BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS050H01

Length=512
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABO87603.1|  chloroplast ATP/ADP translocator                        230   5e-72   Pisum sativum [garden pea]
ref|XP_004506888.1|  PREDICTED: plastidic ATP/ADP-transporter-like      231   6e-69   Cicer arietinum [garbanzo]
gb|AFD54199.1|  gibberellin 3-beta-dioxygenase 4                        223   1e-68   Vitis vinifera
gb|ABG37645.1|  plastid ATP/ADP-transporter                             233   2e-68   Populus trichocarpa [western balsam poplar]
gb|KEH28732.1|  plastidic ATP/ADP-transporter-like protein              230   2e-68   Medicago truncatula
gb|KHG23248.1|  ADP,ATP carrier 1, chloroplastic -like protein          229   4e-68   Gossypium arboreum [tree cotton]
ref|XP_003543665.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    229   4e-68   Glycine max [soybeans]
gb|KHN44149.1|  ADP,ATP carrier protein 1, chloroplastic                229   5e-68   Glycine soja [wild soybean]
gb|KJB70559.1|  hypothetical protein B456_011G079600                    228   1e-67   Gossypium raimondii
ref|XP_004252326.1|  PREDICTED: plastidic ATP/ADP-transporter           228   1e-67   Solanum lycopersicum
ref|XP_011035631.1|  PREDICTED: plastidic ATP/ADP-transporter-like      228   2e-67   Populus euphratica
ref|XP_010099654.1|  Plastidic                                          227   2e-67   Morus notabilis
ref|XP_007135724.1|  hypothetical protein PHAVU_010G152900g             227   2e-67   Phaseolus vulgaris [French bean]
ref|XP_004487222.1|  PREDICTED: plastidic ATP/ADP-transporter-like      227   2e-67   Cicer arietinum [garbanzo]
ref|XP_004235723.1|  PREDICTED: plastidic ATP/ADP-transporter-like      227   3e-67   Solanum lycopersicum
ref|XP_002298119.2|  Chloroplast ADP family protein                     227   3e-67   
ref|XP_010033911.1|  PREDICTED: plastidic ATP/ADP-transporter-like      227   3e-67   Eucalyptus grandis [rose gum]
ref|NP_001274794.1|  plastidic ATP/ADP-transporter                      227   3e-67   Solanum tuberosum [potatoes]
ref|XP_007150697.1|  hypothetical protein PHAVU_005G174000g             226   3e-67   Phaseolus vulgaris [French bean]
gb|ACF80277.1|  unknown                                                 219   4e-67   Zea mays [maize]
ref|XP_011039999.1|  PREDICTED: plastidic ATP/ADP-transporter-like      226   4e-67   Populus euphratica
gb|KHG15786.1|  ADP,ATP carrier 1, chloroplastic -like protein          226   5e-67   Gossypium arboreum [tree cotton]
gb|KJB56643.1|  hypothetical protein B456_009G129100                    226   5e-67   Gossypium raimondii
dbj|BAD95278.1|  adenine nucleotide translocase                         214   5e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009767462.1|  PREDICTED: plastidic ATP/ADP-transporter           226   6e-67   Nicotiana sylvestris
ref|XP_002303268.1|  Chloroplast ADP family protein                     226   6e-67   Populus trichocarpa [western balsam poplar]
gb|KJB13103.1|  hypothetical protein B456_002G057300                    226   7e-67   Gossypium raimondii
gb|KJB13104.1|  hypothetical protein B456_002G057300                    226   8e-67   Gossypium raimondii
ref|XP_007023975.1|  TLC ATP/ADP transporter isoform 3                  223   9e-67   
ref|XP_009595520.1|  PREDICTED: plastidic ATP/ADP-transporter           225   2e-66   Nicotiana tomentosiformis
gb|AAM29152.1|  plastidic ATP/ADP transporter                           224   2e-66   Citrus hybrid cultivar
gb|KDP37155.1|  hypothetical protein JCGZ_06211                         224   3e-66   Jatropha curcas
ref|XP_006427151.1|  hypothetical protein CICLE_v10025170mg             224   4e-66   Citrus clementina [clementine]
ref|XP_006465406.1|  PREDICTED: LOW QUALITY PROTEIN: plastidic AT...    223   4e-66   
gb|EYU24674.1|  hypothetical protein MIMGU_mgv1a002918mg                224   5e-66   Erythranthe guttata [common monkey flower]
gb|KHN47790.1|  ADP,ATP carrier protein 1, chloroplastic                224   5e-66   Glycine soja [wild soybean]
gb|KHN01355.1|  ADP,ATP carrier protein 1, chloroplastic                224   5e-66   Glycine soja [wild soybean]
ref|XP_006583133.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    224   5e-66   Glycine max [soybeans]
ref|XP_006585647.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    223   6e-66   Glycine max [soybeans]
ref|XP_010061949.1|  PREDICTED: plastidic ATP/ADP-transporter-like      223   6e-66   Eucalyptus grandis [rose gum]
ref|XP_011081074.1|  PREDICTED: plastidic ATP/ADP-transporter           223   7e-66   Sesamum indicum [beniseed]
emb|CBI36236.3|  unnamed protein product                                222   7e-66   Vitis vinifera
ref|XP_006341665.1|  PREDICTED: plastidic ATP/ADP-transporter-like      223   8e-66   Solanum tuberosum [potatoes]
ref|XP_007023973.1|  TLC ATP/ADP transporter isoform 1                  223   1e-65   
gb|KJB68136.1|  hypothetical protein B456_010G227600                    222   1e-65   Gossypium raimondii
ref|XP_004302940.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    222   1e-65   Fragaria vesca subsp. vesca
gb|AAT73075.1|  plastidic ATP/ADP transporter                           218   2e-65   Helianthus tuberosus [Jerusalem artichoke]
gb|KHG10295.1|  ADP,ATP carrier 1, chloroplastic -like protein          222   2e-65   Gossypium arboreum [tree cotton]
ref|XP_009343421.1|  PREDICTED: plastidic ATP/ADP-transporter-like      222   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_011072264.1|  PREDICTED: plastidic ATP/ADP-transporter-like      222   2e-65   Sesamum indicum [beniseed]
gb|AAS82778.1|  plastidic ATP/ADP-transporter                           218   2e-65   Helianthus tuberosus [Jerusalem artichoke]
dbj|BAD91180.1|  putative plastidic adenylate transporter               222   2e-65   Mesembryanthemum crystallinum
ref|XP_002285232.1|  PREDICTED: plastidic ATP/ADP-transporter           222   2e-65   Vitis vinifera
gb|EYU21596.1|  hypothetical protein MIMGU_mgv1a002865mg                222   3e-65   Erythranthe guttata [common monkey flower]
emb|CAN83628.1|  hypothetical protein VITISV_019239                     221   3e-65   Vitis vinifera
ref|XP_006829678.1|  hypothetical protein AMTR_s00122p00140700          222   3e-65   Amborella trichopoda
ref|XP_009758418.1|  PREDICTED: plastidic ATP/ADP-transporter-like      222   3e-65   Nicotiana sylvestris
ref|XP_004147999.1|  PREDICTED: plastidic ATP/ADP-transporter-like      221   3e-65   Cucumis sativus [cucumbers]
ref|XP_008447482.1|  PREDICTED: plastidic ATP/ADP-transporter-like      221   4e-65   Cucumis melo [Oriental melon]
ref|XP_010254276.1|  PREDICTED: plastidic ATP/ADP-transporter-like      221   4e-65   Nelumbo nucifera [Indian lotus]
gb|AAT99359.1|  chloroplast ATP/ADP transporter protein                 218   5e-65   Helianthus tuberosus [Jerusalem artichoke]
gb|EPS64663.1|  hypothetical protein M569_10117                         221   5e-65   Genlisea aurea
gb|AAZ23107.1|  plastid ATP/ADP transport protein 2                     221   6e-65   Manihot esculenta [manioc]
ref|XP_008377604.1|  PREDICTED: plastidic ATP/ADP-transporter-like      221   7e-65   Malus domestica [apple tree]
ref|XP_010691228.1|  PREDICTED: plastidic ATP/ADP-transporter           220   9e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008672827.1|  PREDICTED: plastidic ATP/ADP-transporter iso...    221   1e-64   
ref|XP_009624271.1|  PREDICTED: plastidic ATP/ADP-transporter-like      220   1e-64   Nicotiana tomentosiformis
tpg|DAA58346.1|  TPA: plastidic ATP/ADP-transporter                     220   1e-64   
ref|XP_002458233.1|  hypothetical protein SORBIDRAFT_03g029490          220   1e-64   Sorghum bicolor [broomcorn]
ref|XP_002517555.1|  Plastidic ATP/ADP-transporter, putative            220   1e-64   Ricinus communis
gb|AFW83424.1|  hypothetical protein ZEAMMB73_806603                    220   1e-64   
ref|XP_006648444.1|  PREDICTED: plastidic ATP/ADP-transporter-like      218   2e-64   
gb|AAZ23106.1|  plastid ATP/ADP transport protein 1                     219   2e-64   Manihot esculenta [manioc]
ref|XP_010925271.1|  PREDICTED: plastidic ATP/ADP-transporter-like      220   2e-64   Elaeis guineensis
gb|EEE56534.1|  hypothetical protein OsJ_05838                          218   3e-64   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001147851.1|  plastidic ATP/ADP-transporter                      219   3e-64   Zea mays [maize]
ref|NP_001043710.1|  Os01g0647100                                       219   3e-64   
ref|NP_001140537.1|  uncharacterized protein LOC100272602               218   4e-64   Zea mays [maize]
ref|XP_008785487.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    219   4e-64   Phoenix dactylifera
gb|KFK42425.1|  hypothetical protein AALP_AA2G254500                    218   5e-64   Arabis alpina [alpine rockcress]
gb|EAZ12893.1|  hypothetical protein OsJ_02814                          218   5e-64   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84955.1|  hypothetical protein OsI_06319                          218   6e-64   Oryza sativa Indica Group [Indian rice]
dbj|BAD24996.1|  putative plastidic ATP/ADP transporter                 218   6e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008681386.1|  PREDICTED: uncharacterized protein LOC100272...    218   6e-64   Zea mays [maize]
gb|AAZ23108.1|  plastid ATP/ADP transport protein 2                     218   9e-64   Manihot esculenta [manioc]
ref|XP_004969309.1|  PREDICTED: plastidic ATP/ADP-transporter-like      218   1e-63   Setaria italica
ref|XP_006646147.1|  PREDICTED: plastidic ATP/ADP-transporter-like      216   1e-63   
ref|XP_010532151.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    218   1e-63   Tarenaya hassleriana [spider flower]
ref|XP_010537959.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    217   1e-63   Tarenaya hassleriana [spider flower]
gb|ADE75734.1|  unknown                                                 213   1e-63   Picea sitchensis
ref|XP_004951502.1|  PREDICTED: plastidic ATP/ADP-transporter-like      217   2e-63   Setaria italica
ref|XP_010429984.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    213   2e-63   Camelina sativa [gold-of-pleasure]
dbj|BAJ89983.1|  predicted protein                                      216   3e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010249956.1|  PREDICTED: plastidic ATP/ADP-transporter           216   3e-63   Nelumbo nucifera [Indian lotus]
ref|XP_009381260.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    217   4e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002451752.1|  hypothetical protein SORBIDRAFT_04g007240          217   4e-63   
gb|KHG16971.1|  ADP,ATP carrier 1, chloroplastic -like protein          216   5e-63   Gossypium arboreum [tree cotton]
emb|CDO98099.1|  unnamed protein product                                216   5e-63   Coffea canephora [robusta coffee]
gb|AAX63195.1|  putative plastidic ATP/ADP transporter                  216   8e-63   Oryza sativa Japonica Group [Japonica rice]
gb|EMS68334.1|  ADP,ATP carrier protein 1, chloroplastic                214   8e-63   Triticum urartu
ref|XP_009407647.1|  PREDICTED: plastidic ATP/ADP-transporter-like      215   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT25116.1|  ADP,ATP carrier protein 1, chloroplastic                216   1e-62   
ref|XP_009388534.1|  PREDICTED: plastidic ATP/ADP-transporter-like      215   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAH20416.1|  AT1G15500                                              211   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459088.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    211   2e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010914961.1|  PREDICTED: plastidic ATP/ADP-transporter-like      215   2e-62   Elaeis guineensis
gb|AAX58120.1|  plastid ATP/ADP transporter                             214   2e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008809354.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    215   2e-62   Phoenix dactylifera
ref|XP_010429982.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    214   2e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010417726.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    214   2e-62   Camelina sativa [gold-of-pleasure]
gb|EMS56290.1|  Plastidic ATP/ADP-transporter                           211   2e-62   Triticum urartu
ref|NP_178146.1|  ADP,ATP carrier protein 1                             214   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472951.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    214   2e-62   Camelina sativa [gold-of-pleasure]
emb|CDY39988.1|  BnaC06g40660D                                          214   2e-62   Brassica napus [oilseed rape]
ref|XP_009106762.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    214   2e-62   Brassica rapa
gb|AAK76577.1|  putative adenine nucleotide translocase                 214   2e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CDX87299.1|  BnaA07g35740D                                          214   3e-62   
ref|XP_009104454.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    213   3e-62   Brassica rapa
emb|CDY57697.1|  BnaA07g38360D                                          213   3e-62   Brassica napus [oilseed rape]
ref|XP_002889299.1|  chloroplast ADP, ATP carrier protein 1             214   3e-62   
emb|CDX79394.1|  BnaC06g19090D                                          213   3e-62   
emb|CAA89201.2|  adenine nucleotide translocase                         213   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006389778.1|  hypothetical protein EUTSA_v10018281mg             213   4e-62   Eutrema salsugineum [saltwater cress]
ref|XP_003571578.1|  PREDICTED: plastidic ATP/ADP-transporter-like      213   6e-62   Brachypodium distachyon [annual false brome]
ref|XP_006300855.1|  hypothetical protein CARUB_v10019948mg             213   7e-62   
ref|XP_008792130.1|  PREDICTED: plastidic ATP/ADP-transporter-like      213   8e-62   Phoenix dactylifera
ref|XP_006307012.1|  hypothetical protein CARUB_v10008598mg             212   1e-61   Capsella rubella
gb|EMT31396.1|  Plastidic ATP/ADP-transporter                           212   1e-61   
ref|XP_010476640.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    211   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_002890107.1|  hypothetical protein ARALYDRAFT_471751             211   2e-61   
ref|XP_010497204.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    211   2e-61   Camelina sativa [gold-of-pleasure]
ref|NP_173003.1|  ADP,ATP carrier protein 2                             211   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003569451.1|  PREDICTED: plastidic ATP/ADP-transporter-like      211   5e-61   Brachypodium distachyon [annual false brome]
emb|CDY36568.1|  BnaA06g10210D                                          209   8e-61   Brassica napus [oilseed rape]
ref|XP_009148947.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    209   8e-61   Brassica rapa
ref|XP_010925128.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    211   9e-61   
ref|XP_006416899.1|  hypothetical protein EUTSA_v10007090mg             209   1e-60   Eutrema salsugineum [saltwater cress]
emb|CDY39658.1|  BnaC05g11870D                                          209   1e-60   Brassica napus [oilseed rape]
ref|XP_008657814.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    209   1e-60   
emb|CDX83974.1|  BnaC08g16710D                                          209   2e-60   
emb|CDX96838.1|  BnaA08g23810D                                          208   3e-60   
ref|XP_009110479.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    208   3e-60   Brassica rapa
ref|XP_010279263.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    209   3e-60   Nelumbo nucifera [Indian lotus]
gb|ADE77264.1|  unknown                                                 199   1e-59   Picea sitchensis
gb|KHN22476.1|  ADP,ATP carrier protein 1, chloroplastic                206   1e-59   Glycine soja [wild soybean]
ref|XP_003546196.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    206   1e-59   Glycine max [soybeans]
ref|XP_002990822.1|  hypothetical protein SELMODRAFT_21240              201   1e-58   
gb|AAL10405.1|AF416339_1  ADP/ATP translocase                           187   9e-58   Medicago sativa [alfalfa]
ref|XP_002974477.1|  hypothetical protein SELMODRAFT_101296             201   2e-57   
ref|XP_006838934.1|  hypothetical protein AMTR_s00002p00270350          201   2e-57   Amborella trichopoda
ref|XP_008228630.1|  PREDICTED: plastidic ATP/ADP-transporter-like      200   3e-57   Prunus mume [ume]
ref|XP_007217627.1|  hypothetical protein PRUPE_ppa002937mg             200   3e-57   Prunus persica
gb|AEZ00863.1|  putative ATP-ADP-transporter protein                    184   3e-55   Elaeis guineensis
gb|KDO58239.1|  hypothetical protein CISIN_1g012495mg                   191   4e-55   Citrus sinensis [apfelsine]
ref|XP_011401420.1|  ADP,ATP carrier protein 1, chloroplastic           187   2e-52   Auxenochlorella protothecoides
gb|KDD74050.1|  TLC ATP/ADP transporter                                 182   1e-51   Helicosporidium sp. ATCC 50920
ref|XP_001773938.1|  predicted protein                                  181   2e-50   
ref|XP_001780035.1|  predicted protein                                  181   2e-50   
ref|XP_002947450.1|  hypothetical protein VOLCADRAFT_79605              180   6e-50   Volvox carteri f. nagariensis
ref|XP_005844203.1|  hypothetical protein CHLNCDRAFT_56336              178   3e-49   Chlorella variabilis
ref|XP_005643478.1|  ADP/ATP carrier protein                            177   4e-49   Coccomyxa subellipsoidea C-169
ref|XP_001703733.1|  plastidic ADP/ATP translocase                      176   1e-48   Chlamydomonas reinhardtii
ref|XP_005769878.1|  hypothetical protein EMIHUDRAFT_451418             158   3e-42   Emiliania huxleyi CCMP1516
gb|ABV25594.1|  plastid ATP/ADP translocase                             155   1e-41   Pavlova lutheri
gb|ABV25597.1|  plastid ATP/ADP translocase                             156   1e-41   Euglena gracilis
gb|EWM29257.1|  plastidic atp adp transporter                           157   1e-41   Nannochloropsis gaditana
ref|XP_005763298.1|  hypothetical protein EMIHUDRAFT_465146             157   6e-41   Emiliania huxleyi CCMP1516
gb|EJK46221.1|  hypothetical protein THAOC_35120                        154   1e-40   Thalassiosira oceanica
emb|CAC80882.1|  plastidic ATP/ADP transporter                          154   2e-40   Galdieria sulphuraria
ref|XP_005707402.1|  ATP:ADP antiporter, AAA family                     154   2e-40   Galdieria sulphuraria
gb|ABV25604.1|  plastid ATP/ADP translocase                             153   3e-40   Prymnesium parvum
ref|XP_009037704.1|  hypothetical protein AURANDRAFT_27252              152   6e-40   Aureococcus anophagefferens
ref|XP_005781451.1|  hypothetical protein EMIHUDRAFT_365981             142   7e-40   Emiliania huxleyi CCMP1516
gb|AES68077.2|  plastidic ATP/ADP-transporter-like protein              151   1e-39   Medicago truncatula
ref|XP_003597826.1|  ATP/ADP transporter                                151   2e-39   
ref|XP_002184271.1|  nucleotide transporter 1                           151   2e-39   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_005536231.1|  chloroplast ADP,ATP carrier protein                151   2e-39   Cyanidioschyzon merolae strain 10D
emb|CAX16540.1|  putative ATP/ADP translocase                           149   3e-39   Trieres chinensis
emb|CBJ27353.1|  plastidic ATP/ADP transporter                          150   4e-39   Ectocarpus siliculosus
ref|XP_002292665.1|  predicted protein                                  147   3e-38   Thalassiosira pseudonana CCMP1335
ref|WP_013942850.1|  ATPase AAA                                         146   4e-38   Simkania negevensis
gb|ABH10983.1|  plastid ATP/ADP transporter                             145   2e-37   Polytomella parva
ref|WP_042102387.1|  ATPase AAA                                         144   3e-37   Parachlamydiaceae bacterium HS-T3
ref|WP_039356341.1|  ATPase AAA                                         143   7e-37   Candidatus Protochlamydia amoebophila
gb|KIC73885.1|  ADP,ATP carrier protein 1                               143   8e-37   Candidatus Protochlamydia amoebophila
emb|CAE46506.1|  nucleotide transport protein                           142   1e-36   Candidatus Protochlamydia amoebophila UWE25
ref|WP_042280868.1|  ATPase AAA                                         142   2e-36   Candidatus Protochlamydia sp. R18
ref|WP_011174800.1|  ATPase AAA                                         142   2e-36   Candidatus Protochlamydia amoebophila
ref|WP_032124907.1|  ATPase AAA                                         139   1e-35   Candidatus Protochlamydia massiliensis
ref|XP_001693815.1|  plastidic ADP/ATP translocase                      138   9e-35   Chlamydomonas reinhardtii
gb|ABV25596.1|  plastid ATP/ADP translocase                             137   1e-34   Pyropia yezoensis
ref|XP_010419393.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    129   2e-34   
emb|CCB90293.1|  ADP,ATP carrier protein 1                              133   2e-34   Waddlia chondrophila 2032/99
emb|CBJ30232.1|  plastidic ATP/ADP transporter                          135   5e-34   Ectocarpus siliculosus
ref|WP_039386022.1|  ATPase AAA                                         135   5e-34   Neochlamydia sp. TUME1
gb|KIC75182.1|  ADP,ATP carrier protein 1                               135   6e-34   Neochlamydia sp. EPS4
ref|WP_042239794.1|  ATPase AAA                                         134   7e-34   Neochlamydia sp. S13
gb|KEI72701.1|  ATPase AAA                                              133   2e-33   Endozoicomonas elysicola
emb|CAE46508.1|  nucleotide transport protein                           131   2e-33   Parachlamydia sp. P9
ref|WP_041941596.1|  ATPase AAA                                         133   2e-33   Waddlia chondrophila
gb|ADI39022.1|  ADP/ATP translocase                                     133   2e-33   Waddlia chondrophila WSU 86-1044
ref|WP_041018366.1|  ATPase AAA                                         132   6e-33   Criblamydia sequanensis
gb|AFS19476.1|  ADP/ATP carrier protein                                 127   7e-33   Chlamydia psittaci 84/55
emb|CAX16542.1|  putative ATP/ADP translocase                           129   1e-32   Cyanophora paradoxa
ref|WP_006340593.1|  ATPase AAA                                         131   2e-32   Parachlamydia acanthamoebae
emb|CAE46505.1|  nucleotide transport protein                           129   7e-32   endosymbiont of Acanthamoeba sp. TUME1
gb|EPP36943.1|  ADP,ATP carrier protein                                 126   8e-32   Chlamydia psittaci 84-8471/1
ref|WP_014517776.1|  ATPase AAA                                         128   2e-31   Chlamydia pneumoniae
ref|WP_010882994.1|  ATPase AAA                                         128   2e-31   Chlamydia pneumoniae
ref|WP_010895317.1|  ATPase AAA                                         127   2e-31   Chlamydia pneumoniae
gb|EKE09902.1|  hypothetical protein ACD_16C00100G0064                  127   3e-31   uncultured bacterium
gb|EPP28844.1|  ADP,ATP carrier protein                                 126   7e-31   Chlamydia psittaci 08-2626_L3
ref|WP_011458125.1|  ATPase AAA                                         126   7e-31   Chlamydia felis
ref|WP_033402749.1|  ATPase AAA                                         126   8e-31   
ref|WP_032742269.1|  ATPase AAA                                         125   8e-31   
gb|EPJ16785.1|  ADP,ATP carrier protein                                 125   9e-31   Chlamydia psittaci 02DC22
ref|WP_006343113.1|  ATPase AAA                                         125   1e-30   Chlamydia psittaci
ref|WP_021756588.1|  ADP/ATP carrier protein                            125   1e-30   Chlamydia pecorum
ref|WP_021757805.1|  ADP/ATP carrier protein                            125   1e-30   Chlamydia pecorum
ref|WP_013747357.1|  ATPase AAA                                         125   1e-30   Chlamydia psittaci
ref|WP_013712807.1|  ATPase AAA                                         125   1e-30   Chlamydia pecorum
gb|EPJ33718.1|  ADP/ATP carrier family protein                          125   1e-30   Chlamydia psittaci 06-1683
ref|WP_032741515.1|  ATPase AAA                                         125   1e-30   
ref|WP_011006397.1|  ATPase AAA                                         125   2e-30   Chlamydia caviae
ref|WP_006344068.1|  ATPase AAA                                         125   2e-30   Chlamydia abortus
ref|WP_011097058.1|  ATPase AAA                                         125   2e-30   Chlamydia abortus
ref|XP_007023974.1|  TLC ATP/ADP transporter isoform 2                  124   4e-30   
