STPIPLLKNTNINTHETSNPCIPEIYPNPSHDQFDQPQDFTTLSDIYSNQNLAYNYPNTN  150

Query  354  FNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNP  533
             N      + N+ + NW    D+I+ELI+ A+CFD++ +QLAQ IL +LNQ+L S  G P
Sbjct  151  TNLDHLVNDFNN-NSNW----DFIEELIRAADCFDNSHLQLAQAILERLNQRLRSPTGKP  205

Query  534  LRRAAFYFKEALQSLLTGSTR  596
            L RAAF+FK+ALQSLL+GS R
Sbjct  206  LHRAAFHFKDALQSLLSGSNR  226



>gb|KGN53268.1| GRAS family transcription factor [Cucumis sativus]
Length=532

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 107/183 (58%), Gaps = 11/183 (6%)
 Frame = +3

Query  69   YEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQDDR  248
            YEP SVL+LRRSPSPV       + +   ++ PL+  +  L N  DWDS M +LGL DD 
Sbjct  47   YEPTSVLDLRRSPSPVAPDNPLSSADDRHNNHPLDWDEQALHNL-DWDSIMGDLGLHDDS  105

Query  249  N--IKPDHNLLFTPSSESQTHQFEFTHSL----PEFVPSSDFNFS--QFQGNINSFDENW  404
            N  +K + N    P      H     H+     P+F  S  F+        + NSF+ N 
Sbjct  106  NSSLKNNTNHDHVPHFPEFLHSQSLDHTSHLLPPDFFLSEPFSNHPPTVLQSFNSFNPN-  164

Query  405  SFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL-SSAAGNPLRRAAFYFKEALQSLL  581
            +   D++++LI  A+CFDSN  QLA VIL +LNQ+L S+++ NPL RAAF+FKEALQSLL
Sbjct  165  NPSLDFLEDLIAAADCFDSNDFQLAHVILERLNQRLQSTSSTNPLHRAAFFFKEALQSLL  224

Query  582  TGS  590
            + S
Sbjct  225  SPS  227



>ref|XP_004146542.1| PREDICTED: scarecrow-like protein 15-like [Cucumis sativus]
Length=532

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 106/183 (58%), Gaps = 11/183 (6%)
 Frame = +3

Query  69   YEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQDDR  248
            YEP SVL+LRRSPSPV         +   ++ PL+  +  L N  DWDS M +LGL DD 
Sbjct  47   YEPTSVLDLRRSPSPVAPDNPLSVAHDRHNNHPLDWDEQALHNL-DWDSIMGDLGLHDDS  105

Query  249  N--IKPDHNLLFTPSSESQTHQFEFTHSL----PEFVPSSDFNFS--QFQGNINSFDENW  404
            N  +K + N    P      H     H+     P+F  S  F+        + NSF+ N 
Sbjct  106  NSSLKNNTNHDHVPHFPEFLHSQSLDHTSHLLPPDFFLSEPFSNHPPTVLQSFNSFNPN-  164

Query  405  SFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL-SSAAGNPLRRAAFYFKEALQSLL  581
            +   D++++LI  A+CFDSN  QLA VIL +LNQ+L S+++ NPL RAAF+FKEALQSLL
Sbjct  165  NPSLDFLEDLIAAADCFDSNDFQLAHVILERLNQRLQSTSSTNPLHRAAFFFKEALQSLL  224

Query  582  TGS  590
            + S
Sbjct  225  SPS  227



>ref|XP_004172401.1| PREDICTED: scarecrow-like protein 15-like [Cucumis sativus]
Length=504

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 101/181 (56%), Gaps = 35/181 (19%)
 Frame = +3

Query  69   YEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQDD-  245
            YEP SVL+LRRSPSPV       + +   ++ PL+  +  L N  DWDS M +LGL DD 
Sbjct  47   YEPTSVLDLRRSPSPVAPDNPLSSADDRHNNHPLDWDEQALHNL-DWDSIMGDLGLHDDS  105

Query  246  -----RNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDFNFSQFQGNINSFDENWSF  410
                  N   DH LL +P +  Q+                           NSF+ N + 
Sbjct  106  NSSLKNNTNHDHALLKSPPTVLQS--------------------------FNSFNPN-NP  138

Query  411  GFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL-SSAAGNPLRRAAFYFKEALQSLLTG  587
              D++++LI  A+CFDSN  QLA VIL +LNQ+L S+++ NPL RAAF+FKEALQSLL+ 
Sbjct  139  SLDFLEDLIAAADCFDSNDFQLAHVILERLNQRLQSTSSTNPLHRAAFFFKEALQSLLSP  198

Query  588  S  590
            S
Sbjct  199  S  199



>emb|CDY43895.1| BnaA07g01720D [Brassica napus]
Length=491

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 107/199 (54%), Gaps = 20/199 (10%)
 Frame = +3

Query  12   MKVPVASNENWNSAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLL  191
            M+VP +S+ N        + EP SVL LRRSP+P   ++          D+     D+ +
Sbjct  1    MRVPASSDSNSGGKNLVVYDEPTSVLGLRRSPTPTTVEEKPLVSAASGGDNQFPSDDHAM  60

Query  192  TNFEDWDSFMKELGLQDDR--NIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDFNFS  365
             +  DWDS M+EL L DD   N+KP+    F P +    H       LP F      N +
Sbjct  61   RSM-DWDSIMRELELDDDSTPNLKPN----FPPPA----HFAVVDPPLPVF--PDQLNPA  109

Query  366  QFQGNINSFDEN--WSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLR  539
            ++      +D N     GFD I++LI+  +C DS+ +Q A VIL +LNQ+L S AG PL 
Sbjct  110  EY-----GYDNNNEGGGGFDIIEDLIRVVDCVDSDELQHAHVILSRLNQRLRSPAGRPLL  164

Query  540  RAAFYFKEALQSLLTGSTR  596
            RAAFYFKEAL SLL+GS R
Sbjct  165  RAAFYFKEALGSLLSGSNR  183



>ref|XP_003629479.1| GRAS family transcription factor [Medicago truncatula]
 gb|AET03955.1| GRAS family transcription factor [Medicago truncatula]
Length=542

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 114/201 (57%), Gaps = 33/201 (16%)
 Frame = +3

Query  69   YEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNL-LTNFEDWDSFMKELGLQDD  245
            YEP+SVLEL RSPSP    +  P+      +  +E  D+  L N + WDS MK+LGLQDD
Sbjct  45   YEPRSVLELCRSPSP----EKKPSQQEQEHNPEVEQEDHASLPNLDWWDSIMKDLGLQDD  100

Query  246  RNIKPDHNLLFTPSSESQTH------QFEFTHSLPEFVPSSD---------FNFSQFQGN  380
             +  P   LL   ++ S+ +      QF+ T    +F   SD         +N+     N
Sbjct  101  SS-TPIIPLLKNTNNTSEIYPNPSQDQFDQTQ---DFTSLSDIYSNNQNLAYNYPNTNTN  156

Query  381  INSF---------DENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNP  533
            ++           + N +  +D+I+ELI+ A+CFD+N +QLAQ IL +LNQ+L S  G P
Sbjct  157  LDHLVNDFNNNQPNNNTNSNWDFIEELIRAADCFDNNHLQLAQAILERLNQRLRSPTGKP  216

Query  534  LRRAAFYFKEALQSLLTGSTR  596
            L RAAF+FK+ALQSLL+GS R
Sbjct  217  LHRAAFHFKDALQSLLSGSNR  237



>emb|CDY13032.1| BnaC07g03310D [Brassica napus]
Length=493

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 108/197 (55%), Gaps = 14/197 (7%)
 Frame = +3

Query  12   MKVPVASNENWNSAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLL  191
            M+VP +SN N        + EP SVL LRRSP+P   ++          D+     D+ +
Sbjct  1    MRVPASSNSNSGGKNLVVYDEPTSVLGLRRSPTPTTVEEKPLVSAASGGDNQFPSDDHAM  60

Query  192  TNFEDWDSFMKELGLQDDR--NIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDFNFS  365
             +  DWDS M+EL L DD   N+KP+    F P +    H       LP F      N +
Sbjct  61   RSM-DWDSIMRELELDDDSTPNLKPN----FPPPA----HFAVVDPPLPVF--PDQLNPA  109

Query  366  QFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRA  545
            ++ G  ++ +     GFD I++LI+  +C DS+ +Q A VIL +LNQ+L S AG PL RA
Sbjct  110  EY-GYDSNSNNGGGGGFDIIEDLIRVVDCVDSDELQHAHVILSRLNQRLRSPAGRPLLRA  168

Query  546  AFYFKEALQSLLTGSTR  596
            AFYFKEAL SLL+GS R
Sbjct  169  AFYFKEALGSLLSGSNR  185



>ref|XP_010548348.1| PREDICTED: scarecrow-like protein 15 [Tarenaya hassleriana]
Length=562

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 79/214 (37%), Positives = 114/214 (53%), Gaps = 28/214 (13%)
 Frame = +3

Query  27   ASNENWNSAAGNGWYEPKSVLELRRSPSP-----------VLDQKAAPAGNFDVSDDPLE  173
            +S     +  G G+ EP SVL+LR SPSP           V  + +   G      +   
Sbjct  36   SSVATVTAGGGLGFNEPTSVLDLRGSPSPAAAAADKPPVAVAGEVSGGGGTTGQVSEQFP  95

Query  174  LADNLLTNFEDWDSFMKELGLQDDRN--IKPDHNLLFTPSSESQTHQFEFTHSLPEFVPS  347
            L ++++ +  DWDS M+EL L DD    +K        P+      Q     S P+ +  
Sbjct  96   LDEHVMRSM-DWDSIMRELELDDDSAPALKSSFTTAAIPTHYGADSQLP---SFPDQLHP  151

Query  348  SDFNFS------QFQGN--INSFDENWSF---GFDYIDELIQFAECFDSNAVQLAQVILP  494
            +DF  S      Q  G   +NS D +  F   GFD+I++LI+  +C DS+ +QLAQV+L 
Sbjct  152  ADFESSEVYLGHQIGGGHGLNSVDVSDGFVNGGFDFIEDLIRVVDCVDSDELQLAQVVLA  211

Query  495  QLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTR  596
            +LNQ+L S +G PL+RAAFYFKEAL ++L+GSTR
Sbjct  212  RLNQRLRSPSGRPLKRAAFYFKEALATVLSGSTR  245



