BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS050B01

Length=421
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006351365.1|  PREDICTED: uncharacterized protein LOC102603072  77.4    2e-13   Solanum tuberosum [potatoes]
ref|XP_004249304.1|  PREDICTED: uncharacterized protein LOC101268442  75.9    5e-13   Solanum lycopersicum
ref|XP_009788026.1|  PREDICTED: uncharacterized protein LOC104235895  74.3    2e-12   Nicotiana sylvestris
ref|XP_011075041.1|  PREDICTED: uncharacterized protein LOC105159627  70.1    4e-11   Sesamum indicum [beniseed]
emb|CDP14324.1|  unnamed protein product                              63.5    7e-09   Coffea canephora [robusta coffee]
ref|XP_006443418.1|  hypothetical protein CICLE_v10019090mg           63.2    1e-08   Citrus clementina [clementine]
ref|XP_006479104.1|  PREDICTED: uncharacterized protein LOC102619...  63.2    1e-08   Citrus sinensis [apfelsine]
ref|XP_009615719.1|  PREDICTED: uncharacterized protein LOC104108400  62.0    2e-08   Nicotiana tomentosiformis
ref|XP_010036218.1|  PREDICTED: uncharacterized protein LOC104425268  60.8    6e-08   Eucalyptus grandis [rose gum]
ref|XP_011078778.1|  PREDICTED: uncharacterized protein LOC105162459  60.1    1e-07   Sesamum indicum [beniseed]
ref|XP_009621585.1|  PREDICTED: uncharacterized protein LOC104113184  60.1    1e-07   Nicotiana tomentosiformis
ref|XP_009771625.1|  PREDICTED: uncharacterized protein LOC104222130  59.7    1e-07   Nicotiana sylvestris
ref|XP_007161937.1|  hypothetical protein PHAVU_001G110300g           59.7    1e-07   Phaseolus vulgaris [French bean]
ref|XP_007030718.1|  Kinase family protein                            59.7    2e-07   Theobroma cacao [chocolate]
gb|KJB80963.1|  hypothetical protein B456_013G123300                  59.3    2e-07   Gossypium raimondii
gb|KJB80965.1|  hypothetical protein B456_013G123300                  59.3    2e-07   Gossypium raimondii
gb|KHG17118.1|  Casein kinase I isoform delta                         58.9    3e-07   Gossypium arboreum [tree cotton]
gb|KJB45108.1|  hypothetical protein B456_007G289500                  58.5    3e-07   Gossypium raimondii
gb|KJB82581.1|  hypothetical protein B456_013G203000                  58.2    4e-07   Gossypium raimondii
gb|KJB82583.1|  hypothetical protein B456_013G203000                  58.2    5e-07   Gossypium raimondii
gb|KJB82579.1|  hypothetical protein B456_013G203000                  58.2    5e-07   Gossypium raimondii
ref|XP_004157014.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  58.2    5e-07   
gb|KJB82582.1|  hypothetical protein B456_013G203000                  58.2    5e-07   Gossypium raimondii
gb|KJB82580.1|  hypothetical protein B456_013G203000                  57.8    5e-07   Gossypium raimondii
ref|XP_003624626.1|  Casein kinase I isoform alpha                    57.4    7e-07   Medicago truncatula
gb|ABN09797.1|  Protein kinase                                        57.4    8e-07   Medicago truncatula
gb|KHG27523.1|  hypothetical protein F383_15264                       56.6    1e-06   Gossypium arboreum [tree cotton]
ref|XP_002281952.1|  PREDICTED: uncharacterized protein LOC100267624  56.2    2e-06   Vitis vinifera
ref|XP_010088042.1|  Casein kinase I isoform delta                    56.2    2e-06   
gb|EYU20664.1|  hypothetical protein MIMGU_mgv1a002165mg              55.8    2e-06   Erythranthe guttata [common monkey flower]
ref|XP_008441978.1|  PREDICTED: uncharacterized protein LOC103485979  55.5    3e-06   Cucumis melo [Oriental melon]
ref|XP_002325416.1|  kinase family protein                            55.5    4e-06   
ref|XP_011021493.1|  PREDICTED: uncharacterized protein LOC105123555  55.5    4e-06   Populus euphratica
ref|XP_004147533.1|  PREDICTED: uncharacterized protein LOC101221479  55.5    4e-06   Cucumis sativus [cucumbers]
ref|XP_004493152.1|  PREDICTED: uncharacterized protein LOC101504...  54.7    5e-06   Cicer arietinum [garbanzo]
gb|KDP39706.1|  hypothetical protein JCGZ_02726                       54.3    7e-06   Jatropha curcas
gb|KHG04306.1|  Casein kinase I-like protein                          54.3    9e-06   Gossypium arboreum [tree cotton]
gb|EPS68531.1|  hypothetical protein M569_06230                       52.8    2e-05   Genlisea aurea
ref|XP_002525432.1|  casein kinase, putative                          52.8    3e-05   Ricinus communis
ref|XP_003548750.1|  PREDICTED: uncharacterized protein LOC100801...  52.4    3e-05   Glycine max [soybeans]
ref|XP_007204249.1|  hypothetical protein PRUPE_ppa002161mg           51.6    7e-05   Prunus persica
gb|EYU39997.1|  hypothetical protein MIMGU_mgv1a002328mg              51.2    8e-05   Erythranthe guttata [common monkey flower]
ref|XP_010908708.1|  PREDICTED: uncharacterized protein LOC105035016  50.4    1e-04   Elaeis guineensis
ref|XP_008805378.1|  PREDICTED: uncharacterized protein LOC103718369  50.4    1e-04   Phoenix dactylifera
ref|XP_010672054.1|  PREDICTED: uncharacterized protein LOC104888...  50.1    2e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010672056.1|  PREDICTED: uncharacterized protein LOC104888...  50.1    2e-04   
ref|XP_008240478.1|  PREDICTED: uncharacterized protein LOC103338977  48.5    6e-04   Prunus mume [ume]
ref|XP_009366444.1|  PREDICTED: uncharacterized protein LOC103956210  48.1    7e-04   Pyrus x bretschneideri [bai li]