ref|XP_005769576.1|  hypothetical protein EMIHUDRAFT_244401             120   5e-30   Emiliania huxleyi CCMP1516
ref|WP_010230191.1|  ATPase AAA                                         124   5e-30   Chlamydia muridarum [agent of mouse pneumonitis]
ref|WP_035405565.1|  ATPase AAA                                         124   6e-30   Chlamydia suis
ref|WP_011324550.1|  ATPase AAA                                         124   6e-30   Chlamydia trachomatis
ref|WP_014541221.1|  ATPase AAA                                         123   7e-30   Chlamydia trachomatis
ref|WP_012727795.1|  ATPase AAA                                         123   8e-30   Chlamydia trachomatis
ref|WP_009871413.1|  ATPase AAA                                         123   8e-30   Chlamydia trachomatis
ref|WP_009873033.1|  ATPase AAA                                         123   8e-30   Chlamydia trachomatis
ref|WP_006341707.1|  ATPase AAA                                         123   9e-30   Parachlamydia acanthamoebae
ref|WP_020370051.1|  MULTISPECIES: ADP,ATP carrier family protein       123   1e-29   Chlamydia ibidis
gb|KIA76916.1|  ADP,ATP carrier protein 1                               123   1e-29   Parachlamydia acanthamoebae
ref|WP_009873532.1|  ATPase AAA                                         122   3e-29   Chlamydia trachomatis
ref|WP_015506544.1|  ADP/ATP carrier protein family protein             122   3e-29   Chlamydia trachomatis
gb|ADI39042.1|  putative ADP/ATP translocase                            121   3e-29   Waddlia chondrophila WSU 86-1044
ref|WP_041941597.1|  ATPase AAA                                         121   3e-29   Waddlia chondrophila
ref|WP_020356125.1|  MULTISPECIES: ADP,ATP carrier protein              121   4e-29   Chlamydia
gb|EYE60388.1|  ADP,ATP carrier protein 2                               121   4e-29   Bacteroides fragilis str. S6L5
ref|WP_021828277.1|  MULTISPECIES: ADP/ATP carrier family protein       121   5e-29   Chlamydia gallinacea
ref|WP_013182747.1|  ATPase AAA                                         121   6e-29   Waddlia chondrophila
emb|CCB92155.1|  ADP,ATP carrier protein 1                              121   6e-29   Waddlia chondrophila 2032/99
ref|XP_002982220.1|  hypothetical protein SELMODRAFT_116019             120   1e-28   
ref|WP_042241994.1|  ATPase AAA                                         119   3e-28   Neochlamydia sp. S13
gb|KIC76343.1|  ADP,ATP carrier protein 1                               119   4e-28   Neochlamydia sp. EPS4
gb|EKE09230.1|  hypothetical protein ACD_16C00205G0026                  118   5e-28   uncultured bacterium
emb|CDZ79514.1|  ADP/ATP translocase 1                                  118   6e-28   Candidatus Rubidus massiliensis
ref|WP_039383352.1|  ATPase AAA                                         117   1e-27   Neochlamydia sp. TUME1
ref|WP_006341708.1|  ATPase AAA                                         116   3e-27   Parachlamydia acanthamoebae
ref|XP_005855475.1|  carrier protein                                    116   6e-27   Nannochloropsis gaditana CCMP526
gb|EWM29345.1|  carrier protein                                         116   7e-27   Nannochloropsis gaditana
ref|WP_042102375.1|  ATPase AAA                                         115   9e-27   Parachlamydiaceae bacterium HS-T3
ref|NP_001046257.2|  Os02g0208100                                       108   1e-26   
gb|KCW53784.1|  hypothetical protein EUGRSUZ_J03031                     113   5e-26   Eucalyptus grandis [rose gum]
gb|EWM22407.1|  carrier protein                                         114   6e-26   Nannochloropsis gaditana
ref|WP_011174791.1|  ATPase AAA                                         112   1e-25   Candidatus Protochlamydia amoebophila
ref|WP_039356292.1|  ATPase AAA                                         112   1e-25   Candidatus Protochlamydia amoebophila
ref|WP_042280889.1|  ATPase AAA                                         112   1e-25   Candidatus Protochlamydia sp. R18
ref|WP_013950719.1|  ATPase AAA                                         111   1e-25   Candidatus Midichloria mitochondrii
gb|KIC73929.1|  ADP,ATP carrier protein 1                               112   1e-25   Candidatus Protochlamydia amoebophila
gb|KJB70561.1|  hypothetical protein B456_011G079600                    111   1e-25   Gossypium raimondii
ref|WP_013944554.1|  ATPase AAA                                         111   2e-25   Simkania negevensis
ref|WP_034442354.1|  ATPase AAA                                         110   3e-25   
ref|WP_039383351.1|  ATPase AAA                                         110   3e-25   Neochlamydia sp. TUME1
ref|WP_042241991.1|  ATPase AAA                                         110   3e-25   Neochlamydia sp. S13
ref|XP_002179404.1|  nucleotide transporter 2                           111   4e-25   Phaeodactylum tricornutum CCAP 1055/1
gb|KIC76344.1|  ADP,ATP carrier protein 1                               110   4e-25   Neochlamydia sp. EPS4
ref|WP_042280890.1|  ATPase AAA                                         110   4e-25   Candidatus Protochlamydia sp. R18
ref|WP_039356289.1|  ATPase AAA                                         110   5e-25   Candidatus Protochlamydia amoebophila
ref|WP_031934367.1|  hypothetical protein                               110   6e-25   Candidatus Hepatobacter penaei
ref|WP_011174790.1|  ATPase AAA                                         110   7e-25   Candidatus Protochlamydia amoebophila
emb|CDZ79513.1|  ADP/ATP translocase 1                                  109   7e-25   Candidatus Rubidus massiliensis
ref|WP_041018291.1|  ATPase AAA                                         109   7e-25   Criblamydia sequanensis
ref|WP_018576123.1|  hypothetical protein                               109   1e-24   Legionella shakespearei
ref|XP_005823901.1|  hypothetical protein GUITHDRAFT_165621             109   2e-24   
gb|ADR52253.1|  ATP/ADP translocase                                     108   2e-24   
gb|ACZ95367.1|  ATP/ADP translocase                                     108   2e-24   
ref|WP_004596612.1|  ADP,ATP carrier protein 1                          105   2e-24   
ref|WP_032124897.1|  ATPase AAA                                         108   3e-24   
ref|WP_044054082.1|  ATPase AAA                                         108   3e-24   
ref|WP_032124896.1|  ATPase AAA                                         107   5e-24   
ref|WP_034879435.1|  hypothetical protein                               106   8e-24   
ref|WP_042102374.1|  ATPase AAA                                         106   1e-23   
ref|WP_004996827.1|  ATPase AAA                                         105   2e-23   
ref|WP_012151548.1|  ATPase AAA                                         105   3e-23   
ref|WP_011478005.1|  ATPase AAA                                         105   3e-23   
ref|WP_004599717.1|  ATPase AAA                                         105   3e-23   
ref|WP_014411976.1|  ATPase AAA                                         104   4e-23   
gb|ABV25595.1|  plastid ATP/ADP translocase                             104   8e-23   
emb|CBJ31945.1|  conserved unknown protein                              105   9e-23   
ref|WP_032139269.1|  ATPase AAA                                         103   1e-22   
ref|WP_012148204.1|  ATPase AAA                                         103   1e-22   
ref|WP_014412084.1|  ATPase AAA                                         103   1e-22   
ref|WP_014363523.1|  ATPase AAA                                         103   1e-22   
ref|WP_023507442.1|  ADP/ATP translocase 1                              103   1e-22   
ref|WP_029374421.1|  ATPase AAA                                         103   1e-22   
ref|WP_014273134.1|  ATPase AAA                                         103   1e-22   
ref|WP_011190552.1|  ATPase AAA                                         103   1e-22   
ref|WP_012719352.1|  ATPase AAA                                         103   1e-22   
ref|WP_040256787.1|  ATPase AAA                                         103   1e-22   
ref|WP_012013291.1|  ATPase AAA                                         103   1e-22   
ref|WP_014391766.1|  ATPase AAA                                         103   1e-22   
ref|WP_016917366.1|  ATPase AAA                                         103   1e-22   
emb|CAD45254.1|  ADP/ATP carrier protein                                103   1e-22   
ref|WP_011270476.1|  MULTISPECIES: ATPase AAA                           103   1e-22   
ref|WP_029374609.1|  ATPase AAA                                         103   1e-22   
ref|WP_029374502.1|  ATPase AAA                                         103   1e-22   
ref|WP_014408143.1|  ATPase AAA                                         103   1e-22   
ref|WP_010976765.1|  ATPase AAA                                         103   1e-22   
ref|WP_016769753.1|  ATPase AAA                                         103   1e-22   
ref|WP_014013803.1|  ATPase AAA                                         103   1e-22   
ref|WP_012150309.1|  ATPase AAA                                         103   1e-22   
ref|WP_014120469.1|  ATPase AAA                                         103   1e-22   
ref|WP_012736586.1|  ATPase AAA                                         103   1e-22   
ref|WP_014365220.1|  ATPase AAA                                         103   1e-22   
ref|WP_012152377.1|  ATPase AAA                                         103   1e-22   
ref|WP_014410317.1|  ATPase AAA                                         103   2e-22   
ref|WP_014364363.1|  ATPase AAA                                         103   2e-22   
ref|WP_012461657.1|  ATPase AAA                                         103   2e-22   
ref|WP_011944393.1|  ATPase AAA                                         102   3e-22   
ref|WP_010299901.1|  ATPase AAA                                         102   3e-22   
ref|WP_008579514.1|  MULTISPECIES: ATPase AAA                           102   4e-22   
ref|WP_017443549.1|  ATPase AAA                                         102   4e-22   
emb|CAE46502.1|  nucleotide transport protein                           100   5e-22   
ref|WP_014409826.1|  ATPase AAA                                         101   6e-22   
gb|EPP39128.1|  TLC ATP/ADP transporter family protein                97.4    6e-22   
ref|WP_038465856.1|  ATPase AAA                                         101   6e-22   
emb|CAD45252.1|  ADP/ATP carrier protein                                101   6e-22   
ref|WP_010420545.1|  ATPase AAA                                         101   7e-22   
gb|AFW71370.1|  hypothetical protein ZEAMMB73_421978                    100   9e-22   
ref|WP_039455652.1|  hypothetical protein                               100   1e-21   
ref|WP_038460622.1|  ATPase AAA                                         100   2e-21   
gb|EMS36430.1|  ATP/ADP translocase                                   99.8    2e-21   
gb|EJK47706.1|  hypothetical protein THAOC_33559                        101   2e-21   
ref|WP_041018292.1|  ATPase AAA                                         100   2e-21   
gb|AHA27724.1|  ATP/ADP translocase                                   99.8    2e-21   
ref|WP_038539003.1|  hypothetical protein                             99.8    2e-21   
ref|WP_011006099.1|  ATPase AAA                                         100   3e-21   
ref|WP_040055857.1|  ATPase AAA                                       99.8    3e-21   
ref|XP_002118821.1|  hypothetical protein TRIADDRAFT_9522             94.4    3e-21   
ref|XP_002293173.1|  predicted protein                                  100   4e-21   
gb|ACX71867.1|  nucleotide tansporter                                 98.2    7e-21   
gb|EPJ26965.1|  ADP/ATP carrier family protein                        97.8    8e-21   
ref|WP_011458427.1|  ATPase AAA                                       99.0    9e-21   
ref|WP_012778542.1|  ATPase AAA                                       98.2    1e-20   
ref|WP_016770196.1|  ADP,ATP carrier protein 4                        98.2    1e-20   
ref|XP_002296839.1|  predicted protein                                99.0    1e-20   
gb|KIZ03811.1|  Plastidic ATP/ADP-transporter                         95.9    2e-20   
ref|WP_006293548.1|  MULTISPECIES: ADP/ATP carrier protein family...  97.8    2e-20   
gb|AFS21988.1|  ADP/ATP carrier family protein                        97.4    2e-20   
ref|WP_020370844.1|  MULTISPECIES: ADP/ATP carrier family protein     97.8    2e-20   
gb|AFS20239.1|  ADP/ATP carrier family protein                        97.4    2e-20   
gb|EPP36532.1|  ADP/ATP carrier family protein                        97.1    2e-20   
gb|EPJ32453.1|  ADP/ATP carrier family protein                        97.4    2e-20   
ref|WP_004995670.1|  ADPATP carrier protein                           97.4    2e-20   
ref|WP_016728187.1|  ADP,ATP carrier protein 4                        97.4    2e-20   
ref|WP_016830784.1|  ADP,ATP carrier protein 4                        97.4    2e-20   
ref|WP_010977290.1|  ADP,ATP carrier protein                          97.4    2e-20   
ref|WP_016926283.1|  ADP,ATP carrier protein 4                        97.4    2e-20   
ref|WP_014410725.1|  ADP,ATP carrier protein                          97.4    3e-20   
ref|WP_016945702.1|  ADP,ATP carrier protein 4                        97.4    3e-20   
emb|CAD29686.1|  nucleoside triphosphate protein                      97.1    3e-20   
gb|AAM80566.1|  non-mitochondrial nucleotide transport protein        97.1    3e-20   
ref|WP_008580200.1|  ADP,ATP carrier protein 4                        96.3    3e-20   
ref|WP_041621135.1|  ATPase AAA                                       96.7    4e-20   
ref|WP_016966618.1|  ADP/ATP carrier family protein                   97.1    4e-20   
ref|WP_006342801.1|  ATPase AAA                                       97.1    4e-20   
ref|WP_012461410.1|  ATPase AAA                                       96.7    4e-20   
ref|WP_014944735.1|  ATPase AAA                                       97.1    4e-20   
ref|WP_014363914.1|  pyruvate phosphate dikinase                      96.7    4e-20   
ref|WP_006343793.1|  ATPase AAA                                       97.1    4e-20   
ref|WP_012148719.1|  pyruvate phosphate dikinase                      96.7    4e-20   
emb|CAM79613.1|  ATP/ADP translocase                                  96.7    4e-20   
ref|WP_011096845.1|  ATPase AAA                                       97.1    4e-20   
gb|EKD56422.1|  Nucleotide transport protein                          91.7    4e-20   
ref|WP_017442936.1|  ADP,ATP carrier protein 4                        96.7    4e-20   
ref|WP_041404689.1|  ADP/ATP carrier protein                          96.7    5e-20   
gb|ABV84832.1|  ATP/ADP translocase                                   96.7    5e-20   
ref|WP_014365801.1|  ATP/ADP translocase                              96.7    5e-20   
ref|WP_014273500.1|  ATP/ADP translocase                              96.7    5e-20   
ref|WP_011271054.1|  ADP,ATP carrier protein                          96.7    5e-20   
ref|WP_014408640.1|  ATP/ADP translocase                              96.7    5e-20   
ref|WP_014120818.1|  ADP,ATP carrier protein                          96.7    5e-20   
ref|WP_020359192.1|  MULTISPECIES: ADP/ATP carrier family protein     96.7    5e-20   
ref|WP_040255633.1|  ADP/ATP carrier protein                          96.3    5e-20   
ref|WP_037214447.1|  ADP/ATP carrier protein                          96.3    6e-20   
ref|WP_011477438.1|  ATP/ADP translocase                              96.3    6e-20   
emb|CAQ03489.1|  ATP/ADP translocase                                  96.3    6e-20   
ref|WP_023508175.1|  ADP/ATP translocase 1                            96.3    6e-20   
emb|CBJ27483.1|  ADP-ATP translocase                                  96.7    6e-20   
gb|AHK63775.1|  ADP,ATP carrier protein 2                             96.3    7e-20   
ref|WP_012719726.1|  ATP/ADP translocase                              95.9    7e-20   
ref|WP_014409200.1|  ATP/ADP translocase                              95.9    7e-20   
ref|WP_011526090.1|  ATPase AAA                                       95.9    8e-20   
ref|WP_014517560.1|  ATPase AAA                                       95.9    9e-20   
ref|WP_010883252.1|  ATPase AAA                                       95.9    9e-20   
emb|CAD45262.1|  ADP/ATP carrier protein                              95.9    9e-20   
ref|WP_014362945.1|  MULTISPECIES: ADP,ATP carrier protein            95.5    1e-19   
ref|WP_012150855.1|  ADP,ATP carrier protein                          95.5    1e-19   
ref|WP_014014348.1|  ADP,ATP carrier protein                          95.5    1e-19   
ref|WP_013943650.1|  ADP,ATP carrier protein 1                        95.1    1e-19   
ref|WP_014412733.1|  ATP/ADP translocase                              95.1    1e-19   
ref|WP_042103597.1|  ATPase AAA                                       95.1    2e-19   
ref|WP_012736359.1|  ADP,ATP carrier protein                          95.1    2e-19   
ref|WP_012151976.1|  ATP/ADP translocase                              94.7    2e-19   
ref|WP_041078749.1|  ADP/ATP carrier protein                          94.7    2e-19   
ref|WP_012461505.1|  ADP,ATP carrier protein homolog                  94.4    2e-19   
ref|WP_016916813.1|  ADP,ATP carrier protein 4                        94.4    3e-19   
ref|WP_012472291.1|  ADP/ATP carrier protein                          94.0    3e-19   
ref|WP_019230826.1|  hypothetical protein                             93.6    5e-19   
gb|EWM20928.1|  carrier protein                                       94.7    5e-19   
ref|WP_022174379.1|  aDP ATP carrier protein                          93.6    5e-19   
ref|WP_010423014.1|  ATP/ADP translocase                              93.2    6e-19   
emb|CAD45261.1|  ADP/ATP carrier protein                              93.2    6e-19   
ref|WP_032138622.1|  ADP/ATP carrier protein                          93.2    7e-19   
ref|WP_012149628.1|  ADP,ATP carrier protein                          93.2    8e-19   
ref|WP_014392274.1|  ATP/ADP translocase                              92.8    9e-19   
ref|WP_021828898.1|  MULTISPECIES: ADP/ATP carrier family protein     92.8    1e-18   
ref|WP_011190940.1|  ADP/ATP carrier protein 4                        92.0    2e-18   
ref|WP_026071769.1|  ATPase AAA                                       92.0    2e-18   
ref|XP_011398982.1|  Plastidic ATP/ADP-transporter                    92.0    3e-18   
gb|AEJ77374.1|  ADP,ATP carrier protein 1                             90.9    3e-18   
ref|WP_032112829.1|  ATPase AAA                                       91.3    3e-18   
gb|EKE08335.1|  ADP/ATP translocase                                   90.9    4e-18   
ref|WP_004597746.1|  ADP,ATP carrier protein 4                        90.9    5e-18   
ref|WP_009872703.1|  ATPase AAA                                       90.9    6e-18   
ref|WP_020967029.1|  ATPase AAA                                       90.9    6e-18   
ref|WP_009873856.1|  ATPase AAA                                       90.9    6e-18   
ref|WP_009871857.1|  ATPase AAA                                       90.9    6e-18   
emb|CAB39535.1|  nucleoside triphosphate transport protein 2          90.9    6e-18   
ref|WP_035406784.1|  ATPase AAA                                       90.5    6e-18   
ref|WP_011944983.1|  ADP/ATP carrier protein                          90.1    9e-18   
ref|WP_041404846.1|  ADP/ATP carrier protein                          89.7    1e-17   
ref|WP_014409011.1|  ATP/ADP translocase                              89.7    1e-17   
gb|ABV85155.1|  ATP/ADP translocase                                   89.7    1e-17   
ref|WP_032138981.1|  ADP/ATP carrier protein                          89.4    2e-17   
ref|WP_023507537.1|  ADP/ATP translocase 1                            89.4    2e-17   
ref|XP_003061065.1|  ATP:ADP antiporter family                        89.7    2e-17   
ref|WP_008579634.1|  MULTISPECIES: ADP,ATP carrier protein            89.4    2e-17   
ref|WP_017442597.1|  ADP,ATP carrier protein 5                        89.0    2e-17   
ref|WP_041621426.1|  ADP/ATP carrier protein                          89.0    2e-17   
ref|WP_041621816.1|  ADP/ATP carrier protein                          88.6    2e-17   
ref|WP_014364180.1|  ADP,ATP carrier protein                          88.6    3e-17   
dbj|BAG40558.1|  ADP,ATP carrier protein homolog                      88.6    3e-17   
ref|WP_012149067.1|  ADP,ATP carrier protein                          88.6    3e-17   
emb|CAM79378.1|  ATP/ADP translocase                                  88.6    3e-17   
ref|WP_011476837.1|  ATP/ADP translocase                              88.6    3e-17   
emb|CAD45266.1|  ADP/ATP carrier protein                              88.6    3e-17   
ref|WP_014409567.1|  ADP,ATP carrier protein                          88.6    3e-17   
ref|WP_014412334.1|  ADP,ATP carrier protein                          88.6    3e-17   
gb|ABV75397.1|  ADP,ATP carrier protein                               88.2    3e-17   
ref|WP_041816792.1|  ADP/ATP carrier protein                          88.2    3e-17   
emb|CAA72457.1|  ATP/ADP translocase                                  84.7    4e-17   
ref|XP_003083204.1|  unnamed protein product                          89.0    4e-17   
ref|WP_011477389.1|  ATPase AAA                                       87.8    6e-17   
ref|WP_010231516.1|  ATPase AAA                                       87.8    6e-17   
ref|WP_040458412.1|  hypothetical protein                             87.4    7e-17   
ref|WP_013181317.1|  ADP/ATP translocase                              87.4    7e-17   
ref|WP_014365452.1|  ATP/ADP translocase                              87.4    7e-17   
gb|EKE01541.1|  ATP/ADP translocase                                   87.4    8e-17   
ref|WP_024010999.1|  ADP, ATP carrier protein                         87.4    8e-17   
ref|WP_014392737.1|  ATP/ADP translocase                              87.4    8e-17   
ref|WP_021756354.1|  ADP/ATP carrier protein                          87.4    9e-17   
ref|WP_013712507.1|  ATPase AAA                                       87.4    9e-17   
ref|WP_024010287.1|  ADP, ATP carrier protein                         87.4    9e-17   
ref|WP_010421381.1|  ADP,ATP carrier protein                          87.0    1e-16   
ref|WP_014419937.1|  MULTISPECIES: ATP/ADP translocase                87.0    1e-16   
gb|AEV92626.1|  ATP/ADP translocase                                   86.7    1e-16   
ref|WP_012736677.1|  ADP,ATP carrier protein                          86.7    1e-16   
ref|WP_010977709.1|  ADP,ATP carrier protein                          87.0    1e-16   
ref|WP_016945927.1|  ADP,ATP carrier protein 5                        87.0    1e-16   
ref|WP_016926548.1|  ADP,ATP carrier protein 5                        87.0    1e-16   
ref|WP_006342008.1|  translocase                                      87.0    1e-16   
gb|EAA26151.1|  ADPATP carrier protein                                86.7    1e-16   
emb|CEG01693.1|  Major facilitator superfamily domain, general su...  87.0    1e-16   
ref|WP_016830942.1|  ADP,ATP carrier protein 5                        87.0    1e-16   
ref|WP_016728342.1|  ADP,ATP carrier protein 5                        87.0    1e-16   
ref|WP_016770338.1|  ADP,ATP carrier protein 5                        87.0    1e-16   
ref|WP_012719990.1|  MULTISPECIES: ATP/ADP translocase                87.0    1e-16   
ref|WP_040256305.1|  ADP/ATP carrier protein                          86.7    1e-16   
ref|WP_041078250.1|  ADP/ATP carrier protein                          86.7    1e-16   
gb|ABV76706.1|  ADP,ATP carrier protein                               86.7    1e-16   
ref|WP_023508224.1|  ADP/ATP translocase 1                            86.7    1e-16   
ref|WP_011270513.1|  ADP,ATP carrier protein                          86.7    1e-16   
ref|WP_012262574.1|  MULTISPECIES: ADP,ATP carrier protein            86.7    1e-16   
ref|WP_014014739.1|  ADP,ATP carrier protein                          86.7    1e-16   
emb|CAD45265.1|  ADP/ATP carrier protein                              86.7    1e-16   
ref|WP_014121056.1|  ATP/ADP translocase                              86.7    1e-16   
ref|WP_014412653.1|  ATPase AAA                                       86.7    2e-16   
ref|WP_012149674.1|  ATPase AAA                                       86.7    2e-16   
ref|WP_019231187.1|  hypothetical protein                             86.3    2e-16   
ref|WP_011270922.1|  ADP,ATP carrier protein                          86.3    2e-16   
ref|WP_008579871.1|  MULTISPECIES: ATPase AAA                         85.9    2e-16   
ref|WP_041078078.1|  ADP/ATP carrier protein                          85.9    3e-16   
ref|WP_040255821.1|  ATPase AAA                                       85.9    3e-16   