>gb|EYU44670.1| hypothetical protein MIMGU_mgv1a026210mg [Erythranthe guttata]
Length=483

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 87/217 (40%), Positives = 108/217 (50%), Gaps = 48/217 (22%)
 Frame = +3

Query  12   MKVPVASNENWNSAAGNGWYEP----KSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELA  179
            MKVP + N   N              KSVLEL    SP+ +QK            PL L 
Sbjct  1    MKVPFSVNTQNNPKPPPATAAAAYEPKSVLEL--CGSPISNQK------------PLILV  46

Query  180  DNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDFN  359
            D  L    DWDSF  ELGL D      D N +  P+     HQ   +H L + +P+  ++
Sbjct  47   DPQLV---DWDSF-SELGLHDHH----DPNSVSKPT----IHQLN-SHPLTQIIPTDQYS  93

Query  360  FSQFQGN----------------INSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVIL  491
                Q +                INSFD   SF   Y++ELIQ AE  D+N++QL  V+L
Sbjct  94   NQLLQTDFGSLSDIPLIHDNSYSINSFDSFTSFD-GYVNELIQLAESIDTNSLQLGNVLL  152

Query  492  PQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRPA  602
             +LNQ LSS AG PL+R AFYFKEALQ LLT STRP+
Sbjct  153  SRLNQTLSSPAGKPLQRIAFYFKEALQCLLTESTRPS  189



>ref|XP_004146541.1| PREDICTED: scarecrow-like protein 15-like [Cucumis sativus]
 ref|XP_004169023.1| PREDICTED: scarecrow-like protein 15-like [Cucumis sativus]
 gb|KGN53267.1| hypothetical protein Csa_4G043830 [Cucumis sativus]
Length=508

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 81/210 (39%), Positives = 118/210 (56%), Gaps = 22/210 (10%)
 Frame = +3

Query  12   MKVPVASNENWN--SAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADN  185
            M+VPV ++++ +  S+      EP SVL+LRR+PSPV         +   ++ PL+  + 
Sbjct  1    MRVPVPNHQSSSLPSSTPKLHSEPTSVLDLRRTPSPVAPDNPLSVAHDRHNNHPLDWDEQ  60

Query  186  LLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQF-EFTHSL----------P  332
             L N  DWDS M +LGL DD N    +N     ++  +   F EF HS           P
Sbjct  61   ALHNL-DWDSIMGDLGLHDDSNSSLQNN-----TNHDRVPNFPEFLHSQSLDQTSHLLPP  114

Query  333  EFVPSSDFNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL  512
            +F  S  F+ +     + SF+ N +   D+ ++L+  A+CFDSN  QLA VIL +LNQ+L
Sbjct  115  DFFLSEPFS-NHSPTILQSFNSN-NPSLDFFEDLVAAADCFDSNDFQLAHVILERLNQRL  172

Query  513  -SSAAGNPLRRAAFYFKEALQSLLTGSTRP  599
             S+++  PL RAAF+ KEALQSLL+ ST P
Sbjct  173  QSTSSAKPLHRAAFFIKEALQSLLSPSTNP  202



>ref|XP_010667697.1| PREDICTED: scarecrow-like protein 15 [Beta vulgaris subsp. vulgaris]
Length=589

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 80/202 (40%), Positives = 100/202 (50%), Gaps = 35/202 (17%)
 Frame = +3

Query  69   YEPKSVLELRRSPSPVLDQKAAPA-----GNFDVSDDPLELADNLLTNFEDWDSFMKELG  233
            YEP SVL+L+RSPSP                 + +  P    D  L N E WDS + ELG
Sbjct  53   YEPTSVLDLQRSPSPATAATKTATPPPSDTKHNTNHPPTTAVD--LDNLEGWDSILSELG  110

Query  234  LQDDRNIKPDHNLLFTPSSESQTHQFE----------FTHSLPEF-VPSSDFNFSQFQGN  380
            L DD N   +  LL +  S  ++H  +          F HS P   +PS   NF  F  N
Sbjct  111  LNDDSNTN-NSKLLLSQISPCESHLTQVLPDFPSSQPFDHSQPPINLPSDYANFCDFSYN  169

Query  381  IN------SFDE----------NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL  512
             N       FD           N +FG D+ID+LI+ A+ F+SN  Q   VIL +LNQ+L
Sbjct  170  QNLNPNFGPFDHQLHHQTNTNSNTNFGLDFIDDLIRAAQAFESNDSQQVHVILARLNQRL  229

Query  513  SSAAGNPLRRAAFYFKEALQSL  578
             S  G PL+RAAFYFKEALQ L
Sbjct  230  RSPVGKPLQRAAFYFKEALQHL  251



>ref|XP_008453726.1| PREDICTED: scarecrow-like protein 15 [Cucumis melo]
Length=511

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 117/210 (56%), Gaps = 23/210 (11%)
 Frame = +3

Query  12   MKVPVASNENWNSAAGNGWY--EPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADN  185
            M+VPV ++++ + ++       EP SVL+L R+PSPV       + +   ++ PL+  + 
Sbjct  1    MRVPVPNHQSSSLSSSTPKLHSEPTSVLDLHRTPSPVAPDNPLSSAHDRHNNHPLDWDEQ  60

Query  186  LLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQF-EFTHSL----------P  332
             L N  DWDS M +LGL DD N    +N     +S      F EF HS           P
Sbjct  61   ALHNL-DWDSIMGDLGLHDDSNSSLKNN-----TSHDHVPNFPEFLHSQSLDQTSHLLPP  114

Query  333  EFVPSSDFNFS--QFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQ  506
            +F  S  F+        + NSF+ N +   D++++L+  A+CFDSN  QLA VIL +LNQ
Sbjct  115  DFFISEPFSNHPPTILQSFNSFNSN-NPSLDFLEDLVAAADCFDSNDFQLAHVILERLNQ  173

Query  507  KL-SSAAGNPLRRAAFYFKEALQSLLTGST  593
            +L S+++  P+ RAAF+ KEALQSLL+ ST
Sbjct  174  RLQSTSSAKPIHRAAFFIKEALQSLLSPST  203



>gb|KFK40237.1| hypothetical protein AALP_AA3G348400 [Arabis alpina]
Length=438

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 104/198 (53%), Gaps = 45/198 (23%)
 Frame = +3

Query  12   MKVPVASNENWNSAAGNGWYEPKSVLELRRSPSP--VLDQKAAPAGNFDVSDDPLELADN  185
            M+VP +S+ N N   G  + EP SVL+LRRSPSP  V+ Q         V ++ L    +
Sbjct  1    MRVPASSDSNSNLVIG--YNEPTSVLDLRRSPSPTNVIHQT--------VDENGLCSHHH  50

Query  186  LLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDFNFS  365
            ++ +  DWDS MKEL L D+       NL              F+   P   P+++ N  
Sbjct  51   VMHSI-DWDSIMKELELDDETTPTLKSNLPLNTI---------FSIDPP---PNTNNN--  95

Query  366  QFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRA  545
                             DY+ +LI+ A+C DS+ +QLAQVIL +LN  L S  G PL+RA
Sbjct  96   -----------------DYVSDLIRVADCIDSDELQLAQVILSRLNHCLRSPVGRPLQRA  138

Query  546  AFYFKEALQS-LLTGSTR  596
            AFYFKEAL+S L+TGS R
Sbjct  139  AFYFKEALESVLITGSNR  156



>ref|XP_009356715.1| PREDICTED: scarecrow-like protein 15, partial [Pyrus x bretschneideri]
Length=220

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 105/196 (54%), Gaps = 43/196 (22%)
 Frame = +3

Query  63   GWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSD-------DPLELADNLLTNFEDWDSFM  221
            G YEP SVL+LR SPSPV  +K  P+    +SD       DP+E  + +     DWDS M
Sbjct  38   GGYEPTSVLDLRHSPSPVSAEK--PSKILAISDVLSHSNHDPVEWEEQV-----DWDSIM  90

Query  222  KELGLQDDR--NIKPDHNLLFTPSSESQTHQF-EFTHSLPEFVPS----SDFN--FSQFQ  374
            ++LGL DD   N+K        P   S   Q  E+ H  P F PS    SDFN   S+  
Sbjct  91   RDLGLHDDNVPNLKNS-----IPQLNSNDPQISEYLHPQP-FDPSQLVHSDFNINLSEVY  144

Query  375  GNINSFDE---------NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA-  524
             + N +D          +W+ G D+I+ELI  A+ FDS+ + LAQVIL +LN +L S++ 
Sbjct  145  SSQNCYDHVINDFHQSGSWNVGVDFIEELIGAADRFDSDELPLAQVILDRLNNRLRSSSP  204

Query  525  ----GNPLRRAAFYFK  560
                G PL+RAA YFK
Sbjct  205  SKPVGKPLQRAAVYFK  220



>ref|XP_009142446.1| PREDICTED: scarecrow-like protein 15 [Brassica rapa]
 emb|CDX75590.1| BnaA01g01120D [Brassica napus]
Length=487

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 86/143 (60%), Gaps = 15/143 (10%)
 Frame = +3

Query  204  DWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEF---VPSSDFNFS---  365
            DWDS MKEL L DD    P     FT +  +    +    +LP F   +  SDF+ S   
Sbjct  40   DWDSIMKELELDDDSTPNPLKTE-FTTTDSAIGPLYAVDSNLPGFPDQIQPSDFDSSDAY  98

Query  366  --QFQG----NINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAG  527
              Q  G    +++S D     GFD++++LI+  +C +S+ +QLAQVIL +LNQ+L S AG
Sbjct  99   QNQTTGYGFTSLDSVDNGG--GFDFVEDLIRVVDCVESDELQLAQVILSRLNQRLRSPAG  156

Query  528  NPLRRAAFYFKEALQSLLTGSTR  596
             PL+RAAFYFKEAL SLLTGS R
Sbjct  157  RPLQRAAFYFKEALGSLLTGSNR  179



>ref|XP_003519903.1| PREDICTED: scarecrow-like protein 15-like [Glycine max]
Length=523

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 112/203 (55%), Gaps = 32/203 (16%)
 Frame = +3

Query  69   YEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQDDR  248
            YEP SVL+L RSPSP  ++K          ++ L+L D++L N + W+S MK+L L +D 
Sbjct  26   YEPTSVLDLCRSPSP--EKKLTVPKPEPQHNNQLDLDDHVLPNSDWWESIMKDLTLPEDS  83