>ref|XP_006351365.1| PREDICTED: uncharacterized protein LOC102603072 [Solanum tuberosum]
Length=709

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 1/60 (2%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRT-KrrggggrgrgNAAAVXKGPS  419
            MPELR GAR+SKRLGD+QPAPQP  QEENLALPTQNRT +R GGGGRGRGNA A+ KGPS
Sbjct  1    MPELRSGARRSKRLGDLQPAPQPVGQEENLALPTQNRTRRRGGGGGRGRGNATAIGKGPS  60



>ref|XP_004249304.1| PREDICTED: uncharacterized protein LOC101268442 [Solanum lycopersicum]
Length=709

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRT-KrrggggrgrgNAAAVXKGPS  419
            MPELR GAR+SKRLGD+QPAPQP  QEENL LPTQNRT +R GGGGRGRGNA A+ KGPS
Sbjct  1    MPELRSGARRSKRLGDLQPAPQPVGQEENLVLPTQNRTRRRGGGGGRGRGNATAIGKGPS  60



>ref|XP_009788026.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788027.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788028.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788029.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
Length=708

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRTKrrggggrgrgNAAAVXKGPS  419
            MPELR GAR+SKRLGD+QPAP+P+ QEEN  LPTQNR +RRGGGGRGRGNA AV KGPS
Sbjct  1    MPELRSGARRSKRLGDLQPAPEPSGQEENWVLPTQNRGRRRGGGGRGRGNATAVAKGPS  59



>ref|XP_011075041.1| PREDICTED: uncharacterized protein LOC105159627 [Sesamum indicum]
Length=705