>gb|ABO87603.1| chloroplast ATP/ADP translocator [Pisum sativum]
Length=280

 Score =   230 bits (586),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P+AP LA+ GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  111  ILFGGPIAPGLASLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  170

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAW+ AAKSLD QFT
Sbjct  171  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLGAAKSLDTQFT  230

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALR+EEELEKEMERAAA+KIPVVSE
Sbjct  231  ALRKEEELEKEMERAAAVKIPVVSE  255



>ref|XP_004506888.1| PREDICTED: plastidic ATP/ADP-transporter-like [Cicer arietinum]
Length=618

 Score =   231 bits (590),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP LA+ GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  449  ILFGGPLAPGLASLGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  508

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAW++AAKSLD QFT
Sbjct  509  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLAAAKSLDTQFT  568

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALR+EEELEKEMERAAA+KIPVVSE
Sbjct  569  ALRQEEELEKEMERAAAVKIPVVSE  593



>gb|AFD54199.1| gibberellin 3-beta-dioxygenase 4, partial [Vitis vinifera]
Length=317

 Score =   223 bits (567),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP LA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  141  ILFGDPFAPALAKFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  200

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+L+VIV+AW++AAKSLD QFT
Sbjct  201  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILMVIVVAWLAAAKSLDTQFT  260



>gb|ABG37645.1| plastid ATP/ADP-transporter [Populus trichocarpa]
Length=774

 Score =   233 bits (594),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 111/120 (93%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAPTL  FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  598  ILFGGPLAPTLTQFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  657

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV AW+ AAKSLD QFT
Sbjct  658  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVFAWLGAAKSLDTQFT  717



>gb|KEH28732.1| plastidic ATP/ADP-transporter-like protein [Medicago truncatula]
Length=629

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P+AP LA+ GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  460  ILFGGPIAPGLASIGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  519

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAW+ AAKSLD QFT
Sbjct  520  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLGAAKSLDTQFT  579

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALR+EEELEK+MERAAA+KIPVVSE
Sbjct  580  ALRQEEELEKQMERAAAVKIPVVSE  604



>gb|KHG23248.1| ADP,ATP carrier 1, chloroplastic -like protein [Gossypium arboreum]
Length=612

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL PTLA FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  444  ILFGGPLGPTLAKFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  503

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+SAAKSLD QFT
Sbjct  504  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLSAAKSLDTQFT  563



>ref|XP_003543665.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Glycine 
max]
Length=615

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P+AP +A FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  445  ILFGGPIAPVIAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  504

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAW+SAAKSLD QFT
Sbjct  505  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLSAAKSLDTQFT  564

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALRREEELEKEMERAAA+KIPVV++
Sbjct  565  ALRREEELEKEMERAAAVKIPVVAK  589



>gb|KHN44149.1| ADP,ATP carrier protein 1, chloroplastic [Glycine soja]
Length=615

 Score =   229 bits (583),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P+AP +A FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  445  ILFGGPIAPVIAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  504

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAW+SAAKSLD QFT
Sbjct  505  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLSAAKSLDTQFT  564

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALRREEELEKEMERAAA+KIPVV++
Sbjct  565  ALRREEELEKEMERAAAVKIPVVAK  589



>gb|KJB70559.1| hypothetical protein B456_011G079600 [Gossypium raimondii]
 gb|KJB70562.1| hypothetical protein B456_011G079600 [Gossypium raimondii]
Length=609

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL PTLA FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  444  ILFGGPLGPTLAKFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  503

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+SAAKSLD QFT
Sbjct  504  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLSAAKSLDSQFT  563



>ref|XP_004252326.1| PREDICTED: plastidic ATP/ADP-transporter [Solanum lycopersicum]
Length=629

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            FGAPLAPTLA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA
Sbjct  454  FGAPLAPTLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  513

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            AIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLGGVLLVIVLAW++AAKSLD QFT
Sbjct  514  AIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGGVLLVIVLAWLAAAKSLDQQFT  571



>ref|XP_011035631.1| PREDICTED: plastidic ATP/ADP-transporter-like [Populus euphratica]
Length=621

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL PTLA FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  445  ILFGGPLVPTLAQFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  504

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAW++AAKSLD QFT
Sbjct  505  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLAAAKSLDTQFT  564



>ref|XP_010099654.1| Plastidic [Morus notabilis]
 gb|EXB80175.1| Plastidic [Morus notabilis]
Length=620

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P APTLA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  448  ILFGGPFAPTLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  507

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW++AA+SLD QFT
Sbjct  508  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLAAARSLDTQFT  567



>ref|XP_007135724.1| hypothetical protein PHAVU_010G152900g [Phaseolus vulgaris]
 gb|ESW07718.1| hypothetical protein PHAVU_010G152900g [Phaseolus vulgaris]
Length=623

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            FG P+APTLA+FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA
Sbjct  447  FGGPIAPTLASFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  506

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFTal  399
            AIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGGVLL+IV AW++AAKSLD QFTAL
Sbjct  507  AIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGVLLLIVSAWLAAAKSLDTQFTAL  566

Query  400  rreeelekemeraaalkIPVVSE  468
            R+EEELEKEMERAAA+KIPVV+E
Sbjct  567  RKEEELEKEMERAAAVKIPVVAE  589



>ref|XP_004487222.1| PREDICTED: plastidic ATP/ADP-transporter-like [Cicer arietinum]
Length=632

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP +   G+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  456  ILFGDPLAPVIGKLGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  515

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAW+SAAKSLD QFT
Sbjct  516  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLSAAKSLDTQFT  575

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALRREEELEK MERAA + IPVV+E
Sbjct  576  ALRREEELEKVMERAATINIPVVAE  600



>ref|XP_004235723.1| PREDICTED: plastidic ATP/ADP-transporter-like [Solanum lycopersicum]
Length=625

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAPTLA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  447  ILFGDPLAPTLAKFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  506

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAW++AA+SLD QFT
Sbjct  507  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLAAARSLDGQFT  566



>ref|XP_002298119.2| Chloroplast ADP family protein [Populus trichocarpa]
 gb|EEE82924.2| Chloroplast ADP family protein [Populus trichocarpa]
Length=621

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL PTLA FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  445  ILFGGPLVPTLAQFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  504

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW++AAKSLD QFT
Sbjct  505  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLAAAKSLDTQFT  564



>ref|XP_010033911.1| PREDICTED: plastidic ATP/ADP-transporter-like [Eucalyptus grandis]
 gb|KCW53783.1| hypothetical protein EUGRSUZ_J03031 [Eucalyptus grandis]
Length=615

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            + FG PL PTLA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  446  VLFGGPLVPTLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  505

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+L+VIVLAW++AAKSLD QFT
Sbjct  506  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILMVIVLAWLAAAKSLDAQFT  565



>ref|NP_001274794.1| plastidic ATP/ADP-transporter [Solanum tuberosum]
 sp|O24381.2|TLC1_SOLTU RecName: Full=Plastidic ATP/ADP-transporter [Solanum tuberosum]
 emb|CAA71785.1| plastidic ATP/ADP-transporter [Solanum tuberosum]
Length=631

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            FGAPLAPTLA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA
Sbjct  456  FGAPLAPTLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  515

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            AIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLGGVLLVIVLAW+ AAKSLD QFT
Sbjct  516  AIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGGVLLVIVLAWLGAAKSLDGQFT  573



>ref|XP_007150697.1| hypothetical protein PHAVU_005G174000g [Phaseolus vulgaris]
 gb|ESW22691.1| hypothetical protein PHAVU_005G174000g [Phaseolus vulgaris]
Length=617

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P+AP +A FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  446  ILFGGPVAPVIAKFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  505

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAW++AAKSLD QFT
Sbjct  506  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLAAAKSLDSQFT  565

Query  394  alrreeelekemeraaalkIPVVSE  468
             LRREE+LE+EMERAAA+KIPVV++
Sbjct  566  DLRREEDLEREMERAAAVKIPVVAK  590



>gb|ACF80277.1| unknown [Zea mays]
Length=348

 Score =   219 bits (559),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P +  FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  163  ILFGEPLTPLMTKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  222

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIVLAW+ A +SLD+QF+
Sbjct  223  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIVLAWLGAVRSLDLQFS  282



>ref|XP_011039999.1| PREDICTED: plastidic ATP/ADP-transporter-like [Populus euphratica]
Length=623

 Score =   226 bits (577),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAPTL  FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  447  ILFGGPLAPTLTQFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  506

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV AW+ AAKSLD QFT
Sbjct  507  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVFAWLGAAKSLDTQFT  566



>gb|KHG15786.1| ADP,ATP carrier 1, chloroplastic -like protein [Gossypium arboreum]
Length=619

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P APTLA FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  445  ILFGDPFAPTLAKFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  504

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+L+VIV AW+SAA+SLDVQFT
Sbjct  505  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILMVIVFAWLSAARSLDVQFT  564



>gb|KJB56643.1| hypothetical protein B456_009G129100 [Gossypium raimondii]
Length=619

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P APTLA FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  445  ILFGDPFAPTLAKFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  504

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+L+VIV AW+SAA+SLDVQFT
Sbjct  505  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILMVIVFAWLSAARSLDVQFT  564



>dbj|BAD95278.1| adenine nucleotide translocase [Arabidopsis thaliana]
Length=204

 Score =   214 bits (546),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  36   ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  95

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV AW++AAKSL+ QF 
Sbjct  96   KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIVTAWLAAAKSLEGQFN  155

Query  394  alrreeelekemeraaalkIPVVSE  468
            +LR EEELEKEMERA+++KIPVVS+
Sbjct  156  SLRSEEELEKEMERASSVKIPVVSQ  180



>ref|XP_009767462.1| PREDICTED: plastidic ATP/ADP-transporter [Nicotiana sylvestris]
Length=631

 Score =   226 bits (577),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FGAPLAP LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  454  ILFGAPLAPALAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  513

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLGGVLLVIVLAW+ AAKSLD QFT
Sbjct  514  KAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGGVLLVIVLAWLGAAKSLDAQFT  573



>ref|XP_002303268.1| Chloroplast ADP family protein [Populus trichocarpa]
 gb|EEE78247.1| Chloroplast ADP family protein [Populus trichocarpa]
Length=623

 Score =   226 bits (576),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAPTL  FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  447  ILFGGPLAPTLTQFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  506

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV AW+ AAKSLD QFT
Sbjct  507  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVFAWLGAAKSLDTQFT  566



>gb|KJB13103.1| hypothetical protein B456_002G057300 [Gossypium raimondii]
Length=621

 Score =   226 bits (576),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL PTLA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  446  ILFGDPLGPTLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  505

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLGG+LLVIVLAW++AAKSLD QFT
Sbjct  506  KAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGGILLVIVLAWLAAAKSLDTQFT  565

Query  394  alrreeelekemeraaalkIPVVSE  468
               R+EE  ++    AA+KIPVVSE
Sbjct  566  -ALRQEEELEKEMERAAVKIPVVSE  589



>gb|KJB13104.1| hypothetical protein B456_002G057300 [Gossypium raimondii]
Length=619

 Score =   226 bits (575),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL PTLA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  444  ILFGDPLGPTLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  503

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLGG+LLVIVLAW++AAKSLD QFT
Sbjct  504  KAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGGILLVIVLAWLAAAKSLDTQFT  563

Query  394  alrreeelekemeraaalkIPVVSE  468
               R+EE  ++    AA+KIPVVSE
Sbjct  564  -ALRQEEELEKEMERAAVKIPVVSE  587



>ref|XP_007023975.1| TLC ATP/ADP transporter isoform 3, partial [Theobroma cacao]
 gb|EOY26597.1| TLC ATP/ADP transporter isoform 3, partial [Theobroma cacao]
Length=491

 Score =   223 bits (567),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL   LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  357  ILFGDPLGLGLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  416

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAW+SAAKSLD QFT
Sbjct  417  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLSAAKSLDTQFT  476



>ref|XP_009595520.1| PREDICTED: plastidic ATP/ADP-transporter [Nicotiana tomentosiformis]
Length=631

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FGAPLAP LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  454  ILFGAPLAPALAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  513

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLGGVLLVIVLAW+ AAKSLD QFT
Sbjct  514  KAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGGVLLVIVLAWLGAAKSLDGQFT  573



>gb|AAM29152.1| plastidic ATP/ADP transporter [Citrus hybrid cultivar]
Length=588

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            FG PL P LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA
Sbjct  429  FGDPLGPALAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  488

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFTal  399
            AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AA+SLD QFT  
Sbjct  489  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAARSLDTQFT-A  547

Query  400  rreeelekemeraaalkIPVVSE  468
             R+EE  ++    AA+KIPVVSE
Sbjct  548  LRQEEELEKEMERAAVKIPVVSE  570



>gb|KDP37155.1| hypothetical protein JCGZ_06211 [Jatropha curcas]
Length=623

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP LA FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDE+TKVKG
Sbjct  448  ILFGGPLAPALAQFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEETKVKG  507

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG LLVIVLAW++AAKSLD QFT
Sbjct  508  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGTLLVIVLAWLAAAKSLDTQFT  567



>ref|XP_006427151.1| hypothetical protein CICLE_v10025170mg [Citrus clementina]
 gb|ESR40391.1| hypothetical protein CICLE_v10025170mg [Citrus clementina]
Length=621

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            FG PL P LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA
Sbjct  450  FGDPLGPALAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  509

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFTal  399
            AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AA+SLD QFT  
Sbjct  510  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAARSLDTQFT-A  568

Query  400  rreeelekemeraaalkIPVVSE  468
             R+EE  ++    AA+KIPVVSE
Sbjct  569  LRQEEELEKEMERAAVKIPVVSE  591



>ref|XP_006465406.1| PREDICTED: LOW QUALITY PROTEIN: plastidic ATP/ADP-transporter-like 
[Citrus sinensis]
Length=609

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            FG PL P LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA
Sbjct  450  FGDPLGPALAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  509

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFTal  399
            AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AA+SLD QFT  
Sbjct  510  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAARSLDTQFT-A  568

Query  400  rreeelekemeraaalkIPVVSE  468
             R+EE  ++    AA+KIPVVSE
Sbjct  569  LRQEEELEKEMERAAVKIPVVSE  591



>gb|EYU24674.1| hypothetical protein MIMGU_mgv1a002918mg [Erythranthe guttata]
Length=625

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            FG PL P LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA
Sbjct  452  FGGPLGPALANFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  511

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AAKSLD QFT
Sbjct  512  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAAKSLDGQFT  569



>gb|KHN47790.1| ADP,ATP carrier protein 1, chloroplastic [Glycine soja]
Length=623

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP LA+ GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  446  ILFGGPLAPGLASLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  505

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LL+IV AW++AAKSLD QFT
Sbjct  506  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLLIVSAWLAAAKSLDTQFT  565

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALR+EEELEKEMERAA +KIPVV+E
Sbjct  566  ALRKEEELEKEMERAATVKIPVVAE  590



>gb|KHN01355.1| ADP,ATP carrier protein 1, chloroplastic [Glycine soja]
Length=623

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP LA+ GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  446  ILFGGPLAPGLASIGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  505

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLL+IV AW++AAKSLD QFT
Sbjct  506  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLLIVSAWLAAAKSLDTQFT  565

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALR+EEELEKEMERAAA+KIPVV+E
Sbjct  566  ALRKEEELEKEMERAAAVKIPVVAE  590



>ref|XP_006583133.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Glycine 
max]
Length=623

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP LA+ GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  446  ILFGGPLAPGLASIGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  505

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLL+IV AW++AAKSLD QFT
Sbjct  506  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLLIVSAWLAAAKSLDTQFT  565

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALR+EEELEKEMERAAA+KIPVV+E
Sbjct  566  ALRKEEELEKEMERAAAVKIPVVAE  590



>ref|XP_006585647.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Glycine 
max]
Length=624

 Score =   223 bits (569),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP LA+ GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  447  ILFGGPLAPGLASLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  506

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LL+IV AW++AAKSLD QFT
Sbjct  507  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLLIVSAWLAAAKSLDTQFT  566

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALR+EEELEKEMERAA +KIPVV+E
Sbjct  567  ALRKEEELEKEMERAATVKIPVVAE  591



>ref|XP_010061949.1| PREDICTED: plastidic ATP/ADP-transporter-like [Eucalyptus grandis]
 gb|KCW68998.1| hypothetical protein EUGRSUZ_F02558 [Eucalyptus grandis]
Length=623

 Score =   223 bits (569),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            FG PLAP+LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA
Sbjct  449  FGDPLAPSLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  508

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW++AA+SL+ QF+
Sbjct  509  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLAAARSLETQFS  566



>ref|XP_011081074.1| PREDICTED: plastidic ATP/ADP-transporter [Sesamum indicum]
Length=630

 Score =   223 bits (569),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP LA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  453  ILFGDPLAPALAKFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  512

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AAKSLD QFT
Sbjct  513  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAAKSLDGQFT  572



>emb|CBI36236.3| unnamed protein product [Vitis vinifera]
Length=555

 Score =   222 bits (565),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP LA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  379  ILFGDPFAPALAKFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  438

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+L+VIV+AW++AAKSLD QFT
Sbjct  439  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILMVIVVAWLAAAKSLDTQFT  498



>ref|XP_006341665.1| PREDICTED: plastidic ATP/ADP-transporter-like [Solanum tuberosum]
Length=626

 Score =   223 bits (569),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAPTL  FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  448  ILFGDPLAPTLTKFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  507

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGGVLLVIVLAW+ AA+SLD QFT
Sbjct  508  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGVLLVIVLAWLGAARSLDGQFT  567



>ref|XP_007023973.1| TLC ATP/ADP transporter isoform 1 [Theobroma cacao]
 gb|EOY26595.1| TLC ATP/ADP transporter isoform 1 [Theobroma cacao]
Length=620

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL   LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  445  ILFGDPLGLGLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  504

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAW+SAAKSLD QFT
Sbjct  505  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLSAAKSLDTQFT  564



>gb|KJB68136.1| hypothetical protein B456_010G227600 [Gossypium raimondii]
Length=615

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  440  ILFGDPLGPALAEFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  499

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LL+IV  W+SAAKSLD QFT
Sbjct  500  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLMIVFTWLSAAKSLDTQFT  559



>ref|XP_004302940.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=613

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL+P +A+ GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  446  ILFGGPLSPAIASLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  505

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAW+ AA+SLD QFT
Sbjct  506  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLGAARSLDTQFT  565



>gb|AAT73075.1| plastidic ATP/ADP transporter [Helianthus tuberosus]
Length=459

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP L  FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  294  ILFGDPLAPGLMKFGITPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  353

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV AW+ AA+SLD QFT
Sbjct  354  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVGAWLGAARSLDKQFT  413



>gb|KHG10295.1| ADP,ATP carrier 1, chloroplastic -like protein [Gossypium arboreum]
Length=630

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 129/145 (89%), Gaps = 1/145 (1%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL  TLA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  455  ILFGDPLGLTLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  514

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLGG+LLVIVLAW+ AAKSLD QFT
Sbjct  515  KAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGGILLVIVLAWLEAAKSLDTQFT  574

Query  394  alrreeelekemeraaalkIPVVSE  468
               R+EE  ++    AA+KIPVVSE
Sbjct  575  -ALRQEEELEKEMERAAVKIPVVSE  598



>ref|XP_009343421.1| PREDICTED: plastidic ATP/ADP-transporter-like [Pyrus x bretschneideri]
 ref|XP_009343422.1| PREDICTED: plastidic ATP/ADP-transporter-like [Pyrus x bretschneideri]
Length=617

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL+P +A+ GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  444  ILFGGPLSPAIASLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  503

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW++AA+SLD QFT
Sbjct  504  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLAAARSLDTQFT  563



>ref|XP_011072264.1| PREDICTED: plastidic ATP/ADP-transporter-like [Sesamum indicum]
Length=626

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP LA  GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  453  ILFGDPLAPGLAKIGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  512

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AAKSLD QFT
Sbjct  513  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAAKSLDGQFT  572



>gb|AAS82778.1| plastidic ATP/ADP-transporter [Helianthus tuberosus]
Length=459

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP L  FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  294  ILFGDPLAPGLMKFGITPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  353

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV AW+ AA+SLD QFT
Sbjct  354  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVGAWLGAARSLDKQFT  413



>dbj|BAD91180.1| putative plastidic adenylate transporter [Mesembryanthemum crystallinum]
Length=622

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL PTL++FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  451  ILFGGPLGPTLSSFGITPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  510

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LL+IV AW++AA+SLD QFT
Sbjct  511  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLLIVTAWLAAARSLDKQFT  570



>ref|XP_002285232.1| PREDICTED: plastidic ATP/ADP-transporter [Vitis vinifera]
Length=621

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP LA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  445  ILFGDPFAPALAKFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  504

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+L+VIV+AW++AAKSLD QFT
Sbjct  505  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILMVIVVAWLAAAKSLDTQFT  564



>gb|EYU21596.1| hypothetical protein MIMGU_mgv1a002865mg [Erythranthe guttata]
Length=629

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL+P LA  G+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  452  ILFGGPLSPALAGIGVTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  511

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AAKSLD QFT
Sbjct  512  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAAKSLDTQFT  571



>emb|CAN83628.1| hypothetical protein VITISV_019239 [Vitis vinifera]
Length=617

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP LA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  440  ILFGDPFAPALAKFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  499

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+L+VIV+AW++AAKSLD QFT
Sbjct  500  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILMVIVVAWLAAAKSLDTQFT  559