Query  249  N---IKPDHNLL--FTPSSESQTHQFEFTHSLPEFVPSSDF----------------NFS  365
                +K + + +  F PSS+  +    F H  P+F   S+                 +F 
Sbjct  84   PTPLLKTNPSCIPDFPPSSQDPS----FDHPTPDFTSLSEIYNQNIPFNYPSNTLEPSFH  139

Query  366  QFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL-SSAAGNPLRR  542
                +++  + NW    D+I+E I+ A+C+DS+  QLAQ IL +LN +L  S  G PL R
Sbjct  140  DLNHSLHPHNNNW----DFIEEFIRAADCYDSSHFQLAQAILERLNNRLLRSPMGKPLHR  195

Query  543  AAFYFKEALQSLLTGSTRPASSS  611
            AAF+FK+ALQS+L+GS R  + S
Sbjct  196  AAFHFKDALQSILSGSNRNGNGS  218



>emb|CDX69238.1| BnaC01g02150D [Brassica napus]
Length=489

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 84/143 (59%), Gaps = 15/143 (10%)
 Frame = +3

Query  204  DWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEF---VPSSDFNFSQFQ  374
            DWDS MKEL L DD    P     FT +  +    +    +LP F   +  SDF+ S   
Sbjct  40   DWDSIMKELELDDDSTPNPLKTE-FTTTDSAIGPLYAVDSNLPGFPDQIQPSDFDSSDAY  98

Query  375  GN---------INSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAG  527
             N         ++S D     GFD++++LI+  +C +S+ +QLAQVIL +LNQ+L S AG
Sbjct  99   QNQTAGYGFTSLDSVDNGG--GFDFVEDLIRVVDCVESDELQLAQVILSRLNQRLRSPAG  156

Query  528  NPLRRAAFYFKEALQSLLTGSTR  596
             PL+RAAFYFKEAL SLLTGS R
Sbjct  157  RPLQRAAFYFKEALGSLLTGSNR  179



>ref|XP_009374236.1| PREDICTED: scarecrow-like protein 15 [Pyrus x bretschneideri]
Length=548

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 103/208 (50%), Gaps = 34/208 (16%)
 Frame = +3

Query  63   GWYEPKSVLELRRSPSPVLDQKAAPAGNFD-----VSDDPLELADNLLTNFEDWDSFMKE  227
            G YEP SVL+LR+SPSPV  +K +            + DPLE  D  + +  DWDS M++
Sbjct  38   GGYEPTSVLDLRQSPSPVSAEKPSKISGISNVLSHSNHDPLEWEDEQVLHNLDWDSIMRD  97

Query  228  LGLQDDR--NIKPDHNLLFTPSSESQTHQF-EFTHSLPEFVPSS------DFNFSQFQGN  380
            LGL DD   N+K        P   +   Q  E+ H   +F P+       D N S+   +
Sbjct  98   LGLHDDNVPNLKTS-----IPQLNANDPQISEYPHP-QQFDPTQLVHSDYDINLSEVYSS  151

Query  381  INSFDE---------NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA---  524
             N +D          NW+ G D+I+ELI+ A+CFD+  +QLAQVIL +LN +L S++   
Sbjct  152  QNCYDHVTNDFHPSGNWNVGLDFIEELIRAADCFDTEELQLAQVILDRLNHRLRSSSPSK  211

Query  525  --GNPLRRAAFYFKEALQSLLTGSTRPA  602
              G P            QSLL GS   A
Sbjct  212  PVGKPXXXXXXXXXXXXQSLLNGSDTAA  239



>gb|KJB71048.1| hypothetical protein B456_011G102400 [Gossypium raimondii]
Length=517

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 116/235 (49%), Gaps = 57/235 (24%)
 Frame = +3

Query  12   MKVPVAS--------------NENWNSAAGNGWY----------EPKSVLELRRSPSPVL  119
            M+VPV S              N N    AGN  +          EP   L+LRRSPS  +
Sbjct  1    MRVPVCSPQGNHYPIPKPDINNNNITITAGNISFLNSSVPASSCEPTLDLDLRRSPSSAV  60

Query  120  DQKAA--PAGN---FDVS-----DDPLELADNLLTNFEDWDSFMKELGLQDD-----RNI  254
             +K    PA N   F VS        LE  +++L N  DWD+ +K+ GL D+     + I
Sbjct  61   TEKPVSNPADNSNCFSVSGPHQQQAGLEWDEHVLRNM-DWDAILKDFGLDDESVPATKTI  119

Query  255  KPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDFNFSQFQGNINSFDENWSFGFDYIDEL  434
             P    +  P  ++         ++PE   S +        + N ++        Y ++L
Sbjct  120  PPQ---VINPRLDNHIQ------NVPELT-SCELTHHPLHSDFNLYE-------SYSEDL  162

Query  435  IQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRP  599
            I+ A CFD++ +QLAQVIL +L+Q+L S +G PL+RAAFYFKEALQSL TGST P
Sbjct  163  IRAANCFDTHDLQLAQVILDRLHQRLRSPSGEPLQRAAFYFKEALQSLFTGSTWP  217



>ref|XP_006283643.1| hypothetical protein CARUB_v10004700mg [Capsella rubella]
 gb|EOA16541.1| hypothetical protein CARUB_v10004700mg [Capsella rubella]
Length=483

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 86/146 (59%), Gaps = 17/146 (12%)
 Frame = +3

Query  204  DWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTH---QFEFTHSLPEF---VPSSDFNFS  365
            DWDS MKEL L DD    P+      P+S + +     +    +LP F   +  SDF  S
Sbjct  34   DWDSIMKELELDDDS--APNSLKTSFPTSTTDSTILPLYAVDSNLPGFPDQIQPSDFESS  91

Query  366  --------QFQG-NINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSS  518
                    Q  G   NS D   + GFD+I++LI+  +C +S+ +QLAQV+L +LNQ+L S
Sbjct  92   TDVYPGQNQATGYGFNSLDSVDNGGFDFIEDLIRVVDCVESDELQLAQVVLSRLNQRLRS  151

Query  519  AAGNPLRRAAFYFKEALQSLLTGSTR  596
             AG PL+RAAFYFKEAL SLLTG+ R
Sbjct  152  PAGRPLQRAAFYFKEALGSLLTGNNR  177



>gb|AAT75161.1| SCARECROW-like protein [Brassica napus]
 emb|CDX72597.1| BnaC07g46190D [Brassica napus]
Length=461

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 81/136 (60%), Gaps = 20/136 (15%)
 Frame = +3

Query  204  DWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEF--VPSSDF--NFSQF  371
            DWDS MKEL + DD             S+  Q     F  +LP F  + SSD     +Q 
Sbjct  37   DWDSIMKELEVDDD-------------SAPYQLQPSSF--NLPVFPDIDSSDVYPGPNQI  81

Query  372  QG-NINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAA  548
             G   NS D   + GFDYI++LI+  +C +S+ + LA V+L QLNQ+L ++AG PL+RAA
Sbjct  82   TGYGFNSLDSVDNGGFDYIEDLIRVVDCIESDELHLAHVVLSQLNQRLQTSAGRPLQRAA  141

Query  549  FYFKEALQSLLTGSTR  596
            FYFKEAL SLLTG+ R
Sbjct  142  FYFKEALGSLLTGTNR  157



>ref|XP_006411970.1| hypothetical protein EUTSA_v10025054mg [Eutrema salsugineum]
 gb|ESQ53423.1| hypothetical protein EUTSA_v10025054mg [Eutrema salsugineum]
Length=484

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 83/149 (56%), Gaps = 26/149 (17%)
 Frame = +3

Query  204  DWDSFMKELGLQDDRN--------------IKP----DHNLLFTPSSESQTHQFEFTHSL  329
            DWDS MKEL L DD                I P    D NL   P  + Q   FE +   
Sbjct  38   DWDSIMKELELDDDSAPNSLKTGFTTTDSAIGPLYAVDSNLPGFPD-QIQPSDFESSDVY  96

Query  330  PEFVPSSDFNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQK  509
            P    ++ + F    G+++S D     GFD+I++LI+  +C +S+ +Q+A VIL +L Q+
Sbjct  97   PAHNQTAGYGF----GSLDSVDNG---GFDFIEDLIRVVDCIESDELQIAHVILSRLGQR  149

Query  510  LSSAAGNPLRRAAFYFKEALQSLLTGSTR  596
            L S AG PL+RAAFYFKEAL SLLTGS R
Sbjct  150  LRSPAGRPLQRAAFYFKEALGSLLTGSNR  178



>ref|XP_010432142.1| PREDICTED: scarecrow-like protein 15 [Camelina sativa]
Length=486

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 84/148 (57%), Gaps = 17/148 (11%)
 Frame = +3

Query  204  DWDSFMKELGLQDDR---NIKPDHNLLFTPSSESQTHQFEFTHSLPEF---VPSSDFNFS  365
            DWDS MKEL L DD    ++K         S  +    +    +LP F   +  SDF  S
Sbjct  33   DWDSIMKELELDDDSAPNSLKTGFTTTTATSDSTILPLYAVDSNLPGFPDQIQPSDFESS  92

Query  366  Q---FQG--------NINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL  512
                + G          NS D   + GFD+I++LI+  +C +S+ +QLAQVIL +LNQ+L
Sbjct  93   TDIVYPGQNQQPTGYGFNSLDGVDNGGFDFIEDLIRVVDCVESDELQLAQVILSRLNQRL  152

Query  513  SSAAGNPLRRAAFYFKEALQSLLTGSTR  596
             S +G PL+RAAFYFKEAL SLLTG+ R
Sbjct  153  RSPSGRPLQRAAFYFKEALASLLTGTNR  180



>ref|XP_010437311.1| PREDICTED: scarecrow-like protein 15 isoform X1 [Camelina sativa]
Length=486

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 84/148 (57%), Gaps = 17/148 (11%)
 Frame = +3

Query  204  DWDSFMKELGLQDDR---NIKPDHNLLFTPSSESQTHQFEFTHSLPEF---VPSSDFNFS  365
            DWDS MKEL L DD    ++K         +  +    +    +LP F   +  SDF  S
Sbjct  33   DWDSIMKELELDDDSAPNSLKTGFTTTTATTDSTILPLYAVDSNLPGFPDQIQPSDFESS  92

