BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS050A03

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009617344.1|  PREDICTED: patellin-3-like                         187   1e-51   Nicotiana tomentosiformis
ref|XP_006339369.1|  PREDICTED: patellin-2-like                         180   2e-49   
ref|XP_004250845.1|  PREDICTED: patellin-3-like                         179   2e-49   Solanum lycopersicum
ref|XP_009612346.1|  PREDICTED: patellin-3-like                         175   9e-48   Nicotiana tomentosiformis
ref|XP_009775359.1|  PREDICTED: patellin-3-like                         172   8e-47   Nicotiana sylvestris
ref|XP_004241867.1|  PREDICTED: patellin-3-like                         171   2e-46   
ref|XP_006356506.1|  PREDICTED: patellin-2-like                         171   5e-46   Solanum tuberosum [potatoes]
gb|EYU22784.1|  hypothetical protein MIMGU_mgv1a003476mg                170   8e-46   Erythranthe guttata [common monkey flower]
ref|XP_010063754.1|  PREDICTED: patellin-3-like                         169   2e-45   Eucalyptus grandis [rose gum]
ref|XP_009774158.1|  PREDICTED: patellin-3-like                         167   7e-45   Nicotiana sylvestris
ref|XP_004506377.1|  PREDICTED: patellin-2-like                         167   8e-45   Cicer arietinum [garbanzo]
emb|CAB95829.1|  hypothetical protein                                   166   9e-45   Cicer arietinum [garbanzo]
ref|XP_006585750.1|  PREDICTED: patellin-3-like isoform X2              165   4e-44   Glycine max [soybeans]
ref|XP_003531832.1|  PREDICTED: patellin-3-like isoform X1              165   4e-44   Glycine max [soybeans]
gb|KHM98825.1|  Patellin-3                                              165   6e-44   Glycine soja [wild soybean]
gb|KHN32468.1|  Patellin-5                                              159   1e-43   Glycine soja [wild soybean]
gb|KHG00007.1|  Patellin-5 -like protein                                163   1e-43   Gossypium arboreum [tree cotton]
ref|XP_011096139.1|  PREDICTED: patellin-3-like                         164   1e-43   Sesamum indicum [beniseed]
gb|KJB81306.1|  hypothetical protein B456_013G138100                    163   2e-43   Gossypium raimondii
gb|KJB81305.1|  hypothetical protein B456_013G138100                    164   2e-43   Gossypium raimondii
ref|XP_007224786.1|  hypothetical protein PRUPE_ppa023884mg             162   4e-43   
gb|KEH29320.1|  patellin-like protein                                   162   6e-43   Medicago truncatula
dbj|BAE71201.1|  putative cytosolic factor                              161   2e-42   Trifolium pratense [peavine clover]
emb|CBI39339.3|  unnamed protein product                                155   2e-42   Vitis vinifera
ref|XP_007020114.1|  SEC14 cytosolic factor family protein / phos...    161   2e-42   
gb|ABK95051.1|  unknown                                                 151   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_007131297.1|  hypothetical protein PHAVU_011G002100g             160   3e-42   Phaseolus vulgaris [French bean]
ref|XP_006591943.1|  PREDICTED: patellin-2-like isoform X3              159   4e-42   
ref|XP_003540055.1|  PREDICTED: patellin-2-like isoform X1              160   4e-42   Glycine max [soybeans]
ref|XP_006591942.1|  PREDICTED: patellin-2-like isoform X2              159   4e-42   Glycine max [soybeans]
ref|XP_004141567.1|  PREDICTED: patellin-1-like                         150   8e-42   
ref|XP_008378750.1|  PREDICTED: patellin-3-like                         158   2e-41   
gb|KHG10355.1|  Patellin-5 -like protein                                157   2e-41   Gossypium arboreum [tree cotton]
gb|KJB81308.1|  hypothetical protein B456_013G138100                    157   2e-41   Gossypium raimondii
ref|XP_009379334.1|  PREDICTED: patellin-3-like                         157   4e-41   Pyrus x bretschneideri [bai li]
ref|XP_011003949.1|  PREDICTED: patellin-1-like                         148   4e-41   Populus euphratica
ref|XP_011464747.1|  PREDICTED: patellin-3-like isoform X2              156   6e-41   Fragaria vesca subsp. vesca
ref|XP_004299816.1|  PREDICTED: patellin-3-like isoform X1              156   6e-41   Fragaria vesca subsp. vesca
ref|XP_007020115.1|  SEC14 cytosolic factor family protein / phos...    156   7e-41   