>ref|XP_006829678.1| hypothetical protein AMTR_s00122p00140700 [Amborella trichopoda]
 gb|ERM97094.1| hypothetical protein AMTR_s00122p00140700 [Amborella trichopoda]
Length=660

 Score =   222 bits (566),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP LA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDE+TKVKG
Sbjct  458  ILFGDPLAPALAKFGITPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEETKVKG  517

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVL W++AA+SLD QFT
Sbjct  518  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLGWLAAARSLDKQFT  577



>ref|XP_009758418.1| PREDICTED: plastidic ATP/ADP-transporter-like [Nicotiana sylvestris]
Length=629

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP LA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  451  ILFGDPLAPALAKFGITPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  510

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVL W+ AA+SLD QFT
Sbjct  511  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLGWLGAARSLDGQFT  570



>ref|XP_004147999.1| PREDICTED: plastidic ATP/ADP-transporter-like [Cucumis sativus]
 ref|XP_004167037.1| PREDICTED: plastidic ATP/ADP-transporter-like [Cucumis sativus]
 gb|KGN58138.1| ATP/ADP transporter [Cucumis sativus]
Length=627

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P+AP L  FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  450  ILFGGPIAPMLTQFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  509

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAW+ AA+SLD QF+
Sbjct  510  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLGAARSLDSQFS  569



>ref|XP_008447482.1| PREDICTED: plastidic ATP/ADP-transporter-like [Cucumis melo]
Length=627

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P+AP L  FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  450  ILFGGPIAPMLTQFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  509

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAW+ AA+SLD QF+
Sbjct  510  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLGAARSLDSQFS  569



>ref|XP_010254276.1| PREDICTED: plastidic ATP/ADP-transporter-like [Nelumbo nucifera]
Length=620

 Score =   221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP +   GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  446  ILFGGPLAPAIGKLGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  505

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV AW++AAKSLD QF 
Sbjct  506  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVFAWLAAAKSLDGQFN  565

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALR+EEELEKEME  AA+KIPVVS+
Sbjct  566  ALRKEEELEKEMEERAAVKIPVVSK  590



>gb|AAT99359.1| chloroplast ATP/ADP transporter protein [Helianthus tuberosus]
Length=487

 Score =   218 bits (555),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP L  FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  322  ILFGDPLAPGLMKFGITPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  381

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV AW+ AA+SLD QFT
Sbjct  382  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVGAWLGAARSLDKQFT  441



>gb|EPS64663.1| hypothetical protein M569_10117 [Genlisea aurea]
Length=631

 Score =   221 bits (563),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP LA FGMTPLLAAVYVGA+QNIFSKS+KYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  453  ILFGDPLAPVLAKFGMTPLLAAVYVGALQNIFSKSSKYSLFDPCKEMAYIPLDEDTKVKG  512

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LL IVLAW+ AA+SLD QFT
Sbjct  513  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLAIVLAWLGAARSLDGQFT  572



>gb|AAZ23107.1| plastid ATP/ADP transport protein 2 [Manihot esculenta]
Length=623

 Score =   221 bits (562),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP L+ FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDE+TKVKG
Sbjct  447  ILFGGPLAPVLSQFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEETKVKG  506

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG LLVIVL W++AA+SLD QFT
Sbjct  507  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGTLLVIVLLWLAAARSLDTQFT  566



>ref|XP_008377604.1| PREDICTED: plastidic ATP/ADP-transporter-like [Malus domestica]
Length=623

 Score =   221 bits (562),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL+P +A+ GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  449  ILFGGPLSPAIASLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  508

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAW++AA SLD QFT
Sbjct  509  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLAAASSLDKQFT  568



>ref|XP_010691228.1| PREDICTED: plastidic ATP/ADP-transporter [Beta vulgaris subsp. 
vulgaris]
Length=629

 Score =   220 bits (561),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P L TFG+TPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTK+KG
Sbjct  453  ILFGDPLGPLLGTFGLTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKLKG  512

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AA+SLD QFT
Sbjct  513  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAARSLDKQFT  572



>ref|XP_008672827.1| PREDICTED: plastidic ATP/ADP-transporter isoform X1 [Zea mays]
Length=641

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P LAT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  457  ILFGQPLTPMLATMGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  516

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AA SLD QF+
Sbjct  517  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAASSLDKQFS  576



>ref|XP_009624271.1| PREDICTED: plastidic ATP/ADP-transporter-like [Nicotiana tomentosiformis]
Length=631

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP LA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  453  ILFGDPLAPALAKFGITPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  512

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV+ W+ AA+SLD QFT
Sbjct  513  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVVGWLGAARSLDGQFT  572



>tpg|DAA58346.1| TPA: plastidic ATP/ADP-transporter [Zea mays]
Length=612

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P LAT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  457  ILFGQPLTPMLATMGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  516

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AA SLD QF+
Sbjct  517  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAASSLDKQFS  576



>ref|XP_002458233.1| hypothetical protein SORBIDRAFT_03g029490 [Sorghum bicolor]
 gb|EES03353.1| hypothetical protein SORBIDRAFT_03g029490 [Sorghum bicolor]
Length=636

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P LAT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  458  ILFGQPLTPMLATMGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  517

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AA SLD QF+
Sbjct  518  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAANSLDKQFS  577



>ref|XP_002517555.1| Plastidic ATP/ADP-transporter, putative [Ricinus communis]
 gb|EEF44719.1| Plastidic ATP/ADP-transporter, putative [Ricinus communis]
Length=621

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P+AP LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDE+TKVKG
Sbjct  447  ILFGGPIAPALAQFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEETKVKG  506

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG LLVIVL W+ AA+SLD QFT
Sbjct  507  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGTLLVIVLLWLGAARSLDTQFT  566



>gb|AFW83424.1| hypothetical protein ZEAMMB73_806603 [Zea mays]
Length=634

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P LAT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  456  ILFGQPLTPMLATMGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  515

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AA SLD QF+
Sbjct  516  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAASSLDKQFS  575



>ref|XP_006648444.1| PREDICTED: plastidic ATP/ADP-transporter-like [Oryza brachyantha]
Length=548

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P +AT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  363  ILFGEPLTPLMATLGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  422

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIVLAW+ A +SLD QF+
Sbjct  423  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIVLAWLGAVRSLDSQFS  482



>gb|AAZ23106.1| plastid ATP/ADP transport protein 1 [Manihot esculenta]
Length=619

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P+ P L  FG+TPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDE+TKVKG
Sbjct  447  ILFGGPIQPALVQFGLTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEETKVKG  506

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW++AAKSLD QFT
Sbjct  507  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLAAAKSLDTQFT  566



>ref|XP_010925271.1| PREDICTED: plastidic ATP/ADP-transporter-like [Elaeis guineensis]
Length=667

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP L  FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  467  ILFGEPLAPLLGKFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  526

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AA+SLD QF+
Sbjct  527  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWIGAARSLDAQFS  586



>gb|EEE56534.1| hypothetical protein OsJ_05838 [Oryza sativa Japonica Group]
Length=592

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P +AT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  407  ILFGEPLTPLMATLGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  466

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIVLAW+ A +SLD QF+
Sbjct  467  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIVLAWLGAVRSLDSQFS  526



>ref|NP_001147851.1| plastidic ATP/ADP-transporter [Zea mays]
 gb|ACG28895.1| plastidic ATP/ADP-transporter [Zea mays]
Length=642

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P LAT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  457  ILFGQPLTPMLATMGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  516

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV+AW+ AA SLD QF+
Sbjct  517  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVVAWLGAASSLDKQFS  576



>ref|NP_001043710.1| Os01g0647100 [Oryza sativa Japonica Group]
 dbj|BAD68020.1| putative plastidic ATP/ADP transporter [Oryza sativa Japonica 
Group]
 dbj|BAD68186.1| putative plastidic ATP/ADP transporter [Oryza sativa Japonica 
Group]
 dbj|BAF05624.1| Os01g0647100 [Oryza sativa Japonica Group]
 gb|EAY75169.1| hypothetical protein OsI_03061 [Oryza sativa Indica Group]
Length=642

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P LAT GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  467  ILFGQPLTPMLATMGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  526

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AA SLD QF+
Sbjct  527  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAASSLDKQFS  586



>ref|NP_001140537.1| uncharacterized protein LOC100272602 [Zea mays]
 gb|ACF84037.1| unknown [Zea mays]
 gb|AFW71371.1| hypothetical protein ZEAMMB73_421978 [Zea mays]
Length=594

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P +  FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  409  ILFGEPLTPLMTKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  468

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIVLAW+ A +SLD+QF+
Sbjct  469  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIVLAWLGAVRSLDLQFS  528



>ref|XP_008785487.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic-like [Phoenix 
dactylifera]
Length=670

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            FG PLAP L  FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDED KVKGKA
Sbjct  472  FGEPLAPLLGQFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKGKA  531

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AA+SLD QF+
Sbjct  532  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAARSLDAQFS  589



>gb|KFK42425.1| hypothetical protein AALP_AA2G254500 [Arabis alpina]
Length=626

 Score =   218 bits (556),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  455  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  514

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV+AW+ AAKSL+ QF 
Sbjct  515  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVIAWLGAAKSLEGQFN  574

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALR EEELEKEMERA+++KIP+VS+
Sbjct  575  ALRSEEELEKEMERASSVKIPIVSQ  599



>gb|EAZ12893.1| hypothetical protein OsJ_02814 [Oryza sativa Japonica Group]
Length=619

 Score =   218 bits (556),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P LAT GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  444  ILFGQPLTPMLATMGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  503

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AA SLD QF+
Sbjct  504  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAASSLDKQFS  563



>gb|EAY84955.1| hypothetical protein OsI_06319 [Oryza sativa Indica Group]
Length=630

 Score =   218 bits (556),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P +AT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  445  ILFGEPLTPLMATLGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  504

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIVLAW+ A +SLD QF+
Sbjct  505  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIVLAWLGAVRSLDSQFS  564



>dbj|BAD24996.1| putative plastidic ATP/ADP transporter [Oryza sativa Japonica 
Group]
 dbj|BAD25005.1| putative plastidic ATP/ADP transporter [Oryza sativa Japonica 
Group]
 dbj|BAH01705.1| unnamed protein product [Oryza sativa Japonica Group]
Length=630

 Score =   218 bits (556),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P +AT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  445  ILFGEPLTPLMATLGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  504

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIVLAW+ A +SLD QF+
Sbjct  505  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIVLAWLGAVRSLDSQFS  564



>ref|XP_008681386.1| PREDICTED: uncharacterized protein LOC100272602 isoform X1 [Zea 
mays]
 gb|AFW71369.1| hypothetical protein ZEAMMB73_421978 [Zea mays]
Length=630

 Score =   218 bits (555),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P +  FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  445  ILFGEPLTPLMTKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  504

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIVLAW+ A +SLD+QF+
Sbjct  505  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIVLAWLGAVRSLDLQFS  564



>gb|AAZ23108.1| plastid ATP/ADP transport protein 2 [Manihot esculenta]
Length=623

 Score =   218 bits (554),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP L+ FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDE+TKVKG
Sbjct  447  ILFGGPLAPVLSQFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEETKVKG  506

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG LLVIVL W++AA+SLD Q T
Sbjct  507  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGTLLVIVLLWLAAARSLDTQST  566



>ref|XP_004969309.1| PREDICTED: plastidic ATP/ADP-transporter-like [Setaria italica]
Length=632

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P LAT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  459  ILFGQPLTPMLATMGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  518

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL FGSLANSTPYLGG+LLVIVLAW+ AA SLD QF+
Sbjct  519  KAAIDVVCNPLGKSGGALIQQFMILAFGSLANSTPYLGGILLVIVLAWLGAASSLDKQFS  578



>ref|XP_006646147.1| PREDICTED: plastidic ATP/ADP-transporter-like, partial [Oryza 
brachyantha]
Length=554

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P LAT GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  377  ILFGQPLTPMLATMGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  436

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL FGSLANSTPYLGG+LLVIVLAW+ AA SLD QF+
Sbjct  437  KAAIDVVCNPLGKSGGALIQQFMILAFGSLANSTPYLGGILLVIVLAWLGAASSLDKQFS  496



>ref|XP_010532151.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Tarenaya 
hassleriana]
Length=629

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P+AP LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  456  ILFGGPIAPVLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  515

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LL IV AW++AAKSL+ QF 
Sbjct  516  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGVILLGIVTAWLAAAKSLETQFN  575

Query  394  alrreeelekemeraaalkIPVVSE  468
             LR EEELEKEMERA+++KIPVVS 
Sbjct  576  TLRSEEELEKEMERASSVKIPVVSR  600



>ref|XP_010537959.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic [Tarenaya 
hassleriana]
Length=628

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P+AP LA FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  456  ILFGGPVAPVLAKFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  515

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLG +LL IV AW++AAKSL+ QF 
Sbjct  516  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGIILLGIVTAWLAAAKSLETQFN  575

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALR EEELEKEMERA+++KIPVVS+
Sbjct  576  ALRSEEELEKEMERASSVKIPVVSQ  600



>gb|ADE75734.1| unknown [Picea sitchensis]
Length=416

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  49   PLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAID  228
            PL P L  FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAID
Sbjct  151  PLTPLLGKFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAID  210

Query  229  VVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            VVCNPLGKSGGALIQQF+ILTFGSLANSTPYLG +LLVIV+AW++AA+SLD QFT
Sbjct  211  VVCNPLGKSGGALIQQFLILTFGSLANSTPYLGSILLVIVVAWLAAARSLDSQFT  265



>ref|XP_004951502.1| PREDICTED: plastidic ATP/ADP-transporter-like [Setaria italica]
Length=625

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P +  FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  440  ILFGEPLTPLMTQFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  499

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIVLAW+ A +SLD QF+
Sbjct  500  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIVLAWLGAVRSLDSQFS  559



>ref|XP_010429984.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like isoform 
X3 [Camelina sativa]
Length=463

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  294  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  353

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV AW++AAKSL+ QF 
Sbjct  354  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIVTAWLAAAKSLEGQFN  413

Query  394  alrreeelekemeraaalkIPVVSE  468
            +LR EEELEKEMERA+ +KIPVVS+
Sbjct  414  SLRSEEELEKEMERASTVKIPVVSQ  438



>dbj|BAJ89983.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=620

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            + FG PL P LATFGMTPLLAAV+VGA+QNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  435  LLFGEPLTPLLATFGMTPLLAAVFVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  494

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIV+AW+ A +SLD QF+
Sbjct  495  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIVIAWLGAVRSLDSQFS  554



>ref|XP_010249956.1| PREDICTED: plastidic ATP/ADP-transporter [Nelumbo nucifera]
Length=631

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P +   GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  446  ILFGDPLVPAMGKLGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  505

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV AW++AA SLD QF 
Sbjct  506  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVFAWLAAANSLDTQFN  565

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALR+EEELEKEME+  ALKIPVV++
Sbjct  566  ALRKEEELEKEMEKREALKIPVVAK  590



>ref|XP_009381260.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=666

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            + FG PLAP L + GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDE+ KVKG
Sbjct  467  LLFGEPLAPLLGSLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEEMKVKG  526

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AA+SLD QF+
Sbjct  527  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAARSLDSQFS  586



>ref|XP_002451752.1| hypothetical protein SORBIDRAFT_04g007240 [Sorghum bicolor]
 gb|EES04728.1| hypothetical protein SORBIDRAFT_04g007240 [Sorghum bicolor]
Length=681

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P +  FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  482  ILFGEPLTPLMTKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  541

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIVLAW+ A +SLD QF+
Sbjct  542  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIVLAWLGAVRSLDSQFS  601



>gb|KHG16971.1| ADP,ATP carrier 1, chloroplastic -like protein [Gossypium arboreum]
Length=615

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG  L P LA F MTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  440  ILFGDLLGPALAEFSMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  499

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LL+IV  W+SAAKSLD QFT
Sbjct  500  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLMIVFTWLSAAKSLDTQFT  559



>emb|CDO98099.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P  P+LA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDE+TK+KG
Sbjct  454  ILFGDPFGPSLAKFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEETKIKG  513

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LL+IV AW++AA+SLD QFT
Sbjct  514  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLIIVGAWLAAARSLDGQFT  573



>gb|AAX63195.1| putative plastidic ATP/ADP transporter [Oryza sativa Japonica 
Group]
Length=642

 Score =   216 bits (549),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P LAT GMTPLLAAV VGA+QNIFSKSAKYSLFDPCKEMAYIPLDED KVKG
Sbjct  467  ILFGQPLTPMLATMGMTPLLAAVNVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKG  526

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AA SLD QF+
Sbjct  527  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAASSLDKQFS  586



>gb|EMS68334.1| ADP,ATP carrier protein 1, chloroplastic [Triticum urartu]
Length=552

 Score =   214 bits (544),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +1

Query  43   GAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAA  222
            G PL P LATFGMTPLLAAV+VGA+QNIFSKSAKYSLFDPCKEMAYIPLDED KVKGKAA
Sbjct  374  GEPLTPLLATFGMTPLLAAVFVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKGKAA  433

Query  223  IDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            IDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIV+AW+ A +SLD QF+
Sbjct  434  IDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIVIAWLGAVRSLDSQFS  490



>ref|XP_009407647.1| PREDICTED: plastidic ATP/ADP-transporter-like [Musa acuminata 
subsp. malaccensis]
Length=658

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P L +FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDE+ KVKG
Sbjct  473  ILFGEPLTPLLGSFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEEMKVKG  532

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIVLAW+ AA+SLD QF+
Sbjct  533  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIVLAWLGAARSLDSQFS  592



>gb|EMT25116.1| ADP,ATP carrier protein 1, chloroplastic [Aegilops tauschii]
Length=671

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            FG PL P LATFGMTPLLAAV+VGA+QNIFSKSAKYSLFDPCKEMAYIPLDED KVKGKA
Sbjct  489  FGEPLTPLLATFGMTPLLAAVFVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKGKA  548

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            AIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIV+AW+ A +SLD QF+
Sbjct  549  AIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIVIAWLGAVRSLDSQFS  606



>ref|XP_009388534.1| PREDICTED: plastidic ATP/ADP-transporter-like [Musa acuminata 
subsp. malaccensis]
Length=665

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P L + GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDE+ KVKG
Sbjct  469  ILFGEPLTPLLGSLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEEMKVKG  528

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AA+SLD QF+
Sbjct  529  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAARSLDSQFS  588



>dbj|BAH20416.1| AT1G15500 [Arabidopsis thaliana]
Length=455

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  290  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  349

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLG +LL IV AW++AAKSL+ QF 
Sbjct  350  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGVILLGIVTAWLAAAKSLEGQFN  409

Query  394  alrreeelekemeraaalkIPVVSE  468
             L  EEELE+EMERA+++KIPVVS+
Sbjct  410  TLMSEEELEREMERASSVKIPVVSQ  434



>ref|XP_010459088.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic [Camelina 
sativa]
Length=459

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  294  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  353

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLG +LL IV AW++AAKSL+ QF 
Sbjct  354  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGIILLGIVTAWLAAAKSLEGQFN  413

Query  394  alrreeelekemeraaalkIPVVSE  468
             L  EEELE+E+ERA+++KIPVVS+
Sbjct  414  TLMSEEELEQELERASSVKIPVVSK  438



>ref|XP_010914961.1| PREDICTED: plastidic ATP/ADP-transporter-like [Elaeis guineensis]
Length=658

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP L  FGMTPLLAAVYVGA+QNIFSKS+KYSLFDPCKEMAYIPLDED KVK 
Sbjct  463  ILFGEPLAPLLGKFGMTPLLAAVYVGALQNIFSKSSKYSLFDPCKEMAYIPLDEDMKVKS  522

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVL+W+ AA+SLD QF+
Sbjct  523  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLSWIGAARSLDSQFS  582



>gb|AAX58120.1| plastid ATP/ADP transporter [Oryza sativa Japonica Group]
Length=644

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 111/121 (92%), Gaps = 1/121 (1%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKV-K  210
            I FG PL P LAT GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDED KV K
Sbjct  468  ILFGQPLTPMLATMGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVVK  527

Query  211  GKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            GKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVLAW+ AA SLD QF
Sbjct  528  GKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLAWLGAASSLDKQF  587

Query  391  T  393
            +
Sbjct  588  S  588



>ref|XP_008809354.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic [Phoenix 
dactylifera]
Length=679

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            FG PLAP L   GMTPL+AAVYVGA+QNIFSKS+KYSLFDPCKEMAYIPLDED KVKGKA
Sbjct  481  FGEPLAPLLGKLGMTPLIAAVYVGALQNIFSKSSKYSLFDPCKEMAYIPLDEDMKVKGKA  540

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LL IVLAW+ AAKSLD QF+
Sbjct  541  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLAIVLAWLGAAKSLDSQFS  598



>ref|XP_010429982.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010429983.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=618

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  449  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  508

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV AW++AAKSL+ QF 
Sbjct  509  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIVTAWLAAAKSLEGQFN  568

Query  394  alrreeelekemeraaalkIPVVSE  468
            +LR EEELEKEMERA+ +KIPVVS+
Sbjct  569  SLRSEEELEKEMERASTVKIPVVSQ  593



>ref|XP_010417726.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic [Camelina 
sativa]
Length=618

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  450  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  509

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV AW++AAKSL+ QF 
Sbjct  510  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIVTAWLAAAKSLEGQFN  569

Query  394  alrreeelekemeraaalkIPVVSE  468
            +LR EEELEKEMERA+++KIPVVS+
Sbjct  570  SLRSEEELEKEMERASSVKIPVVSQ  594



>gb|EMS56290.1| Plastidic ATP/ADP-transporter [Triticum urartu]
Length=508

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P LAT+GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLD D K+KG
Sbjct  340  ILFGQPLTPLLATWGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDGDMKLKG  399

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQF+IL FGSLANSTPYLGG+LLVIVLAW+ AA+SLD QF+
Sbjct  400  KAAIDVVCNPLGKSGGALIQQFLILIFGSLANSTPYLGGILLVIVLAWLGAARSLDKQFS  459



>ref|NP_178146.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana]
 sp|Q39002.2|TLC1_ARATH RecName: Full=ADP,ATP carrier protein 1, chloroplastic; AltName: 
Full=ADP/ATP translocase 1; AltName: Full=Adenine nucleotide 
translocase 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG52434.1|AC018848_5 adenine nucleotide translocase; 19474-21800 [Arabidopsis thaliana]
 gb|AAL16246.1|AF428316_1 At1g80300/F5I6_5 [Arabidopsis thaliana]
 dbj|BAE98630.1| adenine nucleotide translocase [Arabidopsis thaliana]
 gb|AEE36385.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana]
Length=624

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  456  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  515

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV AW++AAKSL+ QF 
Sbjct  516  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIVTAWLAAAKSLEGQFN  575

Query  394  alrreeelekemeraaalkIPVVSE  468
            +LR EEELEKEMERA+++KIPVVS+
Sbjct  576  SLRSEEELEKEMERASSVKIPVVSQ  600



>ref|XP_010472951.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Camelina 
sativa]
Length=617

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  448  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  507

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV AW++AAKSL+ QF 
Sbjct  508  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIVTAWLAAAKSLEGQFN  567

Query  394  alrreeelekemeraaalkIPVVSE  468
            +LR EEELEKEMERA+++KIPVVS+
Sbjct  568  SLRSEEELEKEMERASSVKIPVVSQ  592



>emb|CDY39988.1| BnaC06g40660D [Brassica napus]
Length=615

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  450  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  509

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV AW++AAKSL+ QF 
Sbjct  510  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIVTAWLAAAKSLEGQFN  569

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALR EEELEKEMERA+++KIPVVS+
Sbjct  570  ALRSEEELEKEMERASSVKIPVVSQ  594



>ref|XP_009106762.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic [Brassica 
rapa]
Length=614