Query  366  Q---FQG--------NINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL  512
                + G          NS D   + GFD+I++LI+  +C +S+ +QLAQVIL +LNQ+L
Sbjct  93   TDIVYPGQNQQPTGYGFNSLDGVDNGGFDFIEDLIRVVDCVESDELQLAQVILSRLNQRL  152

Query  513  SSAAGNPLRRAAFYFKEALQSLLTGSTR  596
             S +G PL+RAAFYFKEAL SLLTG+ R
Sbjct  153  RSPSGRPLQRAAFYFKEALASLLTGTNR  180



>ref|XP_010437312.1| PREDICTED: scarecrow-like protein 15 isoform X2 [Camelina sativa]
 ref|XP_010437313.1| PREDICTED: scarecrow-like protein 15 isoform X3 [Camelina sativa]
Length=486

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 84/148 (57%), Gaps = 17/148 (11%)
 Frame = +3

Query  204  DWDSFMKELGLQDDR---NIKPDHNLLFTPSSESQTHQFEFTHSLPEF---VPSSDFNFS  365
            DWDS MKEL L DD    ++K         +  +    +    +LP F   +  SDF  S
Sbjct  33   DWDSIMKELELDDDSAPNSLKTGFTTTTATTDSTILPLYAVDSNLPGFPDQIQPSDFESS  92

Query  366  Q---FQG--------NINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL  512
                + G          NS D   + GFD+I++LI+  +C +S+ +QLAQVIL +LNQ+L
Sbjct  93   TDIVYPGQNQQPTGYGFNSLDGVDNGGFDFIEDLIRVVDCVESDELQLAQVILSRLNQRL  152

Query  513  SSAAGNPLRRAAFYFKEALQSLLTGSTR  596
             S +G PL+RAAFYFKEAL SLLTG+ R
Sbjct  153  RSPSGRPLQRAAFYFKEALASLLTGTNR  180



>dbj|BAP91520.1| gras family protein [Glycine max]
Length=541

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 81/204 (40%), Positives = 115/204 (56%), Gaps = 25/204 (12%)
 Frame = +3

Query  69   YEPKSVLELRRSPSP---VLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQ  239
            YEP SVL+L RSPSP   +   K  P  N + ++  L+L D++L N + W+S MK+L L 
Sbjct  33   YEPTSVLDLCRSPSPEKKLTVPKPEPQHNNNNNNLNLDLDDHVLPNSDWWESIMKDLALP  92

Query  240  DD-------RNIKPDHNLLFTPSSESQT--HQFEFT-------HSLPEFVPS-----SDF  356
            +D        NI P     F PSS+     H  +FT        +LP   P+     S +
Sbjct  93   EDSPTPLLKTNINPSCIPDFPPSSQDPPFDHPQDFTSLSEIYNQNLPYNYPTNTLEHSFY  152

Query  357  NFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL-SSAAGNP  533
            + S    + N+ +   +  +D+I+ELI+ A+CFDS+  QLAQ IL +LN +L  S  G P
Sbjct  153  DLSHNHHHNNNNNNVNNNNWDFIEELIRAADCFDSSHFQLAQAILERLNNRLLRSPMGKP  212

Query  534  LRRAAFYFKEALQSLLTGSTRPAS  605
            L RAAF+FK+ALQS+L GS R +S
Sbjct  213  LHRAAFHFKDALQSILAGSNRTSS  236



>ref|XP_010446751.1| PREDICTED: scarecrow-like protein 15 isoform X3 [Camelina sativa]
Length=489

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 84/149 (56%), Gaps = 18/149 (12%)
 Frame = +3

Query  204  DWDSFMKELGLQDDR---NIKPDHNLLFTPSSESQTHQFEFTHSLPEF---VPSSDF---  356
            DWDS MKEL L DD    ++K         +  +    +    +LP F   +  SDF   
Sbjct  34   DWDSIMKELELDDDSAPNSLKTGFTTTTATTDSTILPLYAVDSNLPGFPDQIQPSDFESS  93

Query  357  --------NFSQFQG-NINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQK  509
                    N  Q  G   NS D   + GFD+I++LI+  +C +S+ +QLAQVIL +LNQ+
Sbjct  94   TDIVYPGQNQQQPTGYGFNSLDGVDNGGFDFIEDLIRVVDCVESDELQLAQVILSRLNQR  153

Query  510  LSSAAGNPLRRAAFYFKEALQSLLTGSTR  596
            L S +G PL+RAAFYFKEAL SLLTG+ R
Sbjct  154  LRSPSGRPLQRAAFYFKEALASLLTGTNR  182



>ref|XP_010446749.1| PREDICTED: scarecrow-like protein 15 isoform X1 [Camelina sativa]
 ref|XP_010446750.1| PREDICTED: scarecrow-like protein 15 isoform X2 [Camelina sativa]
Length=488

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 84/149 (56%), Gaps = 18/149 (12%)
 Frame = +3

Query  204  DWDSFMKELGLQDDR---NIKPDHNLLFTPSSESQTHQFEFTHSLPEF---VPSSDF---  356
            DWDS MKEL L DD    ++K         +  +    +    +LP F   +  SDF   
Sbjct  34   DWDSIMKELELDDDSAPNSLKTGFTTTTATTDSTILPLYAVDSNLPGFPDQIQPSDFESS  93

Query  357  --------NFSQFQG-NINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQK  509
                    N  Q  G   NS D   + GFD+I++LI+  +C +S+ +QLAQVIL +LNQ+
Sbjct  94   TDIVYPGQNQQQPTGYGFNSLDGVDNGGFDFIEDLIRVVDCVESDELQLAQVILSRLNQR  153

Query  510  LSSAAGNPLRRAAFYFKEALQSLLTGSTR  596
            L S +G PL+RAAFYFKEAL SLLTG+ R
Sbjct  154  LRSPSGRPLQRAAFYFKEALASLLTGTNR  182



>ref|XP_003547994.1| PREDICTED: scarecrow-like protein 15-like [Glycine max]
 dbj|BAP91521.1| gras family protein [Glycine max]
Length=540

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 114/203 (56%), Gaps = 24/203 (12%)
 Frame = +3

Query  69   YEPKSVLELRRSPSP---VLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQ  239
            YEP SVL+L RSPSP   +   K  P  N + ++  L+L D++L N + W+S MK+L L 
Sbjct  33   YEPTSVLDLCRSPSPEKKLTVPKPEPQHNNNNNNLNLDLDDHVLPNSDWWESIMKDLALP  92

Query  240  DD-------RNIKPDHNLLFTPSSESQT--HQFEFT-------HSLPEFVPSSDFNFSQF  371
            +D        NI P     F PSS+     H  +FT        +LP   P++    S +
Sbjct  93   EDSPTPLLKTNINPSCIPDFPPSSQDPPFDHPQDFTSLSEIYNQNLPYNYPTNTLEHSFY  152

Query  372  ----QGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL-SSAAGNPL  536
                  + N+ +   +  +D+I+ELI+ A+CFDS+  QLAQ IL +LN +L  S  G PL
Sbjct  153  DLSHNHHHNNNNNVNNNNWDFIEELIRAADCFDSSHFQLAQAILERLNNRLLRSPMGKPL  212

Query  537  RRAAFYFKEALQSLLTGSTRPAS  605
             RAAF+FK+ALQS+L GS R +S
Sbjct  213  HRAAFHFKDALQSILAGSNRTSS  235



>ref|NP_195389.4| scarecrow-like protein 15 [Arabidopsis thaliana]
 sp|O23210.3|SCL15_ARATH RecName: Full=Scarecrow-like protein 15; Short=AtSCL15; AltName: 
Full=GRAS family protein 25; Short=AtGRAS-25 [Arabidopsis 
thaliana]
 dbj|BAC43101.1| ap2 SCARECROW-like protein [Arabidopsis thaliana]
 gb|AEE86692.1| scarecrow-like protein 15 [Arabidopsis thaliana]
Length=486

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 80/144 (56%), Gaps = 13/144 (9%)
 Frame = +3

Query  204  DWDSFMKELGLQDD----------RNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSD  353
            DWDS MKEL L DD               D  +L   + +S    F       +F  SSD
Sbjct  37   DWDSIMKELELDDDSAPNSLKTGFTTTTTDSTILPLYAVDSNLPGFPDQIQPSDFESSSD  96

Query  354  FNFSQFQGN---INSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA  524
                Q Q      NS D   + GFD+I++LI+  +C +S+ +QLAQV+L +LNQ+L S A
Sbjct  97   VYPGQNQTTGYGFNSLDSVDNGGFDFIEDLIRVVDCVESDELQLAQVVLSRLNQRLRSPA  156

Query  525  GNPLRRAAFYFKEALQSLLTGSTR  596
            G PL+RAAFYFKEAL S LTGS R
Sbjct  157  GRPLQRAAFYFKEALGSFLTGSNR  180



>ref|XP_002869027.1| hypothetical protein ARALYDRAFT_490963 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45286.1| hypothetical protein ARALYDRAFT_490963 [Arabidopsis lyrata subsp. 
lyrata]
Length=486

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 82/145 (57%), Gaps = 14/145 (10%)
 Frame = +3

Query  204  DWDSFMKELGLQDDR--NIKPDHNLLFTPSSESQTHQFEFTHSLPEF---VPSSDFNFS-  365
            DWDS MKEL L DD   N         T +  +    +    +LP F   +  SDF  S 
Sbjct  36   DWDSIMKELELDDDSAPNSLKTGFTTTTTTDSTILPLYAVDSNLPGFPDQIQPSDFESSS  95

Query  366  -------QFQG-NINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSA  521
                   Q  G   NS D   + GFD+I++LI+  +C +S+ +QLAQV+L +LNQ+L S 
Sbjct  96   DVYPGQNQTTGYGFNSLDSVDNGGFDFIEDLIRVVDCVESDELQLAQVVLSRLNQRLRSP  155

Query  522  AGNPLRRAAFYFKEALQSLLTGSTR  596
            AG  L+RAAFYFKEAL SLLTGS R
Sbjct  156  AGRALQRAAFYFKEALGSLLTGSNR  180



>emb|CAB16826.1| SCARECROW-like protein [Arabidopsis thaliana]
 emb|CAB80337.1| SCARECROW-like protein [Arabidopsis thaliana]
Length=486

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 80/144 (56%), Gaps = 13/144 (9%)
 Frame = +3

Query  204  DWDSFMKELGLQDD----------RNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSD  353
            DWDS MKEL L DD               D  +L   + +S    F       +F  SSD
Sbjct  37   DWDSIMKELELDDDSAPNSLKTGFTTTTTDSTILPLYAVDSNLPGFPDQIQPSDFESSSD  96