gb|KJB60075.1|  hypothetical protein B456_009G288200                    155   9e-41   Gossypium raimondii
gb|KCW69563.1|  hypothetical protein EUGRSUZ_F02993                     154   1e-40   Eucalyptus grandis [rose gum]
gb|KJB60073.1|  hypothetical protein B456_009G288200                    155   1e-40   Gossypium raimondii
ref|XP_002267428.1|  PREDICTED: patellin-3                              155   2e-40   Vitis vinifera
ref|XP_011074963.1|  PREDICTED: patellin-3-like                         154   2e-40   Sesamum indicum [beniseed]
ref|XP_006434672.1|  hypothetical protein CICLE_v10000682mg             154   3e-40   Citrus clementina [clementine]
ref|XP_006473247.1|  PREDICTED: patellin-2-like                         154   3e-40   Citrus sinensis [apfelsine]
gb|KDP27341.1|  hypothetical protein JCGZ_20273                         150   4e-40   Jatropha curcas
ref|XP_010062424.1|  PREDICTED: patellin-3-like                         154   4e-40   Eucalyptus grandis [rose gum]
ref|XP_010095907.1|  hypothetical protein L484_008304                   153   8e-40   Morus notabilis
emb|CAN80424.1|  hypothetical protein VITISV_013163                     153   9e-40   Vitis vinifera
ref|XP_011031501.1|  PREDICTED: patellin-3                              152   2e-39   Populus euphratica
ref|XP_006371458.1|  hypothetical protein POPTR_0019s10830g             152   2e-39   Populus trichocarpa [western balsam poplar]
emb|CDP10711.1|  unnamed protein product                                151   3e-39   Coffea canephora [robusta coffee]
gb|EYU28219.1|  hypothetical protein MIMGU_mgv1a004573mg                151   4e-39   Erythranthe guttata [common monkey flower]
ref|XP_008361618.1|  PREDICTED: patellin-3-like                         151   4e-39   
ref|XP_008339156.1|  PREDICTED: patellin-3-like                         151   4e-39   
gb|ABB77236.1|  patellin 1                                              150   7e-39   Cucurbita pepo
gb|KGN52721.1|  hypothetical protein Csa_5G652260                       149   2e-38   Cucumis sativus [cucumbers]
ref|XP_002521801.1|  Patellin-3, putative                               149   2e-38   Ricinus communis
ref|XP_004170401.1|  PREDICTED: patellin-3-like                         149   2e-38   
ref|XP_003630420.1|  Patellin-5                                         148   2e-38   Medicago truncatula
ref|XP_008459681.1|  PREDICTED: patellin-3-like                         149   3e-38   
ref|XP_006376222.1|  hypothetical protein POPTR_0013s11070g             148   4e-38   Populus trichocarpa [western balsam poplar]
ref|XP_009362426.1|  PREDICTED: patellin-3-like                         148   4e-38   Pyrus x bretschneideri [bai li]
ref|XP_011003948.1|  PREDICTED: patellin-3-like                         148   5e-38   Populus euphratica
ref|XP_010244944.1|  PREDICTED: patellin-3-like                         147   9e-38   Nelumbo nucifera [Indian lotus]
ref|XP_010245412.1|  PREDICTED: patellin-3-like                         147   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_006859149.1|  hypothetical protein AMTR_s00070p00121170          146   2e-37   Amborella trichopoda
ref|XP_010095909.1|  hypothetical protein L484_008306                   139   4e-35   Morus notabilis
ref|XP_010909148.1|  PREDICTED: patellin-3-like isoform X2              139   8e-35   Elaeis guineensis
ref|XP_010675154.1|  PREDICTED: patellin-3-like                         137   2e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008352805.1|  PREDICTED: patellin-3-like                         132   3e-34   
ref|XP_008783367.1|  PREDICTED: patellin-3-like                         137   3e-34   Phoenix dactylifera
ref|XP_008442083.1|  PREDICTED: patellin-3-like                         137   5e-34   Cucumis melo [Oriental melon]
ref|XP_010683337.1|  PREDICTED: patellin-3                              136   6e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002456720.1|  hypothetical protein SORBIDRAFT_03g041370          136   8e-34   
ref|XP_008378744.1|  PREDICTED: patellin-3-like                         135   9e-34   
ref|XP_004146380.1|  PREDICTED: patellin-3-like                         136   9e-34   Cucumis sativus [cucumbers]
ref|XP_004970742.1|  PREDICTED: patellin-1-like                         136   1e-33   Setaria italica
ref|XP_010909147.1|  PREDICTED: patellin-3-like isoform X1              135   1e-33   