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  448  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  507

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV AW++AAKSL+ QF 
Sbjct  508  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIVTAWLAAAKSLEGQFN  567

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALR EEELEKEMERA+++KIPVVS+
Sbjct  568  ALRSEEELEKEMERASSVKIPVVSQ  592



>gb|AAK76577.1| putative adenine nucleotide translocase [Arabidopsis thaliana]
Length=624

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  456  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  515

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV AW++AAKSL+ QF 
Sbjct  516  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIVTAWLAAAKSLEGQFN  575

Query  394  alrreeelekemeraaalkIPVVSE  468
            +LR EEELEKEMERA+++KIPVVS+
Sbjct  576  SLRSEEELEKEMERASSVKIPVVSQ  600



>emb|CDX87299.1| BnaA07g35740D [Brassica napus]
Length=614

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  448  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  507

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV AW++AAKSL+ QF 
Sbjct  508  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIVTAWLAAAKSLEGQFN  567

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALR EEELEKEMERA+++KIPVVS+
Sbjct  568  ALRSEEELEKEMERASSVKIPVVSQ  592



>ref|XP_009104454.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Brassica 
rapa]
Length=616

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  448  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  507

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV AW++AAKSL+ QF 
Sbjct  508  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIVTAWLAAAKSLEGQFN  567

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALR EEELEKEMERA+++KIPVVS+
Sbjct  568  ALRSEEELEKEMERASSVKIPVVSQ  592



>emb|CDY57697.1| BnaA07g38360D [Brassica napus]
Length=616

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  448  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  507

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV AW++AAKSL+ QF 
Sbjct  508  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIVTAWLAAAKSLEGQFN  567

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALR EEELEKEMERA+++KIPVVS+
Sbjct  568  ALRSEEELEKEMERASSVKIPVVSQ  592



>ref|XP_002889299.1| chloroplast ADP, ATP carrier protein 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65558.1| chloroplast ADP, ATP carrier protein 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=624

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  456  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  515

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV AW++AAKSL+ QF 
Sbjct  516  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIVTAWLAAAKSLEGQFN  575

Query  394  alrreeelekemeraaalkIPVVSE  468
            +LR EEELEKEMERA+ +KIPVVS+
Sbjct  576  SLRSEEELEKEMERASLVKIPVVSQ  600



>emb|CDX79394.1| BnaC06g19090D [Brassica napus]
Length=616

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  448  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  507

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV AW++AAKSL+ QF 
Sbjct  508  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIVTAWLAAAKSLEGQFN  567

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALR EEELEKEMERA+++KIPVVS+
Sbjct  568  ALRSEEELEKEMERASSVKIPVVSQ  592



>emb|CAA89201.2| adenine nucleotide translocase [Arabidopsis thaliana]
Length=623

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  455  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  514

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV AW++AAKSL+ QF 
Sbjct  515  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIVTAWLAAAKSLEGQFN  574

Query  394  alrreeelekemeraaalkIPVVSE  468
            +LR EEELEKEMERA+++KIPVVS+
Sbjct  575  SLRSEEELEKEMERASSVKIPVVSQ  599



>ref|XP_006389778.1| hypothetical protein EUTSA_v10018281mg [Eutrema salsugineum]
 dbj|BAJ33695.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27064.1| hypothetical protein EUTSA_v10018281mg [Eutrema salsugineum]
Length=624

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  456  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  515

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV AW++AAKSL+ QF 
Sbjct  516  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGIILLVIVTAWLAAAKSLEGQFN  575

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALR EEELEKE+ERA A+KIPVVS+
Sbjct  576  ALRSEEELEKELERATAVKIPVVSQ  600



>ref|XP_003571578.1| PREDICTED: plastidic ATP/ADP-transporter-like [Brachypodium distachyon]
Length=623

 Score =   213 bits (542),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            FG PL P L  FGMTPLLAAV++GA+QNIFSKSAKYSLFDPCKEMAYIPLDED KVKGKA
Sbjct  440  FGEPLTPLLTKFGMTPLLAAVFIGALQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKGKA  499

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            AIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIVLAW+ A +SLD QF+
Sbjct  500  AIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIVLAWLGAVRSLDSQFS  557



>ref|XP_006300855.1| hypothetical protein CARUB_v10019948mg [Capsella rubella]
 gb|EOA33753.1| hypothetical protein CARUB_v10019948mg [Capsella rubella]
Length=639

 Score =   213 bits (542),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  471  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  530

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV AW++AAKSL+ QF 
Sbjct  531  KAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIVGAWLAAAKSLEGQFN  590

Query  394  alrreeelekemeraaalkIPVVSE  468
            +LR EEELEKEMERA+++KIPVVS+
Sbjct  591  SLRSEEELEKEMERASSVKIPVVSQ  615



>ref|XP_008792130.1| PREDICTED: plastidic ATP/ADP-transporter-like [Phoenix dactylifera]
Length=666

 Score =   213 bits (542),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP L   GMTPLLAAVYVGA+QNIFSKS+KYSLFDPCKEMAYIPLDED KVK 
Sbjct  467  ILFGEPLAPLLGKLGMTPLLAAVYVGALQNIFSKSSKYSLFDPCKEMAYIPLDEDMKVKS  526

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIVL+W+ AA+SLD QF+
Sbjct  527  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIVLSWIGAARSLDSQFS  586



>ref|XP_006307012.1| hypothetical protein CARUB_v10008598mg [Capsella rubella]
 gb|EOA39910.1| hypothetical protein CARUB_v10008598mg [Capsella rubella]
Length=618

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  453  ILFGGPFAPVVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  512

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLG +LL IV AW++AAKSL+ QF 
Sbjct  513  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGIILLGIVTAWLAAAKSLEGQFN  572

Query  394  alrreeelekemeraaalkIPVVSE  468
             L  EEELEKE+ERA+++KIPVVS+
Sbjct  573  TLMSEEELEKELERASSVKIPVVSK  597



>gb|EMT31396.1| Plastidic ATP/ADP-transporter [Aegilops tauschii]
Length=620

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P LAT+GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLD D K+KG
Sbjct  452  ILFGQPLTPLLATWGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDGDMKLKG  511

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQF+IL FGSLANSTPYLGG+LLVIVLAW+ AA+SLD QF+
Sbjct  512  KAAIDVVCNPLGKSGGALIQQFLILIFGSLANSTPYLGGILLVIVLAWLGAARSLDKQFS  571



>ref|XP_010476640.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic-like [Camelina 
sativa]
Length=624

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  458  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  517

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLG +LL IV AW++AAKSL+ QF 
Sbjct  518  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGIILLGIVTAWLAAAKSLEGQFN  577

Query  394  alrreeelekemeraaalkIPVVSE  468
             L  EEELE+E+ERA+++KIPVVS+
Sbjct  578  TLMSEEELEQELERASSVKIPVVSK  602



>ref|XP_002890107.1| hypothetical protein ARALYDRAFT_471751 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66366.1| hypothetical protein ARALYDRAFT_471751 [Arabidopsis lyrata subsp. 
lyrata]
Length=618

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  453  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  512

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLG +LL IV AW++AAKSL+ QF 
Sbjct  513  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGIILLGIVTAWLAAAKSLEGQFN  572

Query  394  alrreeelekemeraaalkIPVVSE  468
             L  EEELEKEMERA+++KIPVVS+
Sbjct  573  TLMSEEELEKEMERASSVKIPVVSQ  597



>ref|XP_010497204.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic-like [Camelina 
sativa]
Length=621

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  456  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  515

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLG +LL IV AW++AAKSL+ QF 
Sbjct  516  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGIILLGIVTAWLAAAKSLEGQFN  575

Query  394  alrreeelekemeraaalkIPVVSE  468
             L  EEELE+E+ERA+++KIPVVS+
Sbjct  576  TLMSEEELEQELERASSVKIPVVSK  600



>ref|NP_173003.1| ADP,ATP carrier protein 2 [Arabidopsis thaliana]
 sp|P92935.2|TLC2_ARATH RecName: Full=ADP,ATP carrier protein 2, chloroplastic; AltName: 
Full=ADP/ATP translocase 2; AltName: Full=Adenine nucleotide 
translocase 2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF71976.1|AC013453_1 Putative adenine nucleotide translocase [Arabidopsis thaliana]
 gb|AAL91239.1| putative adenine nucleotide translocase [Arabidopsis thaliana]
 gb|AAM60955.1| adenine nucleotide translocase, putative [Arabidopsis thaliana]
 gb|AAM91244.1| putative adenine nucleotide translocase [Arabidopsis thaliana]
 emb|CAA64329.2| AATP2 protein [Arabidopsis thaliana]
 gb|AEE29330.1| TLC ATP/ADP transporter [Arabidopsis thaliana]
Length=618

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  453  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  512

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLG +LL IV AW++AAKSL+ QF 
Sbjct  513  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGVILLGIVTAWLAAAKSLEGQFN  572

Query  394  alrreeelekemeraaalkIPVVSE  468
             L  EEELE+EMERA+++KIPVVS+
Sbjct  573  TLMSEEELEREMERASSVKIPVVSQ  597



>ref|XP_003569451.1| PREDICTED: plastidic ATP/ADP-transporter-like [Brachypodium distachyon]
Length=632

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL P LAT GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLD D K+KG
Sbjct  455  ILFGQPLTPMLATMGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDGDMKLKG  514

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQF+IL FGSLANSTPYLGG+LL+IVLAW+ AA SLD QF+
Sbjct  515  KAAIDVVCNPLGKSGGALIQQFLILIFGSLANSTPYLGGILLIIVLAWLRAASSLDKQFS  574



>emb|CDY36568.1| BnaA06g10210D [Brassica napus]
Length=610

 Score =   209 bits (533),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  445  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  504

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLG +LL IV AW++AAKSL+ QF 
Sbjct  505  KAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGVILLGIVTAWLAAAKSLEGQFN  564

Query  394  alrreeelekemeraaalkIPVVSE  468
             L  EEELEKEMERA++LKIPVVS+
Sbjct  565  TLMSEEELEKEMERASSLKIPVVSQ  589



>ref|XP_009148947.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic [Brassica 
rapa]
Length=609

 Score =   209 bits (533),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  444  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  503

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLG +LL IV AW++AAKSL+ QF 
Sbjct  504  KAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGVILLGIVTAWLAAAKSLEGQFN  563

Query  394  alrreeelekemeraaalkIPVVSE  468
             L  EEELEKEMERA++LKIPVVS+
Sbjct  564  TLMSEEELEKEMERASSLKIPVVSQ  588



>ref|XP_010925128.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic [Elaeis guineensis]
Length=745

 Score =   211 bits (537),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            + FG  L P L   GMTPL+AAVYVGA+QNIFSKS+KYSLFDPCKEMAYIPLDED KVKG
Sbjct  545  LLFGETLTPLLGKLGMTPLIAAVYVGALQNIFSKSSKYSLFDPCKEMAYIPLDEDMKVKG  604

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LL IVLAW+ AAKSLD QF+
Sbjct  605  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLAIVLAWLGAAKSLDSQFS  664



>ref|XP_006416899.1| hypothetical protein EUTSA_v10007090mg [Eutrema salsugineum]
 gb|ESQ35252.1| hypothetical protein EUTSA_v10007090mg [Eutrema salsugineum]
Length=618

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  453  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  512

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLG +LL IV AW++AAKSL+ QF 
Sbjct  513  KAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGVILLGIVTAWLAAAKSLEGQFN  572

Query  394  alrreeelekemeraaalkIPVVSE  468
             L  EEELEKEMERA++LKIPVVS+
Sbjct  573  TLMSEEELEKEMERASSLKIPVVSQ  597



>emb|CDY39658.1| BnaC05g11870D [Brassica napus]
Length=614

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  449  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  508

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLG +LL IV AW++AAKSL+ QF 
Sbjct  509  KAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGVILLGIVTAWLAAAKSLEGQFN  568

Query  394  alrreeelekemeraaalkIPVVSE  468
             L  EEELEKEMERA++LKIPVVS+
Sbjct  569  TLMSEEELEKEMERASSLKIPVVSQ  593



>ref|XP_008657814.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic-like [Zea 
mays]
Length=650

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 111/136 (82%), Gaps = 16/136 (12%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKV--  207
            I FG PL P LAT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDED KV  
Sbjct  456  ILFGQPLTPMLATMGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVFS  515

Query  208  --------------KGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVI  345
                          KGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVI
Sbjct  516  SNHVKEICLVPSFVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVI  575

Query  346  VLAWMSAAKSLDVQFT  393
            VLAW+ AA SLD QF+
Sbjct  576  VLAWLGAASSLDKQFS  591



>emb|CDX83974.1| BnaC08g16710D [Brassica napus]
Length=609

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  444  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  503

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLG +LL IV AW++AAKSL+ QF 
Sbjct  504  KAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGVILLGIVTAWLAAAKSLEGQFN  563

Query  394  alrreeelekemeraaalkIPVVSE  468
             L  EEELEKEMERAA+LKIPVVS 
Sbjct  564  TLMSEEELEKEMERAASLKIPVVSS  588



>emb|CDX96838.1| BnaA08g23810D [Brassica napus]
Length=612

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  447  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  506

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLG +LL IV AW++AAKSL+ QF 
Sbjct  507  KAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGVILLGIVTAWLAAAKSLEGQFN  566

Query  394  alrreeelekemeraaalkIPVVSE  468
             L  EEELEKEMERAA+LKIPVVS 
Sbjct  567  TLMSEEELEKEMERAASLKIPVVSS  591



>ref|XP_009110479.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic-like [Brassica 
rapa]
 ref|XP_009110480.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic-like [Brassica 
rapa]
Length=610

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  445  ILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  504

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLG +LL IV AW++AAKSL+ QF 
Sbjct  505  KAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGVILLGIVTAWLAAAKSLEGQFN  564

Query  394  alrreeelekemeraaalkIPVVSE  468
             L  EEELEKEMERAA+LKIPVVS 
Sbjct  565  TLMSEEELEKEMERAASLKIPVVSS  589



>ref|XP_010279263.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Nelumbo 
nucifera]
Length=681

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I F   LAP     G+TPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDE+TKVKG
Sbjct  445  ILFSDQLAPLFVKLGLTPLLAAVYVGAVQNIFSKSAKYSLFDPCKEMAYIPLDEETKVKG  504

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQF+ILTFGSL+NSTPYLGG+LL+IVLAW++AA+SLD QFT
Sbjct  505  KAAIDVVCNPLGKSGGALIQQFLILTFGSLSNSTPYLGGILLIIVLAWLAAARSLDRQFT  564



>gb|ADE77264.1| unknown [Picea sitchensis]
Length=310

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +1

Query  52   LAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDV  231
            L P +A FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAA+DV
Sbjct  108  LTPMMAKFGVTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAVDV  167

Query  232  VCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            VCNPLGKSGGALIQQ +IL FGSLANSTPYLG +LL  V++W+ AA+SLD QFT
Sbjct  168  VCNPLGKSGGALIQQVLILGFGSLANSTPYLGVILLATVISWLYAARSLDQQFT  221



>gb|KHN22476.1| ADP,ATP carrier protein 1, chloroplastic [Glycine soja]
Length=616

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P+AP +A FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  446  ILFGGPIAPVIAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  505

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVL W+SAAKSLD QFT
Sbjct  506  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLVWLSAAKSLDTQFT  565

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALRREEELEKEMERAAA+KIPVV++
Sbjct  566  ALRREEELEKEMERAAAVKIPVVAK  590



>ref|XP_003546196.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Glycine 
max]
Length=617

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG P+AP +A FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  447  ILFGGPIAPVIAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  506

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVL W+SAAKSLD QFT
Sbjct  507  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLVWLSAAKSLDTQFT  566

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALRREEELEKEMERAAA+KIPVV++
Sbjct  567  ALRREEELEKEMERAAAVKIPVVAK  591



>ref|XP_002990822.1| hypothetical protein SELMODRAFT_21240, partial [Selaginella moellendorffii]
 gb|EFJ08095.1| hypothetical protein SELMODRAFT_21240, partial [Selaginella moellendorffii]
Length=489

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F  PL P L   G+TPL+AAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA
Sbjct  364  FSDPLTPFLGGIGLTPLMAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  423

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            AIDVVCNPLGKSGGALIQQ +IL+FGSLA+STPYLG +LLVIVLAW+ AA+SLD QFT
Sbjct  424  AIDVVCNPLGKSGGALIQQVLILSFGSLASSTPYLGAILLVIVLAWLGAARSLDKQFT  481



>gb|AAL10405.1|AF416339_1 ADP/ATP translocase [Medicago sativa]
Length=105

 Score =   187 bits (476),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/97 (95%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  52   LAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDV  231
            +AP LA+ GMTPLL AVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDV
Sbjct  1    IAPGLASIGMTPLLTAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDV  60

Query  232  VCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLV  342
            VCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLV
Sbjct  61   VCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLV  97



>ref|XP_002974477.1| hypothetical protein SELMODRAFT_101296 [Selaginella moellendorffii]
 gb|EFJ24699.1| hypothetical protein SELMODRAFT_101296 [Selaginella moellendorffii]
Length=629

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            + F  PL P L   G+TPL+AAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  453  VLFSDPLTPFLGGIGLTPLMAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  512

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQ +IL+FGSL++STPYLG +LLVIVLAW+ AA+SLD QFT
Sbjct  513  KAAIDVVCNPLGKSGGALIQQVLILSFGSLSSSTPYLGAILLVIVLAWLGAARSLDKQFT  572



>ref|XP_006838934.1| hypothetical protein AMTR_s00002p00270350 [Amborella trichopoda]
 gb|ERN01503.1| hypothetical protein AMTR_s00002p00270350 [Amborella trichopoda]
Length=710

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            + F  PL P L   G+TPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDE+TKVKG
Sbjct  449  VLFSDPLTPILGKLGLTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDENTKVKG  508

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQF+ILT GSLANSTPYLG +LL I LAW+ AA+SLD QFT
Sbjct  509  KAAIDVVCNPLGKSGGALIQQFLILTCGSLANSTPYLGVMLLAITLAWLGAARSLDKQFT  568



>ref|XP_008228630.1| PREDICTED: plastidic ATP/ADP-transporter-like [Prunus mume]
Length=621

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL+P + + GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  448  ILFGGPLSPAITSLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  507

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLL+IVLAW+ AA+SLD QFT
Sbjct  508  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLLIVLAWLGAARSLDTQFT  567



>ref|XP_007217627.1| hypothetical protein PRUPE_ppa002937mg [Prunus persica]
 gb|EMJ18826.1| hypothetical protein PRUPE_ppa002937mg [Prunus persica]
Length=620

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PL+P + + GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  447  ILFGGPLSPAITSLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  506

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLL+IVLAW+ AA+SLD QFT
Sbjct  507  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLLIVLAWLGAARSLDTQFT  566



>gb|AEZ00863.1| putative ATP-ADP-transporter protein, partial [Elaeis guineensis]
Length=174

 Score =   184 bits (466),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  100  VYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQF  279
            VYVGA+QNIFSKS+KYSLFDPCKEM YIPLDED KVK KAAIDVVCNPLGKSGGALIQQF
Sbjct  1    VYVGALQNIFSKSSKYSLFDPCKEMVYIPLDEDMKVKSKAAIDVVCNPLGKSGGALIQQF  60

Query  280  MILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            MILTFGSLANSTPYLGG+LLVIVL+W+ AA+SLD QF+
Sbjct  61   MILTFGSLANSTPYLGGILLVIVLSWIGAARSLDSQFS  98



>gb|KDO58239.1| hypothetical protein CISIN_1g012495mg [Citrus sinensis]
Length=462

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/97 (96%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            FG PL P LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA
Sbjct  337  FGDPLGPALAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  396

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG  330
            AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG
Sbjct  397  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG  433



>ref|XP_011401420.1| ADP,ATP carrier protein 1, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM28405.1| ADP,ATP carrier protein 1, chloroplastic [Auxenochlorella protothecoides]
Length=592

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F  PL P LA  GMTPL AAV VGA QNIFSKS+KYSLFDPCKEMAYIPLD++TK KGKA
Sbjct  446  FSTPLTPMLAGLGMTPLFAAVLVGAAQNIFSKSSKYSLFDPCKEMAYIPLDDETKTKGKA  505

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            AIDV+CNPLGKSGGALIQQFMI+ FGSLA STPYLG +LLVIV  W++AAK LD +F+
Sbjct  506  AIDVICNPLGKSGGALIQQFMIIGFGSLAASTPYLGIILLVIVAGWIAAAKDLDWRFS  563



>gb|KDD74050.1| TLC ATP/ADP transporter, partial [Helicosporidium sp. ATCC 50920]
Length=487

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F  PL P LA+ G+TPL AAV VGA QNIFSKS+KYSLFDPCKEMAYIPLD +TK KGKA
Sbjct  359  FSVPLTPALASLGLTPLYAAVLVGAAQNIFSKSSKYSLFDPCKEMAYIPLDSETKTKGKA  418

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            AIDV+CNPLGKSGGALIQQFMI+ FGSLA STPYLG +LLVIV  W+ AAK LD +F
Sbjct  419  AIDVICNPLGKSGGALIQQFMIIGFGSLAASTPYLGIILLVIVGGWIVAAKDLDWRF  475



>ref|XP_001773938.1| predicted protein [Physcomitrella patens]
 gb|EDQ61286.1| predicted protein [Physcomitrella patens]
Length=564

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            + F  PL P LA  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDE+TK+KG
Sbjct  411  VLFSTPLTPMLAGLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEETKLKG  470

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQF+IL FGSLA+STPYLG +LL+IVL W+ AA+SLD QFT
Sbjct  471  KAAIDVVCNPLGKSGGALIQQFLILGFGSLASSTPYLGAILLLIVLLWLGAARSLDAQFT  530



>ref|XP_001780035.1| predicted protein [Physcomitrella patens]
 gb|EDQ55138.1| predicted protein [Physcomitrella patens]
Length=606

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            + F  PL P LA  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDE+TK+KG
Sbjct  377  VLFSTPLTPMLAGLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEETKLKG  436

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGGALIQQF+IL FGSLA STPYLG +LL+IVL W+ AA+SLD QFT
Sbjct  437  KAAIDVVCNPLGKSGGALIQQFLILGFGSLATSTPYLGAILLLIVLLWLGAARSLDAQFT  496



>ref|XP_002947450.1| hypothetical protein VOLCADRAFT_79605 [Volvox carteri f. nagariensis]
 gb|EFJ51498.1| hypothetical protein VOLCADRAFT_79605 [Volvox carteri f. nagariensis]
Length=583

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  43   GAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAA  222
            G  + PTLA FGMTPL AAV VGA QN+FSKS+KYSLFDPCKEMAYIPLD++ K KGKAA
Sbjct  440  GDAVKPTLAGFGMTPLYAAVLVGAAQNVFSKSSKYSLFDPCKEMAYIPLDDEVKTKGKAA  499

Query  223  IDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            IDV+CNPLGKSGGALIQQFMI+  GSLA STPYLG +L VI++ W++AA SL+ QFT
Sbjct  500  IDVICNPLGKSGGALIQQFMIIGLGSLAASTPYLGAILCVIIVLWINAAASLNKQFT  556



>ref|XP_005844203.1| hypothetical protein CHLNCDRAFT_56336 [Chlorella variabilis]
 gb|EFN52101.1| hypothetical protein CHLNCDRAFT_56336 [Chlorella variabilis]
Length=589

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F  PL P L   G+TPL AAV VGA QNIFSKS+KYSLFDPCKEMAYIPLD++TK KGKA
Sbjct  441  FSGPLEPGLMALGLTPLYAAVLVGAAQNIFSKSSKYSLFDPCKEMAYIPLDQETKTKGKA  500