Query  354  FNFSQFQGN---INSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA  524
                Q Q      NS D   + GFD+I++LI+  +C +S+ +QLAQV+L +LNQ+L S A
Sbjct  97   VYPGQNQTTGYGFNSLDSVDNGGFDFIEDLIRVVDCVESDELQLAQVVLSRLNQRLRSPA  156

Query  525  GNPLRRAAFYFKEALQSLLTGSTR  596
            G PL+RAAFYFKEAL S LTGS R
Sbjct  157  GRPLQRAAFYFKEALGSFLTGSNR  180



>gb|KFK30292.1| hypothetical protein AALP_AA7G242600 [Arabis alpina]
Length=493

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 79/144 (55%), Gaps = 14/144 (10%)
 Frame = +3

Query  204  DWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTH-QFEFTHSLPEF---VPSSDFNFSQF  371
            DWDS MKEL L DD           T +++S     +    +LP F   +  SDF  S  
Sbjct  35   DWDSIMKELELDDDSTPNSLKTSFTTTNTDSTILPLYTVDTNLPGFPDQIQPSDFESSDV  94

Query  372  QGNINSFDENWSF---------GFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA  524
              N N  +  +SF         GFD+I++LI+  +C +S+ +QL  VIL +LNQ+L S  
Sbjct  95   FQNQNQ-NSGYSFNSLENIDNGGFDFIEDLIRVVDCVESDELQLGHVILSRLNQRLRSPV  153

Query  525  GNPLRRAAFYFKEALQSLLTGSTR  596
            G PL+RAAFYFKE L SLLTG  R
Sbjct  154  GRPLQRAAFYFKEGLNSLLTGLNR  177



>ref|XP_010070042.1| PREDICTED: scarecrow-like protein 15 [Eucalyptus grandis]
 gb|KCW58597.1| hypothetical protein EUGRSUZ_H01257 [Eucalyptus grandis]
Length=464

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 79/154 (51%), Gaps = 22/154 (14%)
 Frame = +3

Query  204  DWDSFMKELGLQDDRNIKPDHNLLFTPS---------SESQTHQFEFTHSLPEFVPSSDF  356
            DWDS M++LGL DD       N    P+               Q +      +  P   F
Sbjct  5    DWDSIMRDLGLHDDSAPPFRANPHVCPADAFPPPPPPPPHHQQQQQQQQHHQQLEPPGHF  64

Query  357  ---NFSQFQGNINSFDE------NW-SFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQ  506
                F+   G  N  D        W   G D+ DELIQ AECFDS+ +QLAQ+IL +LNQ
Sbjct  65   LPHEFALSDGYSNPLDSCADSPAGWNGLGPDFFDELIQAAECFDSSELQLAQMILARLNQ  124

Query  507  KLSSAAGNPLRRAAFYFKEALQSLL---TGSTRP  599
            +L S AG P++RAAFYFKEA QSLL   +GS RP
Sbjct  125  RLRSPAGKPVQRAAFYFKEAFQSLLLLQSGSNRP  158



>ref|XP_007156025.1| hypothetical protein PHAVU_003G252200g [Phaseolus vulgaris]
 gb|ESW28019.1| hypothetical protein PHAVU_003G252200g [Phaseolus vulgaris]
Length=544

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 106/212 (50%), Gaps = 37/212 (17%)
 Frame = +3

Query  69   YEPKSVLELRRSPSPVLDQKAAP-----------AGNFDVSDDPLELADNLLTNFEDWDS  215
            YEP SVL+L RSPSP   +   P                 +++ L+L D++L N + W+S
Sbjct  33   YEPTSVLDLCRSPSPE-KKPTVPKPEPQHNTNNITTITTTNNNNLDLDDHVLPNSDWWES  91

Query  216  FMKELGLQDD--------RNIKP-------------DHNLLFTPSSESQTHQFEFTHSLP  332
             MK+L L +D         NI P             DH   FT  SE       + ++  
Sbjct  92   IMKDLALPEDSPTPLSKPNNINPCIPDFPPSHDPPFDHPPDFTSLSEIYNQNLPYNYTTT  151

Query  333  EFVPSSDFNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL  512
              +   D +F     + ++   N +  +D+I+ELI+ A+CFDS+  QLAQ IL +LN +L
Sbjct  152  NAL---DHSFQDLNHHHHNPTNNVNNNWDFIEELIRAADCFDSSHFQLAQAILERLNNRL  208

Query  513  -SSAAGNPLRRAAFYFKEALQSLLTGSTRPAS  605
              S    PL RAAF+FK+AL S+L+GS R  S
Sbjct  209  IRSPMAKPLHRAAFHFKDALHSILSGSNRAGS  240



>gb|KDO59927.1| hypothetical protein CISIN_1g007284mg [Citrus sinensis]
Length=609

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 110/237 (46%), Gaps = 74/237 (31%)
 Frame = +3

Query  54   AGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELG  233
            +G+  YEP SVLELRRSPSP+                P    D  +    DW+SF+K+LG
Sbjct  71   SGSKCYEPTSVLELRRSPSPI----------------PEWDRDEHMLRTMDWESFIKDLG  114

Query  234  LQDD-------------RNIKP--------DH--------------------NLLFTPSS  290
              DD             +++ P        DH                    +++   SS
Sbjct  115  GLDDDCSSDVAAPQLQIQHLHPISTDDDSIDHQQQSDFNFNFSSNFNVPAADDVVSLSSS  174

Query  291  ESQTHQFEFTHSLPEFVPSSDFNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAV  470
             +Q H   F    P+ V ++D N       +N+    + F ++YI+ELI+ AEC DSN +
Sbjct  175  TTQYHN-NFPDHHPDAVSNNDNNMIV----VNNLGGGFEFDYNYIEELIRAAECLDSNEL  229

Query  471  QLAQVILPQLNQK--------LSSAAGNPLRRAAFYFKEALQSLLT----GSTRPAS  605
            Q+AQ+IL +LN          +  AAG PL+RAA +FKEAL SLL     G TRP S
Sbjct  230  QVAQMILARLNHSQNLVGSPPVVVAAGKPLQRAAIFFKEALSSLLLSLLNGLTRPTS  286



>ref|XP_006428037.1| hypothetical protein CICLE_v10025197mg [Citrus clementina]
 ref|XP_006493843.1| PREDICTED: scarecrow-like protein 15-like [Citrus sinensis]
 gb|ESR41277.1| hypothetical protein CICLE_v10025197mg [Citrus clementina]
Length=609

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 109/237 (46%), Gaps = 74/237 (31%)
 Frame = +3

Query  54   AGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELG  233
            +G+  YEP SVLELRRSPSP+                P    D  +    DW+SF+K+LG
Sbjct  71   SGSKCYEPTSVLELRRSPSPI----------------PEWDRDEHMLRTMDWESFIKDLG  114

Query  234  LQDD-------------RNIKP--------DH--------------------NLLFTPSS  290
              DD             +++ P        DH                    +++   SS
Sbjct  115  GLDDDCSSDVAAPQLQIQHLHPISTDDDSIDHQQQSDFNFNFSSNFNVPAADDVVSLSSS  174

Query  291  ESQTHQFEFTHSLPEFVPSSDFNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAV  470
             +Q H     ++ P+  P +  N       +N+    + F ++YI+ELI+ AEC DSN +
Sbjct  175  TTQYH-----NNFPDHHPDAVSNNGNNMIVMNNLGGGFEFDYNYIEELIRAAECLDSNEL  229

Query  471  QLAQVILPQLNQK--------LSSAAGNPLRRAAFYFKEALQSLLT----GSTRPAS  605
            Q+AQ+IL +LN          +  AAG PL+RAA +FKEAL SLL     G TRP S
Sbjct  230  QVAQMILARLNHSQNLVGSPPVVVAAGKPLQRAAIFFKEALSSLLLSLLNGLTRPTS  286



>ref|XP_010255200.1| PREDICTED: scarecrow-like protein 15 [Nelumbo nucifera]
Length=549

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 102/221 (46%), Gaps = 32/221 (14%)
 Frame = +3

Query  24   VASNENWN--SAAGNGWYEPKSVLELRRSPSPVLDQ----KAAPAGNFDVSDDPLELADN  185
             A N  +N  + +    YEP SVL+LRRS SPV          PA +   S++P    D 
Sbjct  25   TAENNTFNQPAVSSTSCYEPTSVLDLRRSSSPVAAVPDSFNPVPAFSGVSSEEPSFQWDG  84

Query  186  --LLTNFEDWDSFMKELGLQDDRNIKPDHNLL--FTPSSESQTHQFEFT----------H  323
              L  + +DWDS M    L++  N  P    L  F P      +    T          H
Sbjct  85   HVLPLSSDDWDSMM--WALEEKDNSAPLSKSLPQFGPHGPQSPNFSHLTAPDSFFGSSPH  142

Query  324  SLPEF-VPSSD--------FNFSQFQGNINS-FDENWSFGFDYIDELIQFAECFDSNAVQ  473
            S+P F  PS+         FN S     I S   E   F    +D+L Q A C +SN  Q
Sbjct  143  SVPAFNHPSAASWNHSPTYFNLSNNFHQIGSNGGEGIEFDCSQLDQLFQAAGCLESNESQ  202

Query  474  LAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTR  596
             A  IL +LNQ+L    G PL+RAAFYFKEAL SLLTGS R
Sbjct  203  SALTILARLNQRLQFPMGKPLQRAAFYFKEALLSLLTGSNR  243



>gb|ACB31517.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31518.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31519.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31520.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31521.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31522.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31523.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31524.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31525.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31526.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31527.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31528.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31529.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31530.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31531.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31532.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31533.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31534.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31535.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31536.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31537.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31538.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31539.1| SCL6-IV, partial [Arabidopsis thaliana]
Length=168

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = +3

Query  426  DELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            ++L++ AE  +S+   LAQ IL +LNQ+LSS  G PL RAAFYFKEAL +LL
Sbjct  68   EQLVKAAEVIESDTC-LAQGILARLNQQLSSPVGKPLERAAFYFKEALNNLL  118