gb|EPS60308.1|  hypothetical protein M569_14495                         134   1e-33   Genlisea aurea
ref|XP_010910883.1|  PREDICTED: patellin-3-like isoform X2              135   2e-33   Elaeis guineensis
ref|XP_009404974.1|  PREDICTED: patellin-3-like                         135   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS62735.1|  Patellin-5                                              132   2e-33   Triticum urartu
dbj|BAJ87818.1|  predicted protein                                      135   2e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003564746.1|  PREDICTED: patellin-3-like                         134   3e-33   Brachypodium distachyon [annual false brome]
emb|CDM85203.1|  unnamed protein product                                134   3e-33   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002521798.1|  Patellin-5, putative                               134   4e-33   Ricinus communis
ref|XP_006473246.1|  PREDICTED: patellin-3-like                         134   4e-33   Citrus sinensis [apfelsine]
ref|XP_009385108.1|  PREDICTED: patellin-3-like                         134   5e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT12738.1|  hypothetical protein F775_27688                         132   6e-33   
gb|KDP27342.1|  hypothetical protein JCGZ_20274                         134   7e-33   Jatropha curcas
ref|XP_009403697.1|  PREDICTED: patellin-3-like                         133   9e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY76673.1|  hypothetical protein OsI_04628                          133   1e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_004299815.1|  PREDICTED: patellin-3                              133   1e-32   Fragaria vesca subsp. vesca
ref|XP_006466197.1|  PREDICTED: patellin-3-like                         133   1e-32   Citrus sinensis [apfelsine]
ref|XP_006376221.1|  hypothetical protein POPTR_0013s11060g             132   1e-32   
ref|NP_001044958.1|  Os01g0874700                                       133   1e-32   
ref|XP_008368135.1|  PREDICTED: patellin-3-like                         132   1e-32   
ref|XP_002265124.2|  PREDICTED: patellin-3                              132   1e-32   Vitis vinifera
gb|EAZ14338.1|  hypothetical protein OsJ_04261                          133   1e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010534098.1|  PREDICTED: patellin-3-like                         132   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_009379323.1|  PREDICTED: LOW QUALITY PROTEIN: patellin-3-like    132   2e-32   
ref|XP_009362429.1|  PREDICTED: patellin-3-like                         132   2e-32   
gb|KDO84003.1|  hypothetical protein CISIN_1g009270mg                   132   2e-32   Citrus sinensis [apfelsine]
ref|XP_006434671.1|  hypothetical protein CICLE_v10000804mg             132   2e-32   Citrus clementina [clementine]
emb|CAN80423.1|  hypothetical protein VITISV_013162                     132   3e-32   Vitis vinifera
emb|CBI39340.3|  unnamed protein product                                131   4e-32   Vitis vinifera
ref|XP_010910878.1|  PREDICTED: patellin-3-like isoform X1              131   4e-32   Elaeis guineensis
ref|XP_010231340.1|  PREDICTED: patellin-3-like isoform X2              130   6e-32   
ref|XP_011099658.1|  PREDICTED: patellin-3-like                         130   6e-32   Sesamum indicum [beniseed]
ref|XP_009410675.1|  PREDICTED: patellin-3-like                         130   7e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003568397.1|  PREDICTED: patellin-3-like isoform X1              130   9e-32   Brachypodium distachyon [annual false brome]
ref|XP_006645095.1|  PREDICTED: patellin-1-like                         130   1e-31   Oryza brachyantha
gb|EPS65885.1|  hypothetical protein M569_08890                         130   1e-31   Genlisea aurea
ref|XP_009105873.1|  PREDICTED: patellin-1-like                         130   1e-31   Brassica rapa
ref|XP_011003950.1|  PREDICTED: patellin-3                              130   2e-31   Populus euphratica
ref|XP_006306912.1|  hypothetical protein CARUB_v10008471mg             131   2e-31   Capsella rubella
gb|EPS65571.1|  hypothetical protein M569_09207                         128   2e-31   Genlisea aurea
ref|XP_011031504.1|  PREDICTED: patellin-3                              130   2e-31   Populus euphratica