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            AIDV+CNPLGKSGGALIQQFMI+ FGSLA STPYLG +LL IV  W+ AAK LD +F
Sbjct  501  AIDVICNPLGKSGGALIQQFMIIGFGSLAASTPYLGLILLGIVAMWIYAAKDLDWRF  557



>ref|XP_005643478.1| ADP/ATP carrier protein [Coccomyxa subellipsoidea C-169]
 gb|EIE18934.1| ADP/ATP carrier protein [Coccomyxa subellipsoidea C-169]
Length=559

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            + F APL P LAT  +TPL+AAV +GA QN+FSKSAKYSLFDPCKEMAYIPLD++T++KG
Sbjct  354  VLFSAPLTPWLATINLTPLMAAVLIGAAQNVFSKSAKYSLFDPCKEMAYIPLDQETQLKG  413

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPLGKSGG+ IQQ MI+ FGSLA STPYLG +LL +V+ W+ AA SL  QFT
Sbjct  414  KAAIDVVCNPLGKSGGSAIQQMMIIGFGSLAASTPYLGVILLGVVVMWIGAAGSLSKQFT  473



>ref|XP_001703733.1| plastidic ADP/ATP translocase [Chlamydomonas reinhardtii]
 gb|EDO96373.1| plastidic ADP/ATP translocase [Chlamydomonas reinhardtii]
Length=577

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  43   GAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAA  222
            G  + P LA +GMTPL AAV VGA QN+FSKS+KYSLFDPCKEMAYIPL+++ K KGKAA
Sbjct  438  GDTVKPALAAWGMTPLYAAVLVGAAQNVFSKSSKYSLFDPCKEMAYIPLEDEVKTKGKAA  497

Query  223  IDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            IDV+CNPLGKSGGALIQQFMI+  GSLA STPYLG +L VI++AW++AA SL+ QFT
Sbjct  498  IDVICNPLGKSGGALIQQFMIIGLGSLAASTPYLGAILCVIIVAWINAAASLNKQFT  554



>ref|XP_005769878.1| hypothetical protein EMIHUDRAFT_451418 [Emiliania huxleyi CCMP1516]
 gb|EOD17449.1| hypothetical protein EMIHUDRAFT_451418 [Emiliania huxleyi CCMP1516]
Length=513

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 94/131 (72%), Gaps = 11/131 (8%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG  L+P +A  G TPL+ AV VGA QNI SKS+KYSLFDPCKEMAYIPLD + K KG
Sbjct  373  ILFGGSLSPLVAALGTTPLMLAVVVGAAQNILSKSSKYSLFDPCKEMAYIPLDAEAKTKG  432

Query  214  KAAIDVV-----------CNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWM  360
            KAA+DV+            NPLGKSGG+L+QQ MI + GSLA STPYL G L VI+  W+
Sbjct  433  KAAVDVIGSELRADRSSTRNPLGKSGGSLLQQAMIFSVGSLAASTPYLAGCLFVIIAVWL  492

Query  361  SAAKSLDVQFT  393
             AA+SL+ QFT
Sbjct  493  RAARSLNTQFT  503



>gb|ABV25594.1| plastid ATP/ADP translocase, partial [Pavlova lutheri]
Length=471

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 92/120 (77%), Gaps = 1/120 (1%)
 Frame = +1

Query  34   IWFGAPLAP-TLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVK  210
            I F   LAP  +   G TPL+ AV  GA QNI SKSAKYSLFDPCKEMAYIPLD ++K K
Sbjct  340  ILFNDALAPWIVRALGTTPLMLAVLCGAAQNILSKSAKYSLFDPCKEMAYIPLDAESKTK  399

Query  211  GKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            GKAA+DV+ NPLGKSGG+LIQQ +I  FGSLA STPYL  +L+V ++ WM AA+SL+V F
Sbjct  400  GKAAVDVIGNPLGKSGGSLIQQALIFGFGSLAASTPYLAAILVVTIVVWMKAARSLNVMF  459



>gb|ABV25597.1| plastid ATP/ADP translocase [Euglena gracilis]
Length=505

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +1

Query  58   PTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVC  237
            P  A  G TPL+ AV +GA QNI SKSAKYSLFDPCKEMAYIPLD ++K KGKAA+DV+ 
Sbjct  378  PITAAIGTTPLMLAVLIGAFQNIMSKSAKYSLFDPCKEMAYIPLDAESKTKGKAAVDVIG  437

Query  238  NPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            NPLGKSGG+ IQQ +I   GSLA STPYLG +L +I++ W+SAA+SL+VQF
Sbjct  438  NPLGKSGGSFIQQGLIFGLGSLAVSTPYLGVILGLIIMGWLSAARSLNVQF  488



>gb|EWM29257.1| plastidic atp adp transporter [Nannochloropsis gaditana]
Length=577

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I F    +P  A  GMTPL+ AV +GA QN+ SKS+KYSLFDPCKEMAYIPLD + K KG
Sbjct  446  IIFNGFFSPVTAALGMTPLMLAVIIGAAQNVLSKSSKYSLFDPCKEMAYIPLDAEQKTKG  505

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            KAAIDV+ NPLGKSGG+ IQQ +IL  GSL+ STPYL G++ +IV AW+ AA SL  QF
Sbjct  506  KAAIDVIGNPLGKSGGSFIQQILILILGSLSASTPYLAGIIFLIVGAWIKAAASLSKQF  564



>ref|XP_005763298.1| hypothetical protein EMIHUDRAFT_465146 [Emiliania huxleyi CCMP1516]
 gb|EOD10869.1| hypothetical protein EMIHUDRAFT_465146 [Emiliania huxleyi CCMP1516]
Length=823

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +1

Query  52   LAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDV  231
             AP L+T G+TPL+ AV+VGA QNI SK+AKYSLFDPCKEMAYIPLD + K KGKAA+DV
Sbjct  347  FAPLLSTVGLTPLMLAVFVGAAQNIVSKAAKYSLFDPCKEMAYIPLDAEEKTKGKAAVDV  406

Query  232  VCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            +  PLGKSGG+L+QQ +I  FGSLA STPYL  +L  I+ AWM AA+SL  QF
Sbjct  407  IGGPLGKSGGSLVQQLLIFGFGSLAASTPYLAVILGGIIFAWMGAARSLSGQF  459



>gb|EJK46221.1| hypothetical protein THAOC_35120 [Thalassiosira oceanica]
Length=561

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F    AP  A+ G TPL+ AV VGA+QNI SKS+KYSLFDPCKEMAYIPLD D+K KGKA
Sbjct  434  FAPFFAPIAASLGTTPLMLAVLVGAVQNILSKSSKYSLFDPCKEMAYIPLDSDSKTKGKA  493

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            A+DV+ NPLGKSGGALIQQ +I   GSLA +TPYL  +L V++L W  A  SL VQF
Sbjct  494  AVDVIGNPLGKSGGALIQQILIFGVGSLAAATPYLACILGVLLLFWYKAVDSLSVQF  550



>emb|CAC80882.1| plastidic ATP/ADP transporter [Galdieria sulphuraria]
Length=671

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   L P +   G TPL+ AV VGA QNI SKS+KYSLFDPCKEMAYIPLD + K KGKA
Sbjct  522  FSRQLHPVVGMLGTTPLMLAVLVGAAQNILSKSSKYSLFDPCKEMAYIPLDAEQKSKGKA  581

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            AIDV+ NP+GKSGG+ IQQ +I   GSLA STPYL  +L VIV  W++AA+SLD QF
Sbjct  582  AIDVIGNPMGKSGGSFIQQGLIFAVGSLAASTPYLAFILFVIVGMWIAAARSLDKQF  638



>ref|XP_005707402.1| ATP:ADP antiporter, AAA family [Galdieria sulphuraria]
 gb|EME30882.1| ATP:ADP antiporter, AAA family [Galdieria sulphuraria]
Length=670

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   L P +   G TPL+ AV VGA QNI SKS+KYSLFDPCKEMAYIPLD + K KGKA
Sbjct  521  FSRQLHPVVGMLGTTPLMLAVLVGAAQNILSKSSKYSLFDPCKEMAYIPLDAEQKSKGKA  580

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            AIDV+ NP+GKSGG+ IQQ +I   GSLA STPYL  +L VIV  W++AA+SLD QF
Sbjct  581  AIDVIGNPMGKSGGSFIQQGLIFAVGSLAASTPYLAFILFVIVGMWIAAARSLDKQF  637



>gb|ABV25604.1| plastid ATP/ADP translocase [Prymnesium parvum]
Length=552

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +1

Query  52   LAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDV  231
             +P +A  G TPL+ AV VGA+QNI SK+AKYSLFDPCKEMAYIPLD++ K KGKAAIDV
Sbjct  430  FSPLVAVLGTTPLMLAVIVGALQNILSKAAKYSLFDPCKEMAYIPLDQEQKTKGKAAIDV  489

Query  232  VCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            +  PLGKSGG+LIQQ +I+  GSLA +TPYL  +L  I+ AW+ AA+SL VQF
Sbjct  490  IGGPLGKSGGSLIQQVLIVAVGSLAAATPYLAVILTAIIGAWILAARSLSVQF  542



>ref|XP_009037704.1| hypothetical protein AURANDRAFT_27252 [Aureococcus anophagefferens]
 gb|EGB07715.1| hypothetical protein AURANDRAFT_27252 [Aureococcus anophagefferens]
Length=558

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  58   PTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVC  237
            P  A  G TPL+ AV+VGA QNI SKS KYSLFDPCKEMAYIPLD + K KGKAA+DV+ 
Sbjct  438  PVAAKLGTTPLMMAVFVGAAQNIASKSTKYSLFDPCKEMAYIPLDAEQKTKGKAAVDVIG  497

Query  238  NPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            NPLGKSGGAL QQ +IL+ GSLA STPYL G L +I+  W+ +AKSL  QF
Sbjct  498  NPLGKSGGALYQQGLILSLGSLAASTPYLAGSLFLIIAFWLKSAKSLAGQF  548



>ref|XP_005781451.1| hypothetical protein EMIHUDRAFT_365981 [Emiliania huxleyi CCMP1516]
 gb|EOD29022.1| hypothetical protein EMIHUDRAFT_365981 [Emiliania huxleyi CCMP1516]
Length=127

 Score =   142 bits (359),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +1

Query  97   AVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQ  276
            AV+VGA QNI SK+AKYSLFDPCKEMAYIPLD + K KGKAA+DV+  PLGKSGG+L+QQ
Sbjct  3    AVFVGAAQNIVSKAAKYSLFDPCKEMAYIPLDAEEKTKGKAAVDVIGGPLGKSGGSLVQQ  62

Query  277  FMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             +I  FGSLA STPYL  +L  I+ AWM AA+SL  QF
Sbjct  63   LLIFGFGSLAASTPYLAVILGGIIFAWMGAARSLSGQF  100



>gb|AES68077.2| plastidic ATP/ADP-transporter-like protein [Medicago truncatula]
Length=595

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 109/145 (75%), Gaps = 22/145 (15%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP +   G+TPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  448  ILFGDPLAPVIGKLGLTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  507

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPL KS                         VLLVI LAW++AAKSLD QFT
Sbjct  508  KAAIDVVCNPLRKSWWC----------------------VLLVIGLAWLAAAKSLDTQFT  545

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALRREEELEKE+ER  A+K+PV++E
Sbjct  546  ALRREEELEKELERETAVKVPVLTE  570



>ref|XP_003597826.1| ATP/ADP transporter [Medicago truncatula]
Length=645

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 109/145 (75%), Gaps = 22/145 (15%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I FG PLAP +   G+TPLLAAVYVGA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  498  ILFGDPLAPVIGKLGLTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  557

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            KAAIDVVCNPL KS                         VLLVI LAW++AAKSLD QFT
Sbjct  558  KAAIDVVCNPLRKSWWC----------------------VLLVIGLAWLAAAKSLDTQFT  595

Query  394  alrreeelekemeraaalkIPVVSE  468
            ALRREEELEKE+ER  A+K+PV++E
Sbjct  596  ALRREEELEKELERETAVKVPVLTE  620



>ref|XP_002184271.1| nucleotide transporter 1 [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC44449.1| nucleotide transporter 1 [Phaeodactylum tricornutum CCAP 1055/1]
Length=610

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 92/121 (76%), Gaps = 1/121 (1%)
 Frame = +1

Query  31   NIWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVK  210
            N++ GA ++P  A  G TPL+ AV +GA QNI SKS+KYSLFDPCKEMAYIPLD+++K K
Sbjct  481  NVFSGA-MSPVAALLGTTPLMLAVLLGAAQNILSKSSKYSLFDPCKEMAYIPLDQESKTK  539

Query  211  GKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            GKAAIDVV NPLGKSGGALIQQ +I   GSLA +TPYL  +L  +V  W+ AA SL  QF
Sbjct  540  GKAAIDVVGNPLGKSGGALIQQVLIFGVGSLAAATPYLAVILAGLVFMWVRAANSLAGQF  599

Query  391  T  393
             
Sbjct  600  N  600



>ref|XP_005536231.1| chloroplast ADP,ATP carrier protein [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAM79945.1| chloroplast ADP,ATP carrier protein [Cyanidioschyzon merolae 
strain 10D]
Length=684

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   L+P +A  G TPL  AV +GA QNI SK +KYSLFDPCKEMAYIPLD ++K KGKA
Sbjct  539  FAKQLSPVVAALGTTPLFLAVLIGAAQNIASKGSKYSLFDPCKEMAYIPLDAESKSKGKA  598

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            AIDV+ NPLGKSGG+ IQQ +I   GSLA STP+L   L  I++ W++AA+SLD QFT
Sbjct  599  AIDVIGNPLGKSGGSFIQQALIFATGSLAASTPFLAVFLASIIIMWLAAARSLDRQFT  656



>emb|CAX16540.1| putative ATP/ADP translocase [Odontella sinensis]
Length=470

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = +1

Query  28   INIWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKV  207
            +NI F     P  A  G TPL+ AV VGA QNI SKS+KYSLFDPCKEMAYIPLD+D+K 
Sbjct  344  LNI-FAPTFVPVAAALGTTPLMLAVLVGAAQNILSKSSKYSLFDPCKEMAYIPLDQDSKT  402

Query  208  KGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQ  387
            KGKAA+DV+ NPLGKSGG+LIQQ +I   GSLA +TPYL  +L V++  W  AA SL  Q
Sbjct  403  KGKAAVDVIGNPLGKSGGSLIQQALIFGVGSLAVATPYLAAILGVLIFFWFKAANSLAGQ  462

Query  388  F  390
            F
Sbjct  463  F  463



>emb|CBJ27353.1| plastidic ATP/ADP transporter [Ectocarpus siliculosus]
Length=643

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I F    +P LA FG TPL+AAV +GA QNI SKS+KYSLFDPCKEMAYI LD + K KG
Sbjct  497  ILFEGAFSPLLAFFGTTPLMAAVLIGAAQNILSKSSKYSLFDPCKEMAYINLDAEQKTKG  556

Query  214  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSL  378
            KAA+DV+ NPLGKSGG+ IQQ +I++ GSL+ STPYL  +L+ I+  W+++AKSL
Sbjct  557  KAAVDVIGNPLGKSGGSFIQQVLIVSLGSLSASTPYLAAILVGIIGVWLTSAKSL  611



>ref|XP_002292665.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED89861.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=566

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  58   PTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVC  237
            P  A+ G TPL+ AV VGA QNI SKS+KYSLFDPCKEMAYIPLD+D+K KGKAA+DVV 
Sbjct  445  PIAASLGTTPLMLAVLVGAAQNILSKSSKYSLFDPCKEMAYIPLDQDSKTKGKAAVDVVG  504

Query  238  NPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            NPLGKSGGA+IQQ +I   GSLA +TP+L G+L V++  W  +  SL  QF
Sbjct  505  NPLGKSGGAMIQQILIFGVGSLAAATPWLAGILGVLLFFWYKSVNSLAGQF  555



>ref|WP_013942850.1| ATPase AAA [Simkania negevensis]
 emb|CCB88383.1| ADP,ATP carrier protein 1 [Simkania negevensis Z]
Length=528

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   L   +A+ G TPL+ AV  G  QNI SKSAKYSLFDP KEMAYIPLD++ KVKGKA
Sbjct  376  FRDNLTGFIASIGTTPLMLAVIFGTAQNIMSKSAKYSLFDPTKEMAYIPLDQEQKVKGKA  435

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            A+DVV   LGKSGGALIQQ +IL  GS+A  TPY+GG+LL I+L W+ AAKSL+ QF
Sbjct  436  AVDVVGARLGKSGGALIQQGLILGLGSIAAMTPYVGGILLFIILMWIIAAKSLNKQF  492



>gb|ABH10983.1| plastid ATP/ADP transporter [Polytomella parva]
Length=564

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 90/114 (79%), Gaps = 4/114 (4%)
 Frame = +1

Query  49   PLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAID  228
            PLAP    FG+TPL AAV VGA+QNIFS+S+KYSLFDPCKEMAYIPLD   + +GKAAID
Sbjct  425  PLAP----FGITPLYAAVLVGALQNIFSRSSKYSLFDPCKEMAYIPLDPVMQAQGKAAID  480

Query  229  VVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            V+ N +GKSGGA +QQ +I+  GSL NSTPY+G +L  I+LAWM +  SL+ QF
Sbjct  481  VMGNLIGKSGGAAVQQTLIVLCGSLNNSTPYIGVLLTGIILAWMRSCVSLNTQF  534



>ref|WP_042102387.1| ATPase AAA [Parachlamydiaceae bacterium HS-T3]
Length=512

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   LA  +++ G +PL  AV  GA QNI SKSAKYSLFDP KEMAYIPLD+++KVKGKA
Sbjct  374  FRDNLAGLISSLGTSPLFLAVMFGAAQNIMSKSAKYSLFDPTKEMAYIPLDQESKVKGKA  433

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            AIDVV   LGKSGG+ +QQ +++ FGS+A  TPY+  +LLVI++AWM A KSL+ QF
Sbjct  434  AIDVVGARLGKSGGSFVQQALLVGFGSIAAITPYVAAILLVIIIAWMYAVKSLNKQF  490



>ref|WP_039356341.1| ATPase AAA [Candidatus Protochlamydia amoebophila]
Length=513

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   LA  +A  G TPL  AV  GA QNI SKSAKYSLFDP KEMAYIPLD+++KVKGKA
Sbjct  376  FKGHLAGYIAALGTTPLFLAVIFGAAQNIMSKSAKYSLFDPTKEMAYIPLDDESKVKGKA  435

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            A+DVV   LGKSGG++IQ   +L FG+LA  TPY+G +L+VI+ AW+ AA+SL  QFT
Sbjct  436  AVDVVGARLGKSGGSIIQM-GLLAFGTLATITPYIGAILMVIIAAWIVAARSLSKQFT  492



>gb|KIC73885.1| ADP,ATP carrier protein 1 [Candidatus Protochlamydia amoebophila]
Length=529

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   LA  +A  G TPL  AV  GA QNI SKSAKYSLFDP KEMAYIPLD+++KVKGKA
Sbjct  392  FKGHLAGYIAALGTTPLFLAVIFGAAQNIMSKSAKYSLFDPTKEMAYIPLDDESKVKGKA  451

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            A+DVV   LGKSGG++IQ   +L FG+LA  TPY+G +L+VI+ AW+ AA+SL  QFT
Sbjct  452  AVDVVGARLGKSGGSIIQM-GLLAFGTLATITPYIGAILMVIIAAWIVAARSLSKQFT  508



>emb|CAE46506.1| nucleotide transport protein [Candidatus Protochlamydia amoebophila 
UWE25]
Length=513

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   LA  +A  G TPL  AV  GA QNI SKSAKYSLFDP KEMAYIPLD+++KVKGKA
Sbjct  376  FKDHLAGYIAALGTTPLFLAVIFGAAQNIMSKSAKYSLFDPTKEMAYIPLDDESKVKGKA  435

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            A+DVV   LGKSGG++IQ   +L FG+LA  TPY+G +L+VI+ AW+ AA+SL  QFT
Sbjct  436  AVDVVGARLGKSGGSIIQM-GLLAFGTLATITPYIGAILMVIIAAWIVAARSLSKQFT  492



>ref|WP_042280868.1| ATPase AAA [Candidatus Protochlamydia sp. R18]
Length=513

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   LA  +A  G TPL  AV  GA QNI SKSAKYSLFDP KEMAYIPLD+++KVKGKA
Sbjct  376  FKDHLAGYIAALGTTPLFLAVIFGAAQNIMSKSAKYSLFDPTKEMAYIPLDDESKVKGKA  435

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            A+DVV   LGKSGG++IQ   +L FG+LA  TPY+G +L+VI+ AW+ AA+SL  QFT
Sbjct  436  AVDVVGARLGKSGGSIIQM-GLLAFGTLATITPYIGAILMVIIAAWIVAARSLSKQFT  492



>ref|WP_011174800.1| ATPase AAA [Candidatus Protochlamydia amoebophila]
 emb|CAF22974.1| probable ADP/ATP translocase [Candidatus Protochlamydia amoebophila 
UWE25]
Length=513

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   LA  +A  G TPL  AV  GA QNI SKSAKYSLFDP KEMAYIPLD+++KVKGKA
Sbjct  376  FKDHLAGYIAALGTTPLFLAVIFGAAQNIMSKSAKYSLFDPTKEMAYIPLDDESKVKGKA  435

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            A+DVV   LGKSGG++IQ   +L FG+LA  TPY+G +L+VI+ AW+ AA+SL  QFT
Sbjct  436  AVDVVGARLGKSGGSIIQM-GLLAFGTLATITPYIGAILMVIIAAWIVAARSLSKQFT  492



>ref|WP_032124907.1| ATPase AAA [Chlamydia sp. 'Diamant']
Length=512

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   L   +A  G TPL  AV  GA QNI SKSAKYSLFDP KEMAYIPLDED+KVKGKA
Sbjct  374  FRDSLLGYIAAIGSTPLFLAVMFGAAQNIMSKSAKYSLFDPTKEMAYIPLDEDSKVKGKA  433

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            A+DVV   LGKSGG++IQ   +L FG+LA  TPY+G +L+VI+  W+ AA+SL  QF
Sbjct  434  AVDVVGARLGKSGGSIIQM-TLLAFGTLATITPYIGAILMVIIAIWIVAARSLSKQF  489



>ref|XP_001693815.1| plastidic ADP/ATP translocase [Chlamydomonas reinhardtii]
 gb|EDP09069.1| plastidic ADP/ATP translocase [Chlamydomonas reinhardtii]
Length=615

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 92/117 (79%), Gaps = 4/117 (3%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F APLA      G TPL+AAV VG++QN+FS+++KYSLFDPCKEMAYIPLD++ K KGKA
Sbjct  462  FAAPLA----AMGTTPLMAAVVVGSLQNVFSRASKYSLFDPCKEMAYIPLDDEIKGKGKA  517

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            A+DVV N +GKSGGA++QQ  I TFGSLA STPYLG  L +I++ W+ A  SL+ QF
Sbjct  518  AVDVVGNLVGKSGGAVLQQAAIFTFGSLAASTPYLGIGLAIIIINWIRAVLSLEKQF  574



>gb|ABV25596.1| plastid ATP/ADP translocase, partial [Pyropia yezoensis]
Length=536

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F    AP +A  G TPL+AAV++GA Q I SK+ KYS FDP KEM YI LDE ++ +GKA
Sbjct  387  FAGQAAPIIALAGTTPLMAAVFIGAAQVIMSKACKYSCFDPSKEMLYISLDETSRNEGKA  446