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 47/59 (80%), Gaps = 3/59 (5%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRTKrrggggrgrgNAAAVXKGPS  419
            MPELR GAR+SKRLGD+QPAPQPT QEEN   P QNRT+     GRGRGNAAAV KGPS
Sbjct  1    MPELRSGARRSKRLGDLQPAPQPTNQEENFLAPAQNRTR---RRGRGRGNAAAVAKGPS  56



>emb|CDP14324.1| unnamed protein product [Coffea canephora]
Length=709

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 48/59 (81%), Gaps = 3/59 (5%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLAL--PTQNRTKrrggggrgrgNAAAVXKG  413
            MPELR GAR+SKRLGD+QPA QP  QEEN  +  PTQNRT+ R GGGRGRGNAAAV KG
Sbjct  1    MPELRSGARRSKRLGDLQPAAQPAFQEENWLVQQPTQNRTR-RRGGGRGRGNAAAVAKG  58



>ref|XP_006443418.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 ref|XP_006479105.1| PREDICTED: uncharacterized protein LOC102619111 isoform X2 [Citrus 
sinensis]
 gb|ESR56658.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 gb|KDO55047.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=704

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRTKrrggggrgrgNAAAVXK  410
            MPELR GAR+SKRL D+QP PQP  Q EN  LP QNRT+RR GGGRGRGNA AV K
Sbjct  1    MPELRSGARRSKRLDDLQPPPQPVDQTENWLLPAQNRTRRRVGGGRGRGNATAVAK  56



>ref|XP_006479104.1| PREDICTED: uncharacterized protein LOC102619111 isoform X1 [Citrus 
sinensis]
 gb|KDO55048.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=708

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRTKrrggggrgrgNAAAVXK  410
            MPELR GAR+SKRL D+QP PQP  Q EN  LP QNRT+RR GGGRGRGNA AV K
Sbjct  1    MPELRSGARRSKRLDDLQPPPQPVDQTENWLLPAQNRTRRRVGGGRGRGNATAVAK  56



>ref|XP_009615719.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615725.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615727.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615731.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
Length=708

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRTKrrggggrgrgNAAAVXKGPS  419
            MP+LR GAR+SKRLGD QPAP+P+ QEEN  LPTQNR +RRGGGGRGRGNA AV KGPS
Sbjct  1    MPDLRRGARRSKRLGDPQPAPEPSGQEENWVLPTQNRGQRRGGGGRGRGNATAVAKGPS  59



>ref|XP_010036218.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036219.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036220.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036222.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 gb|KCW47748.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47749.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47750.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
Length=702

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRTKrrggggrgrgNAAAVXKG  413
            MPELR GAR+SKRL ++QP PQ   Q +N ALPTQN+T+RRGGGGRGRGNA AV +G
Sbjct  1    MPELRSGARRSKRLDNLQPNPQQIEQADNWALPTQNKTRRRGGGGRGRGNATAVGRG  57



>ref|XP_011078778.1| PREDICTED: uncharacterized protein LOC105162459 [Sesamum indicum]
Length=705

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 43/59 (73%), Gaps = 3/59 (5%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRTKrrggggrgrgNAAAVXKGPS  419
            MPELR GAR+SKRLGD+QPAPQ   QEE    P Q RT+     GRGRGNAAAV KGPS
Sbjct  1    MPELRSGARRSKRLGDLQPAPQTANQEEKFLAPAQTRTR---RRGRGRGNAAAVAKGPS  56



>ref|XP_009621585.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621586.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621587.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
Length=714

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 51/63 (81%), Gaps = 4/63 (6%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQP-APQPTRQEENLAL-PTQN-RTKrrggggrgrgNAA-AVXK  410
            MPELR GAR+SKRLGD+QP APQP  QEENL L PTQN   +R GGGGRGRGNAA AV K
Sbjct  2    MPELRSGARRSKRLGDLQPAAPQPVGQEENLVLPPTQNRGRRRGGGGGRGRGNAATAVGK  61