>ref|NP_191926.1| protein LOST MERISTEMS 3 [Arabidopsis thaliana]
 sp|O81316.1|SCL6_ARATH RecName: Full=Scarecrow-like protein 6; Short=AtSCL6; AltName: 
Full=GRAS family protein 22; Short=AtGRAS-22; AltName: Full=SCL6-IV 
[Arabidopsis thaliana]
 gb|AAL58919.1|AF462831_1 AT4g00150/F6N15_20 [Arabidopsis thaliana]
 gb|AAC19296.1| contains similarity to Arabidopsis scarecrow (GB:U62798) [Arabidopsis 
thaliana]
 emb|CAB80773.1| scarecrow-like 6 (SCL6) [Arabidopsis thaliana]
 gb|AAM91367.1| At4g00150/F6N15_20 [Arabidopsis thaliana]
 gb|AEE81829.1| LOST MERISTEMS family protein [Arabidopsis thaliana]
Length=558

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = +3

Query  426  DELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            ++L++ AE  +S+   LAQ IL +LNQ+LSS  G PL RAAFYFKEAL +LL
Sbjct  207  EQLVKAAEVIESDTC-LAQGILARLNQQLSSPVGKPLERAAFYFKEALNNLL  257



>ref|XP_002872967.1| hypothetical protein ARALYDRAFT_490555 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49226.1| hypothetical protein ARALYDRAFT_490555 [Arabidopsis lyrata subsp. 
lyrata]
Length=557

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = +3

Query  426  DELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            ++L++ AE  +S+   LAQ IL +LNQ+LSS  G PL RAAFYFKEAL +LL
Sbjct  206  EQLVKAAEVIESDTC-LAQGILARLNQQLSSPVGKPLERAAFYFKEALNNLL  256



>gb|AAD24406.1|AF036303_1 scarecrow-like 6 [Arabidopsis thaliana]
Length=378

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = +3

Query  426  DELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            ++L++ AE  +S+   LAQ IL +LNQ+LSS  G PL RAAFYFKEAL +LL
Sbjct  27   EQLVKAAEVIESDTC-LAQGILARLNQQLSSPVGKPLERAAFYFKEALNNLL  77



>ref|XP_006287420.1| hypothetical protein CARUB_v10000626mg [Capsella rubella]
 gb|EOA20318.1| hypothetical protein CARUB_v10000626mg [Capsella rubella]
Length=551

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +3

Query  426  DELIQFAECFDSNA-VQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            ++L++ AE  +S     LAQ IL +LNQ+LSS  G PL RAAFYFKEAL +LL
Sbjct  196  EQLVKAAEVMESGGDTCLAQGILARLNQQLSSPVGKPLERAAFYFKEALGNLL  248



>ref|XP_009394367.1| PREDICTED: scarecrow-like protein 15 [Musa acuminata subsp. malaccensis]
Length=531

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +3

Query  405  SFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLT  584
            SF    +D LI  A C ++N    A VIL +LN  L SA  +PL RA F FKEAL +LL 
Sbjct  155  SFDRAQLDLLISAARCLEANDFATAHVILSRLNHHLPSAGASPLLRAVFLFKEALLALLR  214

Query  585  GST  593
             ST
Sbjct  215  PST  217



>ref|XP_010426616.1| PREDICTED: scarecrow-like protein 6 isoform X1 [Camelina sativa]
Length=553

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 73/151 (48%), Gaps = 23/151 (15%)
 Frame = +3

Query  150  DVSDDPLELADNLLTN--FEDWDSFMKELGLQDDRNIKPDHNLLFTPS---SESQTHQFE  314
            D +D  LEL   L T+  F D D      G+ D      DH+    PS   ++SQTH   
Sbjct  117  DSTDPSLELNSILQTSPTFHDSDYASPGFGVVDTTGFALDHH--SVPSLLINQSQTH---  171

Query  315  FTHSLPEFVPSSDFNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNA--VQLAQVI  488
            +T +     PS+ +        +N             ++L++ AE  +S      LAQ I
Sbjct  172  YTQN-----PSAIYYGHPPAKRLNPGP------MGITEQLVKAAEVIESGGGDTCLAQGI  220

Query  489  LPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            L +LNQ+LSS  G PL RAAFYFKEAL +LL
Sbjct  221  LARLNQQLSSPVGKPLERAAFYFKEALNNLL  251



>ref|XP_010456318.1| PREDICTED: scarecrow-like protein 6 [Camelina sativa]
Length=553

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +3

Query  426  DELIQFAECFDSNA--VQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            ++L++ AE  +S      LAQ IL +LNQ+LSS  G PL RAAFYFKEAL +LL
Sbjct  198  EQLVKAAEVIESGGGDTCLAQGILARLNQQLSSPVGKPLERAAFYFKEALNNLL  251



>ref|XP_010419547.1| PREDICTED: scarecrow-like protein 6 isoform X2 [Camelina sativa]
Length=553

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +3

Query  426  DELIQFAECFDSNA--VQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            ++L++ AE  +S      LAQ IL +LNQ+LSS  G PL RAAFYFKEAL +LL
Sbjct  198  EQLVKAAEVIESGGGDTCLAQGILARLNQQLSSPVGKPLERAAFYFKEALNNLL  251



>ref|XP_010426622.1| PREDICTED: scarecrow-like protein 6 isoform X2 [Camelina sativa]
Length=551

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +3

Query  426  DELIQFAECFDSNA--VQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            ++L++ AE  +S      LAQ IL +LNQ+LSS  G PL RAAFYFKEAL +LL
Sbjct  196  EQLVKAAEVIESGGGDTCLAQGILARLNQQLSSPVGKPLERAAFYFKEALNNLL  249



>gb|KFK30592.1| hypothetical protein AALP_AA6G001700 [Arabis alpina]
Length=587

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 80/166 (48%), Gaps = 23/166 (14%)
 Frame = +3

Query  150  DVSDDPLELADNLLTN----FEDWDSFMKELGLQD-----DRNIKP-----DHNLLFTPS  287
            D  D  LEL   L T+    F D D      G+ D     D ++ P      H+L     
Sbjct  126  DSQDPSLELNTILRTSSSPVFHDSDYRTLGFGVVDTGFGLDHSVPPLFEEKPHHLPPLLI  185

Query  288  SESQTHQFEFTHSLPEF--VPSSDFNFSQF-QGNINSFDENWSFGFDYIDELIQFAECFD  458
            ++SQTH   FTH+   F  +PS+     +  QG +    +    G    ++L++ AE  +
Sbjct  186  NQSQTH---FTHNPALFYNIPSTPPPAKRLNQGPMGYHPDPSKQGIT--EQLLKAAEVIE  240

Query  459  SNA-VQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGST  593
            S     +AQ IL +LNQ+LSS  G P  RAAFYFKEAL  LL  ++
Sbjct  241  SGGDTCVAQGILARLNQQLSSPIGKPFERAAFYFKEALHGLLLNAS  286



>ref|XP_010419546.1| PREDICTED: scarecrow-like protein 6 isoform X1 [Camelina sativa]
Length=554

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 3/55 (5%)
 Frame = +3

Query  426  DELIQFAECFDSNA---VQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            ++L++ AE  D +      +AQ IL +LNQ+LSS  G PL RAAFYFKEAL +LL
Sbjct  198  EQLVKAAEVIDQSGGGDTCIAQGILARLNQQLSSPVGKPLERAAFYFKEALNNLL  252



>ref|XP_008795618.1| PREDICTED: scarecrow-like protein 15 [Phoenix dactylifera]
Length=547

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 93/198 (47%), Gaps = 21/198 (11%)
 Frame = +3

Query  60   NGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLE--LADNLLTNF----------E  203
            N +YEP SVL+   + SP     AA  G  DV   P +     +LL             +
Sbjct  39   NLFYEPTSVLDPHLTSSPAAATAAAGGGGSDVPPLPWDSHHRQHLLHPPPPPPPPPPPSD  98

Query  204  DWDSFMKELGLQDDRNIKPDHNLLFTPS---SESQTHQFEFTHSLPE-FVPSSDFNFSQF  371
            DWDS    L  +D  + KP H+  F  S   S S    F+    LPE F     F    F
Sbjct  99   DWDSVAWLLSEKDGLS-KPPHHPQFHFSEGDSPSYASLFDGPFDLPEPFDALPPF----F  153

Query  372  QGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAF  551
               +  F    +F   +++ L+Q A   +S+    A  IL +LNQ L ++AG+PL+R AF
Sbjct  154  DAAVTVFSPTPAFDRTHLELLLQAAHSVESSDFATAHAILARLNQYLPASAGSPLQRVAF  213

Query  552  YFKEALQSLLTGSTRPAS  605
            +FKEAL +LL    RPA+
Sbjct  214  HFKEALLALLPLPDRPAA  231



>ref|XP_004163758.1| PREDICTED: scarecrow-like protein 6-like [Cucumis sativus]
 gb|KGN46568.1| hypothetical protein Csa_6G109640 [Cucumis sativus]
Length=754

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +3

Query  426  DELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            D+L +  E  ++    LAQ IL +LN +LSS  G P +RAAFYFKEALQ LL
Sbjct  390  DQLFKAVELIETGNSVLAQGILARLNHQLSSPIGKPFQRAAFYFKEALQLLL  441



>ref|XP_008458131.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 6 [Cucumis 
melo]
Length=754

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +3

Query  426  DELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTG-STRPA  602
            D+L +  E  ++    LAQ IL +LN +LSS  G P +RAAFYFKEALQ LL   S  P+
Sbjct  390  DQLFKAVELIETGNSVLAQGILARLNHQLSSPIGKPFQRAAFYFKEALQLLLQNPSNHPS  449

Query  603  S  605
            S
Sbjct  450  S  450



>ref|XP_004140608.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 6-like 
[Cucumis sativus]
Length=751

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +3

Query  426  DELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            D+L +  E  ++    LAQ IL +LN +LSS  G P +RAAFYFKEALQ LL
Sbjct  387  DQLFKAVELIETGNSVLAQGILARLNHQLSSPIGKPFQRAAFYFKEALQLLL  438



>ref|XP_010943177.1| PREDICTED: scarecrow-like protein 15 [Elaeis guineensis]
Length=547

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 61/200 (31%), Positives = 89/200 (45%), Gaps = 24/200 (12%)
 Frame = +3

Query  60   NGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLE------------LADNLLTNFE  203
            N +YEP SVL+   + SP         G  DV   P +            L       F+
Sbjct  39   NLFYEPTSVLDPHLTSSPA--TAVGVGGGSDVPSHPWDSHHQHQLLLPPPLPPPPPPPFD  96