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            AIDV+ NPLGKSGG+ IQQ +I   GSLA STPYL  +L+ I+  W+ AAKSLD QF+
Sbjct  447  AIDVIGNPLGKSGGSFIQQVLIFGTGSLAASTPYLAVILVGIIGMWLVAAKSLDKQFS  504



>ref|XP_010419393.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like, partial 
[Camelina sativa]
Length=133

 Score =   129 bits (323),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  187  LDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSA  366
            LDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV AW++A
Sbjct  16   LDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIVTAWLAA  75

Query  367  AKSLDVQFTalrreeelekemeraaalkIPVVSE  468
            AKSL+ QF +LR EEELEKEMERA+++KIPVVS+
Sbjct  76   AKSLEGQFNSLRSEEELEKEMERASSVKIPVVSQ  109



>emb|CCB90293.1| ADP,ATP carrier protein 1 [Waddlia chondrophila 2032/99]
Length=312

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   L+  +A  G TPL  AV +G +QNI SKS+KYSLFDP KEMAYIPLD+++KVKGKA
Sbjct  170  FRENLSTYIAALGTTPLFLAVVIGMIQNIMSKSSKYSLFDPTKEMAYIPLDQESKVKGKA  229

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            AIDVV   LGKSGG+LIQQ +++ FG+++  TPY+    + +++ W+ A +SL+ QF
Sbjct  230  AIDVVGARLGKSGGSLIQQGLLVAFGTISAITPYVAIATIAVIIGWLFAVRSLNKQF  286



>emb|CBJ30232.1| plastidic ATP/ADP transporter [Ectocarpus siliculosus]
Length=608

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = +1

Query  46   APLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAI  225
            AP+   L      PL  AV  GA QN+ SKS KYSLFDPCKEMAYIPL ++ K KGKAA+
Sbjct  419  APMQEMLGALSTNPLTLAVLAGAAQNVLSKSCKYSLFDPCKEMAYIPLSQEEKRKGKAAV  478

Query  226  DVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            DV+ NPLGKS G+ +QQ + L  GSL  STPYL GVLL ++  W+ AA SL  +F
Sbjct  479  DVIGNPLGKSTGSFVQQGLFLATGSLQASTPYLAGVLLAVITTWLFAADSLSKKF  533



>ref|WP_039386022.1| ATPase AAA [Neochlamydia sp. TUME1]
 gb|KIC74410.1| ADP,ATP carrier protein 1 [Neochlamydia sp. TUME1]
Length=517

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   LA  ++ FG TPL+ AV  G +QNI SKS KYSLFDP KEMAYIPLD+++KVKGKA
Sbjct  374  FKDHLAGFISYFGTTPLMLAVIFGMIQNIMSKSTKYSLFDPTKEMAYIPLDQESKVKGKA  433

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            AIDVV   LGKSGG+ IQQ +++  GSLA  TPY+  ++   +L W++A +SL+ QF
Sbjct  434  AIDVVGARLGKSGGSFIQQGLLVALGSLAAITPYVAIIMTFFILIWLAAVRSLNRQF  490



>gb|KIC75182.1| ADP,ATP carrier protein 1 [Neochlamydia sp. EPS4]
Length=517

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   LA  ++ FG TPL+ AV  G +QNI SKS KYSLFDP KEMAYIPLD+++KVKGKA
Sbjct  374  FKDHLAGFISYFGTTPLMLAVIFGMIQNIMSKSTKYSLFDPTKEMAYIPLDQESKVKGKA  433

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            AIDVV   LGKSGG+ IQQ +++  GSLA  TPY+  ++   +L W++A +SL+ QF
Sbjct  434  AIDVVGARLGKSGGSFIQQGLLVALGSLAAITPYVAIIMTFFILIWLAAVRSLNRQF  490



>ref|WP_042239794.1| ATPase AAA [Neochlamydia sp. S13]
Length=517

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   LA  ++ FG TPL+ AV  G +QNI SKS KYSLFDP KEMAYIPLD+++KVKGKA
Sbjct  374  FKDHLAGFISYFGTTPLMLAVIFGMIQNIMSKSTKYSLFDPTKEMAYIPLDQESKVKGKA  433

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            AIDVV   LGKSGG+ IQQ +++  GSLA  TPY+  ++   +L W++A +SL+ QF
Sbjct  434  AIDVVGARLGKSGGSFIQQGLLVALGSLAAITPYVAIIMTFFILIWIAAVRSLNRQF  490



>gb|KEI72701.1| ATPase AAA [Endozoicomonas elysicola]
Length=502

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = +1

Query  76   GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLGKS  255
            GM+PL+  V +GA+QNI SKS KYSLFDP KEM+YIPLD + KVKGKAA+DV+ NPLGKS
Sbjct  387  GMSPLMMTVVIGALQNILSKSTKYSLFDPTKEMSYIPLDPEKKVKGKAAVDVIGNPLGKS  446

Query  256  GGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             G+LIQQ +++ FGSL+  TPY+  ++L   + W+++AKSL  +F
Sbjct  447  TGSLIQQVLLVIFGSLSAITPYVAVIVLGFFIVWITSAKSLGTRF  491



>emb|CAE46508.1| nucleotide transport protein [Parachlamydia sp. P9]
Length=335

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   L   +A  G TPL+ AV +G +QNI SKS KYSLFDP KEMAYIPLD+++KVKGKA
Sbjct  209  FRDSLQGYIAMLGTTPLMLAVVIGMIQNIMSKSTKYSLFDPTKEMAYIPLDQESKVKGKA  268

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            AIDVV   LGKSGG+ IQQ +++ FG+++  TPY+    + +++ WM A +SL+ QF
Sbjct  269  AIDVVGARLGKSGGSFIQQGLLVFFGTISAITPYVAVATIAVIVVWMIAVRSLNKQF  325



>ref|WP_041941596.1| ATPase AAA [Waddlia chondrophila]
Length=515

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   L+  +A  G TPL  AV +G +QNI SKS+KYSLFDP KEMAYIPLD+++KVKGKA
Sbjct  373  FRENLSTYIAALGTTPLFLAVVIGMIQNIMSKSSKYSLFDPTKEMAYIPLDQESKVKGKA  432

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            AIDVV   LGKSGG+LIQQ +++ FG+++  TPY+    + +++ W+ A +SL+ QF
Sbjct  433  AIDVVGARLGKSGGSLIQQGLLVAFGTISAITPYVAIATIAVIIGWLFAVRSLNKQF  489



>gb|ADI39022.1| ADP/ATP translocase [Waddlia chondrophila WSU 86-1044]
Length=502

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   L+  +A  G TPL  AV +G +QNI SKS+KYSLFDP KEMAYIPLD+++KVKGKA
Sbjct  360  FRENLSTYIAALGTTPLFLAVVIGMIQNIMSKSSKYSLFDPTKEMAYIPLDQESKVKGKA  419

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            AIDVV   LGKSGG+LIQQ +++ FG+++  TPY+    + +++ W+ A +SL+ QF
Sbjct  420  AIDVVGARLGKSGGSLIQQGLLVAFGTISAITPYVAIATIAVIIGWLFAVRSLNKQF  476



>ref|WP_041018366.1| ATPase AAA [Criblamydia sequanensis]
 emb|CDR34749.1| ADP/ATP translocase [Criblamydia sequanensis CRIB-18]
Length=511

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   L   +   G TPL  AV  G  QNI SKS+KYSLFDP KEM+YIPLD++ KVKGKA
Sbjct  375  FSDSLQHYITMLGTTPLFLAVMFGTAQNIMSKSSKYSLFDPTKEMSYIPLDQEAKVKGKA  434

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            AIDVV   LGKSGG+LIQQ +++ FGSLA  TPY+   ++  ++ W+ A KSL+ QF
Sbjct  435  AIDVVGARLGKSGGSLIQQILLVGFGSLAAITPYIAICMIATIIVWLFAVKSLNKQF  491



>gb|AFS19476.1| ADP/ATP carrier protein [Chlamydia psittaci 84/55]
Length=220

 Score =   127 bits (320),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  73   VAMFGTTPLMLAVMVGAVQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  132

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TPYL   L VI+  W+ +A  L+  F
Sbjct  133  FGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFVIIAIWLVSATKLNKLF  181



>emb|CAX16542.1| putative ATP/ADP translocase, partial [Cyanophora paradoxa]
Length=333

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +1

Query  58   PTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVC  237
            P    FG++PL+ AV+ GA QNI SK+ KYSLFDP KEMAYIPLD +TKVKGKAAIDVV 
Sbjct  233  PVTQMFGISPLMLAVFCGAAQNILSKATKYSLFDPTKEMAYIPLDPETKVKGKAAIDVVG  292

Query  238  NPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWM  360
              LGKSGGA +QQ +I++ GSL+ STP L    LV++L W+
Sbjct  293  ARLGKSGGAFLQQVLIVSLGSLSASTPVLAACFLVVILMWV  333



>ref|WP_006340593.1| ATPase AAA [Parachlamydia acanthamoebae]
 gb|AAQ06407.1| ADP-ATP translocase [Parachlamydia acanthamoebae str. Hall's 
coccus]
 gb|EFB42215.1| ADP/ATP translocase [Parachlamydia acanthamoebae str. Hall's 
coccus]
 emb|CCB85168.1| ADP,ATP carrier protein 1 [Parachlamydia acanthamoebae UV-7]
 gb|KIA76370.1| ADP,ATP carrier protein 1 [Parachlamydia acanthamoebae]
Length=517

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   L   +A  G TPL+ AV +G +QNI SKS KYSLFDP KEMAYIPLD+++KVKGKA
Sbjct  374  FRDSLQGYIAMLGTTPLMLAVVIGMIQNIMSKSTKYSLFDPTKEMAYIPLDQESKVKGKA  433

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            AIDVV   LGKSGG+ IQQ +++ FG+++  TPY+    + +++ WM A +SL+ QF
Sbjct  434  AIDVVGARLGKSGGSFIQQGLLVFFGTISAITPYVAVATIAVIVVWMIAVRSLNKQF  490



>emb|CAE46505.1| nucleotide transport protein [endosymbiont of Acanthamoeba sp. 
TUME1]
Length=470

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = +1

Query  40   FGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKA  219
            F   LA  ++ FG   ++ AV  G +QNI SKS KYSLFDP KEMAYIPLD+++KVKGKA
Sbjct  327  FKDHLAGFISYFGTHSIMLAVIFGMIQNIMSKSTKYSLFDPTKEMAYIPLDQESKVKGKA  386

Query  220  AIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            AIDVV   LGKSGG+ IQQ +++  GSLA  TPY+  ++   +L W++A +SL+ QF
Sbjct  387  AIDVVGARLGKSGGSFIQQGLLVALGSLAAITPYVAIIMTFFILIWLAAVRSLNRQF  443



>gb|EPP36943.1| ADP,ATP carrier protein, partial [Chlamydia psittaci 84-8471/1]
Length=289

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  142  VAMFGTTPLMLAVMVGAVQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  201

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TPYL   L VI+  W+ +A  L+  F
Sbjct  202  FGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFVIIAIWLVSATKLNKLF  250



>ref|WP_014517776.1| ATPase AAA [Chlamydia pneumoniae]
 gb|ACZ33326.1| ADP/ATP carrier protein family [Chlamydophila pneumoniae LPCoLN]
 gb|ETR80236.1| ADP/ATP Translocase, NTT1 [Chlamydia pneumoniae B21]
Length=526

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  386  VAMFGTTPLMLAVVVGAIQNILSKSTKYALFDSTKEMAYIPLDQEQKVKGKAAIDVVAAR  445

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGGALIQQ +++  GS+   TPYL  +LL I+  W+ +A  L+  F
Sbjct  446  FGKSGGALIQQGLLVICGSIGAMTPYLAVILLFIIAIWLVSATKLNKLF  494



>ref|WP_010882994.1| ATPase AAA [Chlamydia pneumoniae]
 ref|NP_224551.1| ADP/ATP translocase [Chlamydophila pneumoniae CWL029]
 ref|NP_444957.1| ADP, ATP carrier protein [Chlamydophila pneumoniae AR39]
 sp|Q9Z8J2.1|TLC1_CHLPN RecName: Full=ADP,ATP carrier protein 1; AltName: Full=ADP/ATP 
translocase 1 [Chlamydia pneumoniae]
 gb|AAD18495.1| ADP/ATP Translocase [Chlamydophila pneumoniae CWL029]
 gb|AAF38252.1| ADP, ATP carrier protein [Chlamydophila pneumoniae AR39]
 gb|AAP98290.1| ATP/ADP-transporter [Chlamydophila pneumoniae TW-183]
Length=515

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  386  VAMFGTTPLMLAVVVGAIQNILSKSTKYALFDSTKEMAYIPLDQEQKVKGKAAIDVVAAR  445

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGGALIQQ +++  GS+   TPYL  +LL I+  W+ +A  L+  F
Sbjct  446  FGKSGGALIQQGLLVICGSIGAMTPYLAVILLFIIAIWLVSATKLNKLF  494



>ref|WP_010895317.1| ATPase AAA [Chlamydia pneumoniae]
 dbj|BAA98559.1| ADP/ATP translocase [Chlamydophila pneumoniae J138]
Length=515

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  386  VAMFGTTPLMLAVVVGAIQNILSKSTKYALFDSTKEMAYIPLDQEQKVKGKAAIDVVAAR  445

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGGALIQQ +++  GS+   TPYL  +LL I+  W+ +A  L+  F
Sbjct  446  FGKSGGALIQQGLLVICGSIGAMTPYLAVILLFIIAIWLVSATKLNKLF  494



>gb|EKE09902.1| hypothetical protein ACD_16C00100G0064 [uncultured bacterium]
Length=505

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = +1

Query  34   IWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  213
            I F   L   L  FG+T LL AVYVGA+QNI  KS KYSLFDP KEM YIPLD++ KVKG
Sbjct  376  ILFKDYLEGLLLLFGVTSLLMAVYVGAIQNILGKSMKYSLFDPTKEMTYIPLDQELKVKG  435

Query  214  KAAIDVVCNPLGKSGGALIQQF-MILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLD  381
            KAA+DV+ +  GKS G +IQ F +ILT G+     PYL GVL+ I+L WM A K L 
Sbjct  436  KAAVDVIFSRFGKSSGGIIQIFLLILTAGTQMTIMPYLSGVLIFIMLIWMGAVKGLS  492



>gb|EPP28844.1| ADP,ATP carrier protein [Chlamydia psittaci 08-2626_L3]
Length=454

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  307  VAMFGTTPLMLAVMVGAVQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  366

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TPYL   L VI+  W+ +A  L+  F
Sbjct  367  FGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFVIIAIWLVSATKLNKLF  415



>ref|WP_011458125.1| ATPase AAA [Chlamydophila felis]
 dbj|BAE81345.1| ADP/ATP translocase [Chlamydophila felis Fe/C-56]
Length=530

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  385  VAMFGTTPLMLAVVVGAIQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  444

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TPYL  +L  I+  W+ +AK L+  F
Sbjct  445  FGKSGGSLIQQGLLVVCGSIGAMTPYLAVILFGIISIWLVSAKKLNKLF  493



>ref|WP_033402749.1| ATPase AAA, partial [Endozoicomonas elysicola]
Length=484

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  76   GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLGKS  255
            GM+PL+  V +GA+QNI SKS KYSLFDP KEM+YIPLD + KVKGKAA+DV+ NPLGKS
Sbjct  387  GMSPLMMTVVIGALQNILSKSTKYSLFDPTKEMSYIPLDPEKKVKGKAAVDVIGNPLGKS  446

Query  256  GGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAA  369
             G+LIQQ +++ FGSL+  TPY+  ++L   + W+++A
Sbjct  447  TGSLIQQVLLVIFGSLSAITPYVAVIVLGFFIVWITSA  484



>ref|WP_032742269.1| ATPase AAA, partial [Chlamydia psittaci]
Length=469

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  322  VAMFGTTPLMLAVMVGAVQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  381

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TPYL   L VI+  W+ +A  L+  F
Sbjct  382  FGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFVIIAIWLVSATKLNKLF  430



>gb|EPJ16785.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC22]
Length=500

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  353  VAMFGTTPLMLAVMVGAVQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  412

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TPYL   L VI+  W+ +A  L+  F
Sbjct  413  FGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFVIIAIWLVSATKLNKLF  461



>ref|WP_006343113.1| ATPase AAA [Chlamydia psittaci]
 ref|YP_004064394.1| ADP/ATP carrier protein [Chlamydia psittaci RD1]
 emb|CBY16956.1| ADP/ATP carrier protein [Chlamydia psittaci RD1]
 gb|EGF85036.1| ADP/ATP carrier protein [Chlamydia psittaci Cal10]
 gb|AEG85482.1| ADP/ATP carrier protein [Chlamydia psittaci C19/98]
 gb|AEG86461.1| ADP/ATP carrier protein [Chlamydia psittaci 01DC11]
 gb|AEG87435.1| ADP/ATP carrier protein [Chlamydia psittaci 02DC15]
 gb|AEG88411.1| ADP/ATP carrier protein [Chlamydia psittaci 08DC60]
 gb|EPJ13171.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC16]
 gb|EPJ14902.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC15]
 gb|EPJ15526.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC18]
 gb|EPJ18880.1| ADP,ATP carrier protein [Chlamydia psittaci 01DC11]
 gb|EPJ20128.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC21]
 gb|EPJ21222.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC23]
 gb|EPJ21971.1| ADP,ATP carrier protein [Chlamydia psittaci 04DC42]
 gb|EPJ23230.1| ADP,ATP carrier protein [Chlamydia psittaci 03DC29]
 gb|EPJ24421.1| ADP,ATP carrier protein [Chlamydia psittaci 08DC60]
 gb|EPJ29395.1| ADP,ATP carrier protein [Chlamydia psittaci C19/98]
 gb|EPJ30143.1| ADP,ATP carrier protein [Chlamydia psittaci 03DC35]
 gb|EPJ97988.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC14]
 gb|EPL00331.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC24]
 gb|EPP33497.1| ADP,ATP carrier protein [Chlamydia psittaci C6/98]
Length=532

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  385  VAMFGTTPLMLAVMVGAVQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  444

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TPYL   L VI+  W+ +A  L+  F
Sbjct  445  FGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFVIIAIWLVSATKLNKLF  493



>ref|WP_021756588.1| ADP/ATP carrier protein [Chlamydia pecorum]
 gb|AGW37916.1| ADP/ATP carrier protein [Chlamydia pecorum PV3056/3]
Length=533

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  385  VAMFGTTPLMLAVIVGAIQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  444

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGGALIQQ +++  GS+   TP+L  +L +I+  W+ +A  L+  F
Sbjct  445  FGKSGGALIQQGLLVVCGSIGAMTPHLAIILFLIIAVWLVSATKLNKLF  493



>ref|WP_021757805.1| ADP/ATP carrier protein [Chlamydia pecorum]
 gb|AGW39762.1| ADP/ATP carrier protein [Chlamydia pecorum P787]
 gb|ETF37490.1| ADP,ATP carrier protein 1 [Chlamydia pecorum VR629]
 gb|ETF37998.1| ADP,ATP carrier protein 1 [Chlamydia pecorum DBDeUG]
 gb|ETF38266.1| ADP,ATP carrier protein 1 [Chlamydia pecorum MC/MarsBar]
 gb|ETF40232.1| ADP,ATP carrier protein 1 [Chlamydia pecorum IPTaLE]
Length=533

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  385  VAMFGTTPLMLAVIVGAIQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  444

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGGALIQQ +++  GS+   TP+L  +L +I+  W+ +A  L+  F
Sbjct  445  FGKSGGALIQQGLLVVCGSIGAMTPHLAIILFLIIAVWLVSATKLNKLF  493



>ref|WP_013747357.1| ATPase AAA [Chlamydia psittaci]
 gb|ADZ18583.1| ADP/ATP carrier protein [Chlamydia psittaci 6BC]
 gb|AEB55460.1| ADP, ATP carrier protein [Chlamydia psittaci 6BC]
 gb|AFS20568.1| ADP/ATP carrier family protein [Chlamydia psittaci GR9]
 gb|AFS21220.1| ADP/ATP carrier family protein [Chlamydia psittaci MN]
 gb|AFS22669.1| ADP/ATP carrier family protein [Chlamydia psittaci VS225]
 gb|AFS24249.1| ADP/ATP carrier family protein [Chlamydia psittaci WS/RT/E30]
 gb|AFS25137.1| ADP/ATP carrier family protein [Chlamydia psittaci M56]
 gb|AFS25886.1| ADP/ATP carrier family protein [Chlamydia psittaci WC]
 gb|AFS26909.1| ADP/ATP carrier family protein [Chlamydia psittaci CP3]
 gb|AFS27997.1| ADP/ATP carrier family protein [Chlamydia psittaci NJ1]
 emb|CCO01942.1| ADP/ATP carrier protein [Chlamydia psittaci 01DC12]
 gb|AGE75021.1| ADP/ATP carrier protein [Chlamydia psittaci Mat116]
 gb|EPJ24811.1| ADP,ATP carrier protein [Chlamydia psittaci 09DC77]
 gb|EPJ26367.1| ADP,ATP carrier protein [Chlamydia psittaci 09DC80]
 gb|EPJ27592.1| ADP,ATP carrier protein [Chlamydia psittaci 99DC5]
 gb|EPJ29787.1| ADP,ATP carrier protein [Chlamydia psittaci 09DC78]
 gb|EPL01129.1| ADP,ATP carrier protein [Chlamydia psittaci 09DC79]
 gb|EPP31854.1| ADP,ATP carrier protein [Chlamydia psittaci C1/97]
Length=532

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  385  VAMFGTTPLMLAVMVGAVQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  444

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TPYL   L VI+  W+ +A  L+  F
Sbjct  445  FGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFVIIAIWLVSATKLNKLF  493



>ref|WP_013712807.1| ATPase AAA [Chlamydia pecorum]
 gb|AEB41729.1| ADP,ATP carrier protein 1 [Chlamydophila pecorum E58]
 gb|AGW38837.1| ADP/ATP carrier protein [Chlamydia pecorum W73]
Length=533

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  385  VAMFGTTPLMLAVIVGAIQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  444

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGGALIQQ +++  GS+   TP+L  +L +I+  W+ +A  L+  F
Sbjct  445  FGKSGGALIQQGLLVVCGSIGAMTPHLAIILFLIIAVWLVSATKLNKLF  493



>gb|EPJ33718.1| ADP/ATP carrier family protein, partial [Chlamydia psittaci 06-1683]
Length=510

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  385  VAMFGTTPLMLAVMVGAVQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  444

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TPYL   L VI+  W+ +A  L+  F
Sbjct  445  FGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFVIIAIWLVSATKLNKLF  493



>ref|WP_032741515.1| ATPase AAA [Chlamydia psittaci]
Length=545

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  398  VAMFGTTPLMLAVMVGAVQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  457

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TPYL   L VI+  W+ +A  L+  F
Sbjct  458  FGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFVIIAIWLVSATKLNKLF  506



>ref|WP_011006397.1| ATPase AAA [Chlamydophila caviae]
 gb|AAP05181.1| ADP, ATP carrier protein [Chlamydophila caviae GPIC]
Length=533

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +AT G TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  385  VATLGTTPLMLAVMVGAIQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  444

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TPYL   L +I+  W+ +A  L+  F
Sbjct  445  FGKSGGSLIQQSLLVVCGSIGAMTPYLAIALFLIIAVWLVSATKLNKLF  493



>ref|WP_006344068.1| ATPase AAA [Chlamydophila abortus]
 gb|EGK69188.1| ADP/ATP carrier protein [Chlamydophila abortus LLG]
Length=532

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  385  VAMFGTTPLMLAVMVGAIQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  444