Query  411  GPS  419
            GPS
Sbjct  62   GPS  64



>ref|XP_009771625.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771626.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771627.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
Length=714

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 51/63 (81%), Gaps = 4/63 (6%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQP-APQPTRQEENLAL-PTQN-RTKrrggggrgrgNAA-AVXK  410
            MPELR GAR+SKRLGD+QP APQP  QEENL L PTQN   +R GGGGRGRGNAA AV K
Sbjct  2    MPELRSGARRSKRLGDLQPAAPQPVGQEENLVLPPTQNRGRRRGGGGGRGRGNAATAVGK  61

Query  411  GPS  419
            GPS
Sbjct  62   GPS  64



>ref|XP_007161937.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
 gb|ESW33931.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
Length=708

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQN-RTKrrggggrgrgNAAAVXKGPS  419
            MPELR GAR+SKRLGD+QP P P  Q EN A P QN   +R GGG    GNA AV KGPS
Sbjct  1    MPELRSGARRSKRLGDLQPGPLPIDQGENWAQPAQNRTRRRVGGGRGRGGNATAVGKGPS  60



>ref|XP_007030718.1| Kinase family protein [Theobroma cacao]
 gb|EOY11220.1| Kinase family protein [Theobroma cacao]
Length=705

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRTKrrggggrgrgNAAAVXKGPS  419
            MPELR GAR+SKRL D+QP PQP  Q EN  LP QNRT+ R  GGRGRGNAAAV KGPS
Sbjct  1    MPELRSGARRSKRLDDLQP-PQPVDQAENWVLPAQNRTR-RRVGGRGRGNAAAVAKGPS  57



>gb|KJB80963.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80964.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80966.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=706

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRTKrrggggrgrgNAAAVXKGPS  419
            MPELR GARKSKRLGD+QP  QP  Q EN  LP QNRT+ R  GGRGRG A AV KGPS
Sbjct  1    MPELRSGARKSKRLGDLQPPLQPVDQAENWVLPAQNRTR-RQVGGRGRGKATAVAKGPS  58



>gb|KJB80965.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=707

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRTKrrggggrgrgNAAAVXKGPS  419
            MPELR GARKSKRLGD+QP  QP  Q EN  LP QNRT+ R  GGRGRG A AV KGPS
Sbjct  1    MPELRSGARKSKRLGDLQPPLQPVDQAENWVLPAQNRTR-RQVGGRGRGKATAVAKGPS  58



>gb|KHG17118.1| Casein kinase I isoform delta [Gossypium arboreum]
 gb|KHG17119.1| Casein kinase I isoform delta [Gossypium arboreum]
Length=706

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRTKrrggggrgrgNAAAVXKGPS  419
            MPELR GAR+SKRLGD++P  QP  Q EN  LP QN   RR  GGRGRGNA  V KGPS
Sbjct  1    MPELRSGARRSKRLGDLEPPSQPVVQAENWVLPAQN-RSRRRVGGRGRGNAVGVAKGPS  58



>gb|KJB45108.1| hypothetical protein B456_007G289500 [Gossypium raimondii]
Length=706

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRTKrrggggrgrgNAAAVXKGPS  419
            MPELR GAR+SKRLGD++P  QP  Q EN  LP QN   RR  GGRGRGNA  V KGPS
Sbjct  1    MPELRSGARRSKRLGDLEPPSQPVVQAENWVLPAQN-RSRRRVGGRGRGNAVGVAKGPS  58



>gb|KJB82581.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=654

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRT  356
            MPELR GAR+SK L D+QP PQP  Q EN  LP QNRT
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQNRT  38



>gb|KJB82583.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=707

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRT  356
            MPELR GAR+SK L D+QP PQP  Q EN  LP QNRT
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQNRT  38



>gb|KJB82579.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=706

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRT  356
            MPELR GAR+SK L D+QP PQP  Q EN  LP QNRT
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQNRT  38