ref|NP_001150957.1|  LOC100284590                                       129   2e-31   
ref|XP_006416189.1|  hypothetical protein EUTSA_v10007015mg             130   2e-31   Eutrema salsugineum [saltwater cress]
emb|CDX96377.1|  BnaA07g29880D                                          129   2e-31   
dbj|BAD95021.1|  cytosolic factor                                       121   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010543667.1|  PREDICTED: patellin-5-like                         128   3e-31   Tarenaya hassleriana [spider flower]
gb|ACN27998.1|  unknown                                                 129   3e-31   Zea mays [maize]
ref|NP_001276245.1|  patellin-3-like                                    128   3e-31   Glycine max [soybeans]
ref|XP_007131298.1|  hypothetical protein PHAVU_011G002200g             128   3e-31   Phaseolus vulgaris [French bean]
ref|XP_002325536.2|  hypothetical protein POPTR_0019s10810g             128   4e-31   
emb|CDX68278.1|  BnaA07g23180D                                          127   4e-31   
ref|XP_004961988.1|  PREDICTED: patellin-2-like                         129   4e-31   Setaria italica
gb|KHG01147.1|  Patellin-3 -like protein                                129   4e-31   Gossypium arboreum [tree cotton]
ref|XP_011001253.1|  PREDICTED: patellin-3-like                         129   4e-31   Populus euphratica
ref|XP_011015061.1|  PREDICTED: patellin-3-like                         129   5e-31   Populus euphratica
ref|XP_009104870.1|  PREDICTED: patellin-3-like                         128   5e-31   Brassica rapa
emb|CDY50441.1|  BnaC06g24230D                                          127   6e-31   Brassica napus [oilseed rape]
ref|XP_011096149.1|  PREDICTED: patellin-3                              128   6e-31   Sesamum indicum [beniseed]
ref|XP_007020120.1|  Sec14p-like phosphatidylinositol transfer fa...    128   7e-31   
gb|KJB60043.1|  hypothetical protein B456_009G288100                    128   7e-31   Gossypium raimondii
gb|KJB60040.1|  hypothetical protein B456_009G288100                    128   7e-31   Gossypium raimondii
ref|XP_008657015.1|  PREDICTED: patellin-3-like                         127   7e-31   
ref|XP_008219012.1|  PREDICTED: patellin-3                              127   9e-31   Prunus mume [ume]
gb|EMT14507.1|  hypothetical protein F775_26247                         125   1e-30   
gb|EYU22783.1|  hypothetical protein MIMGU_mgv1a004079mg                127   2e-30   Erythranthe guttata [common monkey flower]
ref|XP_006390693.1|  hypothetical protein EUTSA_v10018429mg             126   2e-30   Eutrema salsugineum [saltwater cress]
dbj|BAK04984.1|  predicted protein                                      128   2e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002525405.1|  Patellin-3, putative                               127   2e-30   Ricinus communis
dbj|BAK01654.1|  predicted protein                                      127   2e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007020128.1|  Sec14p-like phosphatidylinositol transfer fa...    127   2e-30   
gb|EEE63805.1|  hypothetical protein OsJ_18629                          125   2e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002441147.1|  hypothetical protein SORBIDRAFT_09g021240          127   2e-30   
gb|EEC79272.1|  hypothetical protein OsI_20058                          126   3e-30   Oryza sativa Indica Group [Indian rice]
ref|NP_001055617.1|  Os05g0429400                                       126   3e-30   
gb|EYU20559.1|  hypothetical protein MIMGU_mgv1a006872mg                125   3e-30   Erythranthe guttata [common monkey flower]
dbj|BAH57191.1|  AT1G22530                                              125   3e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CDY03655.1|  BnaA02g15820D                                          126   3e-30   
ref|XP_011011644.1|  PREDICTED: patellin-3-like                         126   4e-30   Populus euphratica
dbj|BAD94747.1|  putative cytosolic factor protein                      122   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006654435.1|  PREDICTED: patellin-2-like                         126   4e-30   Oryza brachyantha