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TPYL   L +I+  W+ +A  L+  F
Sbjct  445  FGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFLIIAVWLVSATKLNKLF  493



>ref|WP_011097058.1| ATPase AAA [Chlamydophila abortus]
 emb|CAH63874.1| ADP/ATP carrier protein [Chlamydophila abortus S26/3]
 emb|CED80479.1| ADP/ATP carrier protein [Chlamydophila abortus]
Length=532

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  385  VAMFGTTPLMLAVMVGAIQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  444

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TPYL   L +I+  W+ +A  L+  F
Sbjct  445  FGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFLIIAVWLVSATKLNKLF  493



>ref|XP_007023974.1| TLC ATP/ADP transporter isoform 2 [Theobroma cacao]
 gb|EOY26596.1| TLC ATP/ADP transporter isoform 2 [Theobroma cacao]
Length=501

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +1

Query  193  EDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAK  372
            +  +VKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAW+SAAK
Sbjct  379  KSKQVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLSAAK  438

Query  373  SLDVQFT  393
            SLD QFT
Sbjct  439  SLDTQFT  445



>ref|XP_005769576.1| hypothetical protein EMIHUDRAFT_244401 [Emiliania huxleyi CCMP1516]
 gb|EOD17147.1| hypothetical protein EMIHUDRAFT_244401 [Emiliania huxleyi CCMP1516]
Length=229

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 73/109 (67%), Gaps = 11/109 (10%)
 Frame = +1

Query  100  VYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVV-----------CNPL  246
            V+ G +    +    YSLFDPCKEMAYIPLD + K KGKAA+DV+            NPL
Sbjct  111  VFTGLVSTFIAFFTLYSLFDPCKEMAYIPLDAEAKTKGKAAVDVIGSELRADRSSTRNPL  170

Query  247  GKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            GKSGG+L+QQ MI + GSLA STPYL G L VI+  W+ AA+SL+ QFT
Sbjct  171  GKSGGSLLQQAMIFSVGSLAASTPYLAGCLFVIIAVWLRAARSLNTQFT  219



>ref|WP_010230191.1| ATPase AAA [Chlamydia muridarum]
 sp|Q9PKX5.1|TLC1_CHLMU RecName: Full=ADP,ATP carrier protein 1; AltName: Full=ADP/ATP 
translocase 1 [Chlamydia muridarum str. Nigg]
 gb|AAF39198.1| ADP, ATP carrier protein [Chlamydia muridarum str. Nigg]
 gb|AHH22725.1| ATPase AAA [Chlamydia muridarum str. Nigg3 CMUT3-5]
 gb|AHH23650.1| ATPase AAA [Chlamydia muridarum str. Nigg CM972]
 gb|KDU80686.1| ADP/ATP carrier protein family [Chlamydia muridarum]
 gb|KDU81343.1| ADP/ATP carrier protein [Chlamydia muridarum]
 gb|KDU82181.1| ADP/ATP carrier protein [Chlamydia muridarum]
 gb|KDU83295.1| ADP/ATP carrier protein [Chlamydia muridarum]
 gb|KDU84629.1| ADP/ATP carrier protein [Chlamydia muridarum]
 gb|AID37867.1| ATPase AAA [Chlamydia muridarum str. Nigg 2 MCR]
 gb|AIT90534.1| ATPase AAA [Chlamydia muridarum]
 gb|AIT91421.1| ATPase AAA [Chlamydia muridarum]
 gb|AIW23299.1| ATPase AAA [Chlamydia muridarum]
 gb|AJR10420.1| ATPase AAA [Chlamydia muridarum]
Length=529

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A  G TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  384  VAALGTTPLMLAVVVGAVQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  443

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS++  TP+L   L  I++ W+++A  L+  F
Sbjct  444  FGKSGGSLIQQGLLVVCGSISAMTPFLAVALFAIIMVWLTSATKLNKLF  492



>ref|WP_035405565.1| ATPase AAA [Chlamydia suis]
 gb|ESN89754.1| ADP,ATP carrier protein 1 [Chlamydia suis MD56]
Length=529

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A  G TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  384  VAALGTTPLMLAVVVGAIQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  443

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TP+L   L  I++ W+++A  L+  F
Sbjct  444  FGKSGGSLIQQGLLVVCGSIGAMTPFLAVALFAIIMVWLTSATKLNKLF  492



>ref|WP_011324550.1| ATPase AAA [Chlamydia trachomatis]
 gb|AAX50316.1| ADP,ATP carrier protein [Chlamydia trachomatis A/HAR-13]
 emb|CAX09618.1| ADP,ATP carrier protein [Chlamydia trachomatis B/TZ1A828/OT]
 gb|AEP34876.1| ADP,ATP carrier protein [Chlamydia trachomatis A2497]
 emb|CAX08724.1| ADP,ATP carrier protein [Chlamydia trachomatis A2497]
 emb|CCP49241.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
A/7249]
 emb|CCP48342.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
A/5291]
 emb|CCP47442.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
A/363]
Length=526

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A  G TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  384  VAALGTTPLMLAVVVGAIQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  443

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TP+L   L  I++ W+++A  L+  F
Sbjct  444  FGKSGGSLIQQGLLVVCGSIGAMTPFLAVALFAIIMVWLTSATKLNKLF  492



>ref|WP_014541221.1| ATPase AAA [Chlamydia trachomatis]
 ref|YP_008634577.1| ADP,ATP carrier protein [Chlamydia trachomatis E/C599]
 emb|CBJ14581.1| ADP,ATP carrier protein [Chlamydia trachomatis Sweden2]
 gb|ADH16831.1| ADP,ATP carrier protein [Chlamydia trachomatis E/150]
 gb|ADH20523.1| ADP,ATP carrier protein [Chlamydia trachomatis E/11023]
 emb|CCE12341.1| ADP,ATP carrier protein [Chlamydia trachomatis E/SW3]
 emb|CCP54923.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
E/SotonE4]
 emb|CCP55816.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
E/SotonE8]
 emb|CCP60311.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
E/Bour]
 emb|CCP27852.1| ADP,ATP carrier protein [Chlamydia trachomatis IU824]
 emb|CCP28756.1| ADP,ATP carrier protein [Chlamydia trachomatis IU888]
 gb|AGT64992.1| ATPase AAA [Chlamydia trachomatis]
 gb|AGT67776.1| ATPase AAA [Chlamydia trachomatis]
 emb|CDG42958.1| ADP,ATP carrier protein [Chlamydia trachomatis E/C599]
Length=528

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A  G TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  384  VAALGTTPLMLAVVVGAIQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  443

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TP+L   L  I++ W+++A  L+  F
Sbjct  444  FGKSGGSLIQQGLLVVCGSIGAMTPFLAVALFAIIMVWLTSATKLNKLF  492



>ref|WP_012727795.1| ATPase AAA [Chlamydia trachomatis]
 emb|CAX10512.1| ADP,ATP carrier protein [Chlamydia trachomatis B/Jali20/OT]
Length=528

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A  G TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  384  VAALGTTPLMLAVVVGAIQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  443

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TP+L   L  I++ W+++A  L+  F
Sbjct  444  FGKSGGSLIQQGLLVVCGSIGAMTPFLAVALFAIIMVWLTSATKLNKLF  492



>ref|WP_009871413.1| ATPase AAA [Chlamydia trachomatis]
 ref|NP_219568.1| ADP/ATP translocase [Chlamydia trachomatis D/UW-3/CX]
 sp|O84068.1|TLC1_CHLTR RecName: Full=ADP,ATP carrier protein 1; AltName: Full=ADP/ATP 
translocase 1 [Chlamydia trachomatis D/UW-3/CX]
 gb|AAC67656.1| ADP/ATP Translocase [Chlamydia trachomatis D/UW-3/CX]
 gb|ADH17756.1| ADP,ATP carrier protein [Chlamydia trachomatis G/9768]
 gb|ADH18676.1| ADP,ATP carrier protein [Chlamydia trachomatis G/11222]
 gb|ADH19603.1| ADP,ATP carrier protein [Chlamydia trachomatis G/11074]
 gb|ADH96699.1| ADP,ATP carrier protein [Chlamydia trachomatis G/9301]
 gb|ADI50741.1| ADP,ATP carrier protein [Chlamydia trachomatis D-EC]
 gb|ADI51753.1| ADP,ATP carrier protein [Chlamydia trachomatis D-LC]
 emb|CCP50231.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
K/SotonK1]
 emb|CCP53140.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
D/SotonD5]
 emb|CCP54031.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
D/SotonD6]
 emb|CCP57630.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
G/SotonG1]
 emb|CCP58522.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
Ia/SotonIa1]
 emb|CCP59416.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
Ia/SotonIa3]
 gb|AGR95329.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-F(s)/852]
 gb|AGR99047.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-F(s)/342]
 gb|AGS01861.1| ADP,ATP carrier protein [Chlamydia trachomatis J/6276tet1]
 gb|AGT69628.1| ATPase AAA [Chlamydia trachomatis]
 gb|AGT70547.1| ATPase AAA [Chlamydia trachomatis]
 gb|AGT72389.1| ATPase AAA [Chlamydia trachomatis]
 gb|AHC16911.1| ATPase AAA [Chlamydia trachomatis C/TW-3]
Length=528

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A  G TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  384  VAALGTTPLMLAVVVGAIQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  443

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TP+L   L  I++ W+++A  L+  F
Sbjct  444  FGKSGGSLIQQGLLVVCGSIGAMTPFLAVALFAIIMVWLTSATKLNKLF  492



>ref|WP_009873033.1| ATPase AAA [Chlamydia trachomatis]
 ref|YP_008655229.1| ADP,ATP carrier protein [Chlamydia trachomatis F/SWFPminus]
 emb|CCE14119.1| ADP,ATP carrier protein [Chlamydia trachomatis F/SW5]
 emb|CCE13230.1| ADP,ATP carrier protein [Chlamydia trachomatis F/SW4]
 emb|CCP52247.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
D/SotonD1]
 emb|CCP56739.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
F/SotonF3]
 gb|AGT64069.1| ATPase AAA [Chlamydia trachomatis]
 gb|AGT65918.1| ATPase AAA [Chlamydia trachomatis]
 gb|AGT66848.1| ATPase AAA [Chlamydia trachomatis F/11-96]
 gb|AGT68699.1| ATPase AAA [Chlamydia trachomatis]
 gb|AGT71473.1| ATPase AAA [Chlamydia trachomatis]
 emb|CDG42069.1| ADP,ATP carrier protein [Chlamydia trachomatis F/SWFPminus]
Length=528

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A  G TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  384  VAALGTTPLMLAVVVGAIQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  443

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TP+L   L  I++ W+++A  L+  F
Sbjct  444  FGKSGGSLIQQGLLVVCGSIGAMTPFLAVALFAIIMVWLTSATKLNKLF  492



>ref|WP_006341707.1| ATPase AAA [Parachlamydia acanthamoebae]
 gb|EFB41019.1| ADP/ATP translocase [Parachlamydia acanthamoebae str. Hall's 
coccus]
 emb|CCB87422.1| ADP,ATP carrier protein 1 [Parachlamydia acanthamoebae UV-7]
Length=525

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 82/128 (64%), Gaps = 11/128 (9%)
 Frame = +1

Query  10   DTAIHDINIWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPL  189
            D+  H +NI           T G TPL   V+ G+ QNI  + AKY++FD  KEMA++PL
Sbjct  383  DSLSHIVNI-----------TLGTTPLAVVVFFGSAQNILCRGAKYTVFDATKEMAFVPL  431

Query  190  DEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAA  369
            D  +K+KGKAAID VC+ LGKSGG+LI Q +++TF ++  S PY+ G LLVI+  WM A 
Sbjct  432  DVKSKLKGKAAIDGVCSRLGKSGGSLIHQSLLVTFSTIMASAPYVAGFLLVIIAIWMYAT  491

Query  370  KSLDVQFT  393
            + L  QF 
Sbjct  492  RYLGAQFN  499



>ref|WP_020370051.1| MULTISPECIES: ADP,ATP carrier family protein [Chlamydia]
 gb|EPP35655.1| ADP,ATP carrier family protein [Chlamydia psittaci 10_1398_11]
 gb|EQM62559.1| ADP/ATP carrier protein [Chlamydia ibidis 10-1398/6]
Length=532

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A  G TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV   
Sbjct  385  VAMLGTTPLMLAVVVGAIQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAAR  444

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TPYL   L VI+  W+ +A  L+  F
Sbjct  445  FGKSGGSLIQQGLLVICGSIGAMTPYLAVTLFVIIGVWLVSATKLNKLF  493



>gb|KIA76916.1| ADP,ATP carrier protein 1 [Parachlamydia acanthamoebae]
Length=550

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 82/128 (64%), Gaps = 11/128 (9%)
 Frame = +1

Query  10   DTAIHDINIWFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPL  189
            D+  H +NI           T G TPL   V+ G+ QNI  + AKY++FD  KEMA++PL
Sbjct  408  DSLSHIVNI-----------TLGTTPLAVVVFFGSAQNILCRGAKYTVFDATKEMAFVPL  456

Query  190  DEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAA  369
            D  +K+KGKAAID VC+ LGKSGG+LI Q +++TF ++  S PY+ G LLVI+  WM A 
Sbjct  457  DVKSKLKGKAAIDGVCSRLGKSGGSLIHQSLLVTFSTIMASAPYVAGFLLVIIAIWMYAT  516

Query  370  KSLDVQFT  393
            + L  QF 
Sbjct  517  RYLGAQFN  524



>ref|WP_009873532.1| ATPase AAA [Chlamydia trachomatis]
 ref|YP_001654404.1| ADP,ATP carrier protein [Chlamydia trachomatis 434/Bu]
 ref|YP_007717365.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Canada2]
 emb|CAB39534.1| nucleoside triphosphate transport protein 1 [Chlamydia trachomatis]
 emb|CAP03760.1| ADP,ATP carrier protein [Chlamydia trachomatis 434/Bu]
 emb|CAP06714.1| ADP,ATP carrier protein [Chlamydia trachomatis L2b/UCH-1/proctitis]
 gb|AEJ76967.1| ADP,ATP carrier protein 1 [Chlamydia trachomatis L2c]
 emb|CCP51356.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/8200/07]
 emb|CCP61209.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/795]
 emb|CCP62100.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L1/440/LN]
 emb|CCP63882.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L1/115]
 emb|CCP64771.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L1/224]
 emb|CCP65661.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2/25667R]
 emb|CCP66551.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L3/404/LN]
 emb|CCP67439.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/UCH-2]
 emb|CCP68329.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Canada2]
 emb|CCP69221.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/LST]
 emb|CCP70111.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Ams1]
 emb|CCP71001.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/CV204]
 emb|CCP90166.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Ams2]
 emb|CCP91056.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Ams3]
 emb|CCP91946.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Canada1]
 emb|CCP92841.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Ams4]
 emb|CCP93731.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Ams5]
 gb|AGJ65359.1| ATPase AAA [Chlamydia trachomatis L2/434/Bu(f)]
 gb|AGJ64419.1| ATPase AAA [Chlamydia trachomatis L2/434/Bu(i)]
 gb|AGR93480.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-F/69]
 gb|AGR94404.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-L2(s)/46]
 gb|AGR96282.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-J/943]
 gb|AGR97209.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-J/953]
 gb|AGR98129.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-L2(s)/3]
 gb|AGR99998.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-J(s)/122]
 gb|AGS00936.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-J/966]
 gb|AGS02818.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-J/971]
 gb|AGS03743.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-L2/55]
Length=528

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A  G TPL+ AV VGA+QNI SKS KY+LFD  KE+AYIPLD++ KVKGKAAIDVV   
Sbjct  384  VAALGTTPLMLAVVVGAIQNILSKSTKYALFDATKELAYIPLDQEQKVKGKAAIDVVAAR  443

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TP+L   L  I++ W+++A  L+  F
Sbjct  444  FGKSGGSLIQQGLLVVCGSIGAMTPFLAVALFAIIMVWLTSATKLNKLF  492



>ref|WP_015506544.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis]
 emb|CCP62992.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L1/1322/p2]
Length=528

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            +A  G TPL+ AV VGA+QNI SKS KY+LFD  KE+AYIPLD++ KVKGKAAIDVV   
Sbjct  384  VAALGTTPLMLAVVVGAIQNILSKSTKYALFDATKELAYIPLDQEQKVKGKAAIDVVAAR  443

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+LIQQ +++  GS+   TP+L   L  I++ W+++A  L+  F
Sbjct  444  FGKSGGSLIQQGLLVVCGSIGAMTPFLAVALFAIIMVWLTSATKLNKLF  492



>gb|ADI39042.1| putative ADP/ATP translocase [Waddlia chondrophila WSU 86-1044]
Length=488

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            LA  GM+P +  V  GA+QN  SK+AKYS+FD  KEM++IPLD + K+KGKAAID V + 
Sbjct  357  LAALGMSPAMLVVMFGALQNCLSKAAKYSVFDATKEMSFIPLDHEVKLKGKAAIDGVGSR  416

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+L+ Q M++ FGSL+ S PY+  +L+ ++  W+ A +SL  QF
Sbjct  417  FGKSGGSLVHQGMLMVFGSLSTSAPYVAAILMAMIAFWIGAVRSLGRQF  465



>ref|WP_041941597.1| ATPase AAA [Waddlia chondrophila]
 emb|CCB92154.1| ADP,ATP carrier protein 1 [Waddlia chondrophila 2032/99]
Length=518

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +1

Query  64   LATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNP  243
            LA  GM+P +  V  GA+QN  SK+AKYS+FD  KEM++IPLD + K+KGKAAID V + 
Sbjct  387  LAALGMSPAMLVVMFGALQNCLSKAAKYSVFDATKEMSFIPLDHEVKLKGKAAIDGVGSR  446

Query  244  LGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             GKSGG+L+ Q M++ FGSL+ S PY+  +L+ ++  W+ A +SL  QF
Sbjct  447  FGKSGGSLVHQGMLMVFGSLSTSAPYVAAILMAMIAFWIGAVRSLGRQF  495



>ref|WP_020356125.1| MULTISPECIES: ADP,ATP carrier protein [Chlamydia]
 gb|EPP36701.1| ADP,ATP carrier protein [Chlamydia psittaci 10_743_SC13]
 gb|EPP38163.1| ADP,ATP carrier protein [Chlamydia psittaci 10_881_SC42]
 gb|AHK63109.1| ADP,ATP carrier protein 1 [Chlamydia avium 10DC88]
Length=534

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +1

Query  76   GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLGKS  255
            G TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV    GKS
Sbjct  388  GTTPLMLAVIVGAIQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAARFGKS  447

Query  256  GGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            GG+LIQQ +++  GS+   TPYL   L VI+  W+ +A  L+  F
Sbjct  448  GGSLIQQGLLVICGSIGAMTPYLAIALFVIISIWLISATKLNKLF  492



>gb|EYE60388.1| ADP,ATP carrier protein 2 [Bacteroides fragilis str. S6L5]
Length=506

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +1

Query  76   GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLGKS  255
            G TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV    GKS
Sbjct  359  GTTPLMLAVIVGAVQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAARFGKS  418

Query  256  GGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            GG+LIQQ +++  GS+   TPYL   L VI+  W+ +A  L+  F
Sbjct  419  GGSLIQQGLLVICGSIGAMTPYLAIALFVIISIWLISATKLNKLF  463



>ref|WP_021828277.1| MULTISPECIES: ADP/ATP carrier family protein [Bacteria]
 gb|ERL53970.1| ADP/ATP carrier family protein [Chlamydia gallinacea 08-1274/3]
Length=535

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +1

Query  76   GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLGKS  255
            G TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVKGKAAIDVV    GKS
Sbjct  388  GTTPLMLAVIVGAVQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAARFGKS  447

Query  256  GGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
            GG+LIQQ +++  GS+   TPYL   L VI+  W+ +A  L+  F
Sbjct  448  GGSLIQQGLLVICGSIGAMTPYLAIALFVIISIWLISATKLNKLF  492



>ref|WP_013182747.1| ATPase AAA [Waddlia chondrophila]
 gb|ADI39043.1| putative ADP/ATP translocase [Waddlia chondrophila WSU 86-1044]
Length=531

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = +1

Query  67   ATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPL  246
            A FGM+PL   V  G++QNI  + AKY++FD  KEMA++PL ++ KVKGKAAID VCN L
Sbjct  388  ALFGMSPLALVVLAGSVQNILCRGAKYTVFDATKEMAFVPLSDEYKVKGKAAIDGVCNRL  447

Query  247  GKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            GKSGG++I Q ++L F + + S PY+  VLLVI+  W  A K L ++F 
Sbjct  448  GKSGGSMIHQSLLLYFVTFSASAPYVAAVLLVIISCWSVAVKFLGIEFN  496



>emb|CCB92155.1| ADP,ATP carrier protein 1 [Waddlia chondrophila 2032/99]
Length=540

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = +1

Query  67   ATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPL  246
            A FGM+PL   V  G++QNI  + AKY++FD  KEMA++PL ++ KVKGKAAID VCN L
Sbjct  397  ALFGMSPLALVVLAGSVQNILCRGAKYTVFDATKEMAFVPLSDEYKVKGKAAIDGVCNRL  456

Query  247  GKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            GKSGG++I Q ++L F + + S PY+  VLLVI+  W  A K L ++F 
Sbjct  457  GKSGGSMIHQSLLLYFVTFSASAPYVAAVLLVIISCWSVAVKFLGIEFN  505



>ref|XP_002982220.1| hypothetical protein SELMODRAFT_116019, partial [Selaginella 
moellendorffii]
 gb|EFJ16888.1| hypothetical protein SELMODRAFT_116019, partial [Selaginella 
moellendorffii]
Length=507

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 74/98 (76%), Gaps = 10/98 (10%)
 Frame = +1

Query  97   AVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQ  276
            AVYVG +Q+I  K+AKYSLFDPCKEM +IPLDEDTKVK KA +D++CNPLG +       
Sbjct  420  AVYVGIVQHIVKKNAKYSLFDPCKEMTHIPLDEDTKVKSKAIVDIICNPLGAA-------  472

Query  277  FMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQF  390
             ++L  G L  STPY+  VLLVI+LAW+ AA+SLD QF
Sbjct  473  -LVLMLGPL--STPYVCMVLLVIMLAWLRAARSLDKQF  507



>ref|WP_042241994.1| ATPase AAA [Neochlamydia sp. S13]
Length=522

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +1

Query  76   GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLGKS  255
            G TPL  AV+ G+ QN  SK+AKYS FD  KEMA+IPL  + K+KGKAAID V + LGKS
Sbjct  384  GTTPLAIAVFFGSAQNCLSKAAKYSFFDTTKEMAFIPLSHECKLKGKAAIDGVGSRLGKS  443

Query  256  GGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            GG+LI Q +++ FG+L  S PY+  +LLV+++ W  A +SL  QF 
Sbjct  444  GGSLIHQGLLMFFGNLVMSAPYVASILLVVIIFWFVACRSLGRQFN  489



>gb|KIC76343.1| ADP,ATP carrier protein 1 [Neochlamydia sp. EPS4]
Length=530

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +1

Query  76   GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLGKS  255
            G TPL  AV+ G+ QN  SK+AKYS FD  KEMA+IPL  + K+KGKAAID V + LGKS
Sbjct  392  GTTPLAIAVFFGSAQNCLSKAAKYSFFDTTKEMAFIPLSHECKLKGKAAIDGVGSRLGKS  451

Query  256  GGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWMSAAKSLDVQFT  393
            GG+LI Q +++ FG+L  S PY+  +LLV+++ W  A +SL  QF 
Sbjct  452  GGSLIHQGLLMFFGNLVMSAPYVASILLVVIIFWFVACRSLGRQFN  497



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115