>ref|XP_004157014.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101221479 
[Cucumis sativus]
Length=742

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +3

Query  237  VTMPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQN-RTKrrggggrgrgNAAAVXKG  413
            +TMPELR GAR+S+RL D+QP  QP  Q ENLA+P  N   +R  GG    GNA AV KG
Sbjct  33   LTMPELRSGARRSRRLDDLQPCTQPLDQGENLAVPAPNRTRRRVAGGRGRGGNAQAVAKG  92

Query  414  PS  419
            PS
Sbjct  93   PS  94



>gb|KJB82582.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=696

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRT  356
            MPELR GAR+SK L D+QP PQP  Q EN  LP QNRT
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQNRT  38



>gb|KJB82580.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=587

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRT  356
            MPELR GAR+SK L D+QP PQP  Q EN  LP QNRT
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQNRT  38



>ref|XP_003624626.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES80844.1| casein kinase I-like protein [Medicago truncatula]
Length=708

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQN  350
            MPELR GAR+SKRLGD+QP PQP  Q EN A P QN
Sbjct  1    MPELRSGARRSKRLGDLQPGPQPVDQGENWAEPAQN  36



>gb|ABN09797.1| Protein kinase [Medicago truncatula]
Length=573

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQN  350
            MPELR GAR+SKRLGD+QP PQP  Q EN A P QN
Sbjct  1    MPELRSGARRSKRLGDLQPGPQPVDQGENWAEPAQN  36



>gb|KHG27523.1| hypothetical protein F383_15264 [Gossypium arboreum]
Length=706

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQN  350
            MPELR GARKSKRLGD+QP  QP  Q EN  LP QN
Sbjct  1    MPELRSGARKSKRLGDLQPPFQPVDQAENWVLPAQN  36



>ref|XP_002281952.1| PREDICTED: uncharacterized protein LOC100267624 [Vitis vinifera]
 emb|CAN59733.1| hypothetical protein VITISV_003914 [Vitis vinifera]
Length=708

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNR-TKrrggggrgrgNAAAVXKGPS  419
            MPELR G R+SKRL D+QP+PQP  Q EN  LP QNR  +R GGG     NA  + KGPS
Sbjct  1    MPELRSGPRRSKRLDDLQPSPQPGDQAENWLLPAQNRPRRRVGGGRGRGCNATPLAKGPS  60



>ref|XP_010088042.1| Casein kinase I isoform delta [Morus notabilis]
 gb|EXB31261.1| Casein kinase I isoform delta [Morus notabilis]
Length=706

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNR  353
            MPELR G R+SKRLGD+QP+PQP  Q EN  LPT N+
Sbjct  1    MPELRSGVRRSKRLGDLQPSPQPIGQAENWPLPTPNK  37



>gb|EYU20664.1| hypothetical protein MIMGU_mgv1a002165mg [Erythranthe guttata]
Length=706

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 41/59 (69%), Gaps = 3/59 (5%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRTKrrggggrgrgNAAAVXKGPS  419
            MPELR GAR+SKRLGD+ P PQ   QEE    P Q RT+     GRGRGNA+AV KGPS
Sbjct  2    MPELRSGARRSKRLGDLHPTPQTANQEEEFLAPAQTRTR---RRGRGRGNASAVAKGPS  57



>ref|XP_008441978.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
 ref|XP_008441979.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
Length=708

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQN-RTKrrggggrgrgNAAAVXKGPS  419
            MPELR GAR+S+RL D+QP  QP  Q ENLA+P  N   +R  GG    GNA AV KGPS
Sbjct  1    MPELRSGARRSRRLDDLQPCTQPLDQGENLAVPAPNRTRRRVAGGRGRGGNAQAVAKGPS  60



>ref|XP_002325416.1| kinase family protein [Populus trichocarpa]
 gb|EEE99797.1| kinase family protein [Populus trichocarpa]
Length=720