Query  204  DWDSFMKELGLQDDRNI--KPDHN--LLFTPSS-ESQTHQFEFTHSLPE-FVPSSDFNFS  365
            +WD     L  +DD +   KP H+  L F+     S    F+    LP+ F P   F+  
Sbjct  97   EWDPVTWLLSEKDDLSTFPKPPHHPELHFSEGDYPSYASLFDGPSDLPDAFDPLPPFS--  154

Query  366  QFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRA  545
                 +  F     F   +++ L++ A C +S     A  IL +LNQ L ++AG+ L+R 
Sbjct  155  --DAAVTIFSPPPVFDRTHLELLLRAAHCVESRDFATAHAILARLNQYLPASAGSALQRV  212

Query  546  AFYFKEALQSLLTGSTRPAS  605
            AF+FKEAL +LL    RPA+
Sbjct  213  AFHFKEALLALLPLPNRPAT  232



>gb|KJB49198.1| hypothetical protein B456_008G106000 [Gossypium raimondii]
Length=698

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGST  593
            ID+LIQ AE  ++    LAQ IL +LN +LS   G P  RAAFYFKEALQ LL  +T
Sbjct  341  IDQLIQAAELIETGDPVLAQGILARLNHQLS-PVGKPFIRAAFYFKEALQLLLPLNT  396



>ref|XP_007052139.1| GRAS family transcription factor [Theobroma cacao]
 gb|EOX96296.1| GRAS family transcription factor [Theobroma cacao]
Length=730

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRPA  602
            ID LIQ AE  ++  + LAQ IL +LN +LS   G P  RAAFYFKEALQ LL  +T   
Sbjct  372  IDLLIQAAELIETGNLVLAQGILARLNHQLS-PVGKPFIRAAFYFKEALQLLLRLNTTNN  430

Query  603  SSSF  614
            +S+ 
Sbjct  431  TSAL  434



>ref|XP_006856053.1| hypothetical protein AMTR_s00059p00091580 [Amborella trichopoda]
 gb|ERN17520.1| hypothetical protein AMTR_s00059p00091580 [Amborella trichopoda]
Length=499

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 90/206 (44%), Gaps = 44/206 (21%)
 Frame = +3

Query  72   EPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMK-ELGLQDDR  248
            EP SVL+LR SP+P      AP         P+E  D+LL    D  S M+  +G + D 
Sbjct  25   EPTSVLDLRSSPTP------APPLWAQQQPPPMEEWDSLLL---DEPSLMRWIMGGEIDE  75

Query  249  NIKPDHNLLFTPS-SESQTHQFEFTH-----SLPEFVPSSDFNFSQF-QGNINSFDENWS  407
               P    L  P  + ++    E  +     S P   P++ F+   F   N   FD+   
Sbjct  76   TGNPSS--LSRPQFASTEPAPVEPVYPIDPFSFPSIEPTATFSSLPFVAANNPHFDQ---  130

Query  408  FGFD---------------------YIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA  524
            FGF+                     ++++L++ A+  +   V +AQ IL +LN  L  + 
Sbjct  131  FGFEREQVYSGHHHQSGGLVANDEWWLEQLVRVAQSLEGGNVAMAQAILARLNHTLPPSV  190

Query  525  GNPLRRAAFYFKEALQSLLTGSTRPA  602
            G P +RA F FKEAL  LL G   PA
Sbjct  191  GRPHQRALFQFKEALCGLL-GPHAPA  215



>gb|KJB49199.1| hypothetical protein B456_008G106100 [Gossypium raimondii]
Length=643

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            ID+LIQ AE  ++    LAQ IL +LN +LS   G P  RAAFYFKEALQ LL
Sbjct  285  IDQLIQAAELIETGDPVLAQGILARLNHQLS-PVGKPFIRAAFYFKEALQLLL  336



>ref|XP_010544366.1| PREDICTED: scarecrow-like protein 6 [Tarenaya hassleriana]
Length=628

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +3

Query  417  DYIDELIQFAECFDSNA-VQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            + I++L + AE  +S     L Q IL +LNQ+LSS  G P +RAAFYFKEAL  LL
Sbjct  272  EIIEQLFKAAELIESGGDPALLQAILARLNQQLSSPFGKPFQRAAFYFKEALHKLL  327



>ref|XP_010661679.1| PREDICTED: scarecrow-like protein 27 [Vitis vinifera]
Length=750

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 4/66 (6%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL---TGST  593
            ID+L + AE  ++    LAQ IL +LN +LS   G P +RAAFYFKEALQ LL   + +T
Sbjct  391  IDQLFKAAELVETGNTILAQGILARLNHQLS-PIGKPFQRAAFYFKEALQLLLHSNSNNT  449

Query  594  RPASSS  611
             P ++S
Sbjct  450  NPLATS  455



>ref|XP_007220242.1| hypothetical protein PRUPE_ppa001781mg [Prunus persica]
 gb|EMJ21441.1| hypothetical protein PRUPE_ppa001781mg [Prunus persica]
Length=765

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRPA  602
            ID+L   AE  ++    LAQ IL +LN +LS   G P +RAAFYFKEALQ LL  +T   
Sbjct  406  IDQLFNAAELIETGNPALAQGILARLNHQLS-PVGKPFQRAAFYFKEALQLLLHINTSSN  464

Query  603  SS  608
            SS
Sbjct  465  SS  466



>ref|XP_010934970.1| PREDICTED: scarecrow-like protein 27 [Elaeis guineensis]
Length=781

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRP  599
            I++L + AE  ++     A+ IL +LNQ+L S  G PL R+AFYFKEAL  LLT  T P
Sbjct  417  IEQLFKVAELVEAGNTVSARGILARLNQQLPSPVGKPLLRSAFYFKEALH-LLTSPTVP  474



>ref|XP_002511661.1| hypothetical protein RCOM_1610560 [Ricinus communis]
 gb|EEF50330.1| hypothetical protein RCOM_1610560 [Ricinus communis]
Length=733

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  420  YIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
             I+ + Q AE  ++    LAQ IL +LN +LS + G P  RAAFYFKEALQ LL
Sbjct  374  IINPICQAAELIETGNPALAQGILARLNHQLSLSIGKPHTRAAFYFKEALQLLL  427



>ref|XP_008232583.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 6 [Prunus 
mume]
Length=769

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRPA  602
            ID+L   AE  ++    LAQ IL +LN +LS   G P +RAAFYFKEALQ LL  +T   
Sbjct  410  IDQLFNAAELIETGNPALAQGILARLNHQLS-PIGKPFQRAAFYFKEALQLLLHINTSSN  468

Query  603  SS  608
            SS
Sbjct  469  SS  470



>ref|XP_008341645.1| PREDICTED: scarecrow-like protein 22 [Malus domestica]
Length=748

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRPA  602
            ID+L   AE  ++    LAQ IL +LN +LS   G P  RAAFYFKEALQ LL  +T   
Sbjct  389  IDQLFNAAELIETGNSVLAQGILARLNHQLS-PIGKPFSRAAFYFKEALQLLLHTNTSSN  447

Query  603  SSS  611
             SS
Sbjct  448  CSS  450



>ref|XP_006855813.1| hypothetical protein AMTR_s00044p00228020 [Amborella trichopoda]
 gb|ERN17280.1| hypothetical protein AMTR_s00044p00228020 [Amborella trichopoda]
Length=766

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRP  599
            +D+L++ AE  ++     A+ IL +LN +LS   GNPL RAAFYFK+AL SLL     P
Sbjct  398  VDQLLKAAELVEAGNAGPARAILARLNHQLS-PLGNPLHRAAFYFKQALLSLLCNPQPP  455



>gb|KDP28794.1| hypothetical protein JCGZ_14565 [Jatropha curcas]
Length=658

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            ++ + Q AE  ++    LAQ IL +LN KLS + G P  RAAFYFKEALQ LL
Sbjct  303  LNPICQAAELIETGNPVLAQGILARLNHKLSLSIGKPHIRAAFYFKEALQLLL  355



>ref|XP_008796953.1| PREDICTED: scarecrow-like protein 6 [Phoenix dactylifera]
Length=655

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRP  599
            +++L++ AE  ++     A+ IL +LNQ+L S  G PL R+AFYFKEAL  LLT    P
Sbjct  291  VEQLLKVAELVEAGNTVSARGILARLNQQLPSPVGKPLLRSAFYFKEALH-LLTSPAAP  348



>ref|XP_010110817.1| hypothetical protein L484_011800 [Morus notabilis]
 gb|EXC28296.1| hypothetical protein L484_011800 [Morus notabilis]
Length=772

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSL  578
            +D++ + AE   +     AQ IL +LN  LSS  G PL RAAFYFKEALQ L
Sbjct  395  LDQVYKAAELIGTGNFSHAQGILARLNHHLSSPFGKPLHRAAFYFKEALQLL  446



>ref|XP_009395624.1| PREDICTED: scarecrow-like protein 15 [Musa acuminata subsp. malaccensis]
Length=522

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 88/194 (45%), Gaps = 28/194 (14%)
 Frame = +3

Query  33   NENWNSA--AGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDP--LELADNLLTNF  200
            N N NS   A N +YEP SVL+ R +   V    AAPAG   V + P       N   +F
Sbjct  32   NLNTNSILFAPNLFYEPTSVLDPRLTSRFVTAPSAAPAG---VCEPPRLFRGGGNSHQHF  88

Query  201  EDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDFNFSQF-QG  377
               D +     L  +    PD    F+P  +     F  +H         D  F  F  G
Sbjct  89   PSSDQWYTASWLLPE---TPD----FSPLPDDVNPSFLNSH--------FDIPFDSFAAG  133

Query  378  NINSFDENWSFGFDY--IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAF  551
            ++ S   + S GFD   ++ LI+ A   +SN    A+VIL +LNQ + S   +PL+RA  
Sbjct  134  DLVS---SPSPGFDRSQLESLIRAAYYLESNDFDAARVILSRLNQHIPSTVVSPLQRAVS  190

Query  552  YFKEALQSLLTGST  593
             FKEAL  LL  ST
Sbjct  191  LFKEALLGLLCPST  204



>ref|XP_010258971.1| PREDICTED: scarecrow-like protein 6 [Nelumbo nucifera]
Length=810

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRPA  602
            +D+L + AE  ++     A+ IL +LN +LS   G PL+RAAFYFKEALQ LL  S   A
Sbjct  447  VDQLFKAAELVEAGNSVHARGILARLNHQLS-PVGKPLQRAAFYFKEALQLLLLTSNNTA  505