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRT  356
            MPELR GAR+SKRL D+QP  QP  Q ENL +P QN+T
Sbjct  1    MPELRSGARRSKRLDDLQPPQQPNNQAENLTVPVQNKT  38



>ref|XP_011021493.1| PREDICTED: uncharacterized protein LOC105123555 [Populus euphratica]
Length=707

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRT  356
            MPELR GAR+SKRL D+QP  QP  Q ENL +P QN+T
Sbjct  1    MPELRSGARRSKRLDDLQPPQQPNNQAENLTVPVQNKT  38



>ref|XP_004147533.1| PREDICTED: uncharacterized protein LOC101221479 [Cucumis sativus]
 gb|KGN53942.1| Casein kinase [Cucumis sativus]
Length=708

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQN-RTKrrggggrgrgNAAAVXKGPS  419
            MPELR GAR+S+RL D+QP  QP  Q ENLA+P  N   +R  GG    GNA AV KGPS
Sbjct  1    MPELRSGARRSRRLDDLQPCTQPLDQGENLAVPAPNRTRRRVAGGRGRGGNAQAVAKGPS  60



>ref|XP_004493152.1| PREDICTED: uncharacterized protein LOC101504885 isoform X1 [Cicer 
arietinum]
 ref|XP_004493153.1| PREDICTED: uncharacterized protein LOC101504885 isoform X2 [Cicer 
arietinum]
Length=708

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQN  350
            MPELR GAR+SKRLGD+QPAP P  Q EN   P QN
Sbjct  1    MPELRSGARRSKRLGDLQPAPLPVDQGENWTQPAQN  36



>gb|KDP39706.1| hypothetical protein JCGZ_02726 [Jatropha curcas]
Length=705

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRTKrrggggrgrgNAAAVXKGPS  419
            MPELR GAR+SKRL D+Q   QP    EN   PTQN+T+RR GG    GNA  V KG S
Sbjct  1    MPELRSGARRSKRLDDLQALQQPINPTENWIQPTQNKTRRRAGGRGRGGNATGVAKGAS  59



>gb|KHG04306.1| Casein kinase I-like protein [Gossypium arboreum]
Length=706

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQN  350
            MPELR GAR+SK L D+QP PQP  Q EN  LP QN
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN  36



>gb|EPS68531.1| hypothetical protein M569_06230 [Genlisea aurea]
Length=704

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQN  350
            MPELR GAR+SKRLGD+Q APQP  QE++    TQN
Sbjct  1    MPELRSGARRSKRLGDLQSAPQPENQEQDFLPSTQN  36



>ref|XP_002525432.1| casein kinase, putative [Ricinus communis]
 gb|EEF36922.1| casein kinase, putative [Ricinus communis]
Length=705

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRTKrrggggrgrgNAAAVXKGPS  419
            MPELR GAR+SKRL D+Q   QP    +N   P QN+T+RR GG    GNA AV KG S
Sbjct  1    MPELRSGARRSKRLDDLQTLQQPVNPADNWIQPAQNKTRRRVGGRGRGGNATAVAKGAS  59



>ref|XP_003548750.1| PREDICTED: uncharacterized protein LOC100801967 isoform X1 [Glycine 
max]
 ref|XP_006598981.1| PREDICTED: uncharacterized protein LOC100801967 isoform X2 [Glycine 
max]
 gb|KHN46781.1| Casein kinase I like hhp1 [Glycine soja]
Length=709

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPT--QNRTKrrggggrgrgNAAAVXKGP  416
            MPELR GAR+SKRLGD+QP P P  Q EN   P       +R GGG    GNA AV KGP
Sbjct  1    MPELRSGARRSKRLGDLQPGPLPVDQGENWQQPAAPNRTRRRVGGGRGRGGNATAVGKGP  60

Query  417  S  419
            S
Sbjct  61   S  61



>ref|XP_007204249.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
 gb|EMJ05448.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
Length=707

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQ-PTRQEENLALPTQNRTKrrggggrgrgNAAAVXKGPS  419
            MPELR G R+SKRL D+QP+ Q P  Q EN  LP QN+T+ R  GG       AV KGPS
Sbjct  1    MPELRSGVRRSKRLDDLQPSSQPPIGQAENCVLPAQNKTR-RRAGGGRGRGGNAVAKGPS  59



>gb|EYU39997.1| hypothetical protein MIMGU_mgv1a002328mg [Erythranthe guttata]
Length=687

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 41/59 (69%), Gaps = 7/59 (12%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQPTRQEENLALPTQNRTKrrggggrgrgNAAAVXKGPS  419
            MPELR GAR+SKRLGD+Q A     QEEN+    QNR     G GRGRGNAAAV KGP+
Sbjct  1    MPELRRGARRSKRLGDLQAA----NQEENIVASAQNR---PRGRGRGRGNAAAVAKGPT  52



>ref|XP_010908708.1| PREDICTED: uncharacterized protein LOC105035016 [Elaeis guineensis]
Length=718

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 38/64 (59%), Gaps = 5/64 (8%)
 Frame = +3

Query  243  MPELRXGAR----KSKRLGDIQPAPQPTRQEENLALPTQN-RTKrrggggrgrgNAAAVX  407
            MPELR GAR    KSK+L DI   PQP  Q EN  LPT N   +R G G     NAAAV 
Sbjct  1    MPELRSGARQARLKSKKLDDIPLPPQPIDQAENWVLPTTNRTGRRGGAGRGRGSNAAAVA  60

Query  408  KGPS  419
            KGPS
Sbjct  61   KGPS  64



>ref|XP_008805378.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
 ref|XP_008805379.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
Length=718

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 38/64 (59%), Gaps = 5/64 (8%)
 Frame = +3

Query  243  MPELRXGAR----KSKRLGDIQPAPQPTRQEENLALPTQN-RTKrrggggrgrgNAAAVX  407
            MPELR GAR    KSK+L DI P PQ   Q EN  LPT N   +R G G     NAAAV 
Sbjct  1    MPELRSGARQARLKSKKLDDIPPPPQRIDQAENWVLPTTNRTGRRGGAGRGRGSNAAAVV  60

Query  408  KGPS  419
            KGPS
Sbjct  61   KGPS  64



>ref|XP_010672054.1| PREDICTED: uncharacterized protein LOC104888715 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=713

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDI-QPAPQPTRQEENLALPTQNRT  356
            MPELR GAR+SKRLGD+ QP+P+   Q EN   PTQN+T
Sbjct  1    MPELRSGARRSKRLGDLQQPSPELNDQGENCHPPTQNKT  39



>ref|XP_010672056.1| PREDICTED: uncharacterized protein LOC104888715 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=711

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDI-QPAPQPTRQEENLALPTQNRT  356
            MPELR GAR+SKRLGD+ QP+P+   Q EN   PTQN+T
Sbjct  1    MPELRSGARRSKRLGDLQQPSPELNDQGENCHPPTQNKT  39



>ref|XP_008240478.1| PREDICTED: uncharacterized protein LOC103338977 [Prunus mume]
Length=707

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 1/38 (3%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQ-PTRQEENLALPTQNR  353
            MPELR G R+SKRL D+QP+ Q P  Q EN  LP QN+
Sbjct  1    MPELRSGVRRSKRLDDLQPSSQPPIGQAENCVLPAQNK  38



>ref|XP_009366444.1| PREDICTED: uncharacterized protein LOC103956210 [Pyrus x bretschneideri]
Length=707

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 1/38 (3%)
 Frame = +3

Query  243  MPELRXGARKSKRLGDIQPAPQ-PTRQEENLALPTQNR  353
            MPELR G R+SKRL D+QP+ Q P  Q EN  LP QN+
Sbjct  1    MPELRSGVRRSKRLDDLQPSSQPPIGQAENCVLPAQNK  38



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557844602525