Query  603  SS  608
            +S
Sbjct  506  TS  507



>ref|XP_009382417.1| PREDICTED: scarecrow-like protein 27 [Musa acuminata subsp. malaccensis]
Length=790

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRPA  602
            ++ L + AE  ++     A  IL +LN +L S  G PL R+AFYFKEALQ +L+    P 
Sbjct  417  VNLLFEAAEMVEARNFSGAHAILARLNHQLPSPLGKPLIRSAFYFKEALQLILSNGPNPV  476

Query  603  SSS  611
             SS
Sbjct  477  RSS  479



>ref|XP_003538071.1| PREDICTED: scarecrow-like protein 6-like [Glycine max]
 gb|KHN41697.1| Scarecrow-like protein 6 [Glycine soja]
Length=742

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = +3

Query  426  DELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRPAS  605
            ++L + AE  D+  ++LA  IL +LN +LS   G P +RAAFYFKEALQ LL  +   +S
Sbjct  387  EQLFKAAELIDAGNLELAHGILARLNHQLS-PIGKPFQRAAFYFKEALQLLLHSNANNSS  445

Query  606  SSF  614
             +F
Sbjct  446  FTF  448



>ref|XP_004306953.1| PREDICTED: scarecrow-like protein 6 [Fragaria vesca subsp. vesca]
Length=737

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 2/94 (2%)
 Frame = +3

Query  330  PEFVPSSDFNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQK  509
            P  + + D   +  +G+      N  F    ID+L+  AE  ++    LAQ IL +LN +
Sbjct  348  PVMLATKDKMVNNLEGD-KELMNNHQFHQAIIDQLVNAAELIETGNPLLAQGILARLNHQ  406

Query  510  LSSAAGNPLRRAAFYFKEALQSLLTGSTRPASSS  611
            LS   G P +RAA YFKEAL+ LL  S   A+ S
Sbjct  407  LS-PIGKPFQRAALYFKEALELLLNNSHSSANLS  439



>gb|KJB51923.1| hypothetical protein B456_008G238300 [Gossypium raimondii]
Length=773

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +3

Query  426  DELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            D+L + AE   +     AQ+IL +LNQ++S   G PL+RAAFYFKEALQ LL
Sbjct  412  DQLYKAAELVGTGNFSHAQLILARLNQQVS-PVGMPLQRAAFYFKEALQVLL  462



>ref|XP_009374164.1| PREDICTED: scarecrow-like protein 27 [Pyrus x bretschneideri]
Length=748

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 34/53 (64%), Gaps = 1/53 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            ID+L   AE  ++    LAQ IL +LN +LS   G P  RAAFYFKEALQ LL
Sbjct  389  IDQLFNAAELIETGNPVLAQGILARLNHQLS-PIGKPFSRAAFYFKEALQLLL  440



>gb|AJC52498.1| SCL12, partial [Pinus radiata]
Length=614

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGST  593
            +++L++ AE  +   +  AQ IL +LNQ LS   G PL+RAAFYFKEAL S +  +T
Sbjct  238  VEQLLKAAEAVELGNLDHAQAILARLNQHLSPL-GKPLQRAAFYFKEALASRILNTT  293



>ref|XP_009342426.1| PREDICTED: scarecrow-like protein 6 [Pyrus x bretschneideri]
Length=748

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 37/63 (59%), Gaps = 1/63 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRPA  602
            ID+L   AE  ++    LAQ IL +LN +LS   G P  R AFYFKEALQ LL  +T   
Sbjct  389  IDQLFNAAELIETGNSVLAQGILARLNHQLS-PIGKPFSRTAFYFKEALQFLLNTNTSSN  447

Query  603  SSS  611
             SS
Sbjct  448  CSS  450



>ref|XP_008371269.1| PREDICTED: scarecrow-like protein 6 [Malus domestica]
Length=750

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 34/53 (64%), Gaps = 1/53 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            ID+L   AE  ++    LAQ IL +LN +LS   G P  RAAFYFKEALQ LL
Sbjct  391  IDQLFNAAELIETGNPVLAQGILARLNHQLS-PIGKPFSRAAFYFKEALQLLL  442



>ref|XP_008448862.1| PREDICTED: scarecrow-like protein 6 [Cucumis melo]
Length=777

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            +D+L + AE   +     AQ IL +LN +LS   G PL+RAAFYFKEALQ LL
Sbjct  415  LDQLYKAAELVGTGNFSYAQGILARLNHQLS-PVGKPLQRAAFYFKEALQLLL  466



>ref|XP_006573232.1| PREDICTED: scarecrow-like protein 27-like [Glycine max]
 gb|KHN31643.1| Scarecrow-like protein 6 [Glycine soja]
Length=744

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +3

Query  426  DELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            ++L + AE  D+  ++LA  IL +LN +LS   G P +RAAFYFKEALQ LL
Sbjct  389  EQLFKAAELIDAGNLELAHGILARLNHQLS-PIGKPFQRAAFYFKEALQLLL  439



>ref|XP_009349895.1| PREDICTED: scarecrow-like protein 6, partial [Pyrus x bretschneideri]
Length=679

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 37/63 (59%), Gaps = 1/63 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRPA  602
            ID+L   AE  ++    LAQ IL +LN +LS   G P  R AFYFKEALQ LL  +T   
Sbjct  320  IDQLFNAAELIETGNSVLAQGILARLNHQLS-PIGKPFSRTAFYFKEALQFLLNTNTSSN  378

Query  603  SSS  611
             SS
Sbjct  379  CSS  381



>ref|XP_009375779.1| PREDICTED: scarecrow-like protein 22 [Pyrus x bretschneideri]
Length=702

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 37/63 (59%), Gaps = 1/63 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRPA  602
            ID+L   AE  ++    LAQ IL +LN +LS   G P  R AFYFKEALQ LL  +T   
Sbjct  343  IDQLFNAAELIETGNSVLAQGILARLNHQLS-PIGKPFSRTAFYFKEALQFLLNTNTSSN  401

Query  603  SSS  611
             SS
Sbjct  402  CSS  404



>ref|XP_007210362.1| hypothetical protein PRUPE_ppa001561mg [Prunus persica]
 gb|EMJ11561.1| hypothetical protein PRUPE_ppa001561mg [Prunus persica]
Length=802

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            +D+L + AE   +     AQ IL +LN +LS   G PL+RAAFYFKEALQ LL
Sbjct  438  LDQLYKAAELVGTGNFSHAQGILARLNHQLS-PVGKPLQRAAFYFKEALQLLL  489



>gb|AFR66646.1| scarecrow-like 6 [Larix kaempferi]
Length=639

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGST  593
            +++L++ AE  +   +  AQ IL +LNQ LS   G PL RAAFYFKEAL S +  +T
Sbjct  268  VEQLLKAAEAVELGNLDHAQAILARLNQHLSPL-GKPLHRAAFYFKEALASRILNAT  323



>ref|XP_008238556.1| PREDICTED: scarecrow-like protein 27 [Prunus mume]
Length=813

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            +D+L + AE   +     AQ IL +LN +LS   G PL+RAAFYFKEALQ LL
Sbjct  449  LDQLYKAAELVGTGNFSHAQGILARLNHQLS-PVGKPLQRAAFYFKEALQLLL  500



>ref|XP_004147202.1| PREDICTED: scarecrow-like protein 27-like [Cucumis sativus]
Length=774

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            +D+L + AE   +     AQ IL +LN +LS   G PL+RAAFYFKEALQ LL
Sbjct  412  LDQLYKAAELVGTGNFSHAQGILARLNHQLS-PVGKPLQRAAFYFKEALQLLL  463



>ref|XP_010662422.1| PREDICTED: scarecrow-like protein 22 isoform X1 [Vitis vinifera]
Length=764

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGSTRPA  602
            +D+L + AE   +    +AQ IL +LN +LS   G P +RAAFYFKEALQ +L  +  PA
Sbjct  449  LDQLCKAAELVGTGNFSIAQGILARLNHQLS-PEGKPFQRAAFYFKEALQLILM-NNNPA  506

Query  603  SS  608
            +S
Sbjct  507  AS  508



>gb|KGN55872.1| hypothetical protein Csa_3G020600 [Cucumis sativus]
Length=770

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            +D+L + AE   +     AQ IL +LN +LS   G PL+RAAFYFKEALQ LL
Sbjct  408  LDQLYKAAELVGTGNFSHAQGILARLNHQLS-PVGKPLQRAAFYFKEALQLLL  459



>ref|XP_004169643.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 27-like 
[Cucumis sativus]
Length=774

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL  581
            +D+L + AE   +     AQ IL +LN +LS   G PL+RAAFYFKEALQ LL
Sbjct  412  LDQLYKAAELVGTGNFSHAQGILARLNHQLS-PVGKPLQRAAFYFKEALQLLL  463



>ref|XP_011033505.1| PREDICTED: scarecrow-like protein 22 isoform X2 [Populus euphratica]
Length=695

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGST  593
            I  + Q AE  ++    LAQ IL +LN +LS   G P +R AFYFK+ALQ LL  S+
Sbjct  338  IGPICQAAELIENRNPVLAQGILARLNHQLSLPIGKPYQRTAFYFKDALQLLLHSSS  394



>ref|XP_011033489.1| PREDICTED: scarecrow-like protein 22 isoform X1 [Populus euphratica]
 ref|XP_011033496.1| PREDICTED: scarecrow-like protein 22 isoform X1 [Populus euphratica]
Length=701

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLLTGST  593
            I  + Q AE  ++    LAQ IL +LN +LS   G P +R AFYFK+ALQ LL  S+
Sbjct  344  IGPICQAAELIENRNPVLAQGILARLNHQLSLPIGKPYQRTAFYFKDALQLLLHSSS  400



>ref|XP_010056372.1| PREDICTED: scarecrow-like protein 22 [Eucalyptus grandis]
 gb|KCW73063.1| hypothetical protein EUGRSUZ_E01509 [Eucalyptus grandis]
Length=729

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = +3

Query  423  IDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFYFKEALQSLL-TGSTRP  599
            +D+L +  E  ++   +LAQ IL +LN +L S  G P  RAAFY KEALQ LL T ST P
Sbjct  372  VDQLYKAVELIEAGNPELAQGILARLNHQL-SPIGKPFIRAAFYVKEALQLLLQTNSTNP  430



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520