ref|NP_173669.1|  patellin 2                                            127   5e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003522462.1|  PREDICTED: patellin-3-like                         125   5e-30   Glycine max [soybeans]
ref|XP_007222319.1|  hypothetical protein PRUPE_ppa003964mg             125   6e-30   Prunus persica
ref|XP_007024015.1|  Patellin 1, putative                               120   6e-30   
ref|XP_006390694.1|  hypothetical protein EUTSA_v10018354mg             125   6e-30   Eutrema salsugineum [saltwater cress]
ref|XP_009127905.1|  PREDICTED: patellin-1-like                         125   7e-30   Brassica rapa
ref|XP_010521168.1|  PREDICTED: LOW QUALITY PROTEIN: patellin-3         124   8e-30   Tarenaya hassleriana [spider flower]
ref|XP_007049994.1|  SEC14 cytosolic factor family protein / phos...    125   1e-29   
ref|XP_004503864.1|  PREDICTED: patellin-5-like                         124   1e-29   Cicer arietinum [garbanzo]
ref|XP_004169713.1|  PREDICTED: patellin-3-like                         122   1e-29   
ref|XP_002888860.1|  SEC14 cytosolic factor family protein              124   1e-29   Arabidopsis lyrata subsp. lyrata
gb|KFK41635.1|  hypothetical protein AALP_AA2G153200                    124   1e-29   Arabis alpina [alpine rockcress]
ref|XP_010414837.1|  PREDICTED: patellin-3-like                         124   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010471234.1|  PREDICTED: patellin-3                              124   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006339368.1|  PREDICTED: patellin-3-like                         123   2e-29   Solanum tuberosum [potatoes]
gb|KEH35657.1|  patellin-3 protein                                      124   2e-29   Medicago truncatula
ref|XP_010428080.1|  PREDICTED: patellin-3-like isoform X1              123   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006302172.1|  hypothetical protein CARUB_v10020182mg             123   2e-29   Capsella rubella
ref|XP_004250635.1|  PREDICTED: patellin-3                              123   2e-29   Solanum lycopersicum
gb|KHN32467.1|  Patellin-3                                              123   2e-29   Glycine soja [wild soybean]
emb|CDY03654.1|  BnaA02g15830D                                          123   2e-29   
ref|XP_010428078.1|  PREDICTED: patellin-1                              124   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_002893236.1|  hypothetical protein ARALYDRAFT_472493             125   2e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_009127906.1|  PREDICTED: patellin-3-like                         123   2e-29   Brassica rapa
ref|XP_009402649.1|  PREDICTED: patellin-3-like                         124   3e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002325736.2|  hypothetical protein POPTR_0019s00780g             124   3e-29   
emb|CDX90715.1|  BnaA03g23950D                                          121   3e-29   
ref|XP_006384383.1|  hypothetical protein POPTR_0004s14530g             124   3e-29   
ref|XP_010471233.1|  PREDICTED: patellin-1-like                         123   3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006387528.1|  hypothetical protein POPTR_0895s00200g             124   3e-29   
emb|CDX82182.1|  BnaC02g21080D                                          123   3e-29   
ref|XP_002887418.1|  hypothetical protein ARALYDRAFT_895064             123   4e-29   Arabidopsis lyrata subsp. lyrata
emb|CDX82180.1|  BnaC02g21100D                                          122   5e-29   
ref|XP_004138674.1|  PREDICTED: patellin-3-like                         122   5e-29   
gb|AAK82462.1|  At1g72160/T9N14_8                                       121   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177360.1|  patellin-1                                            123   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302079.1|  hypothetical protein CARUB_v10020065mg             122   5e-29   Capsella rubella
ref|XP_010535265.1|  PREDICTED: patellin-1-like                         123   6e-29   Tarenaya hassleriana [spider flower]
gb|KFK32084.1|  hypothetical protein AALP_AA6G197400                    123   6e-29   Arabis alpina [alpine rockcress]
gb|KCW69562.1|  hypothetical protein EUGRSUZ_F029921                    119   7e-29   Eucalyptus grandis [rose gum]
ref|XP_008441140.1|  PREDICTED: patellin-3-like                         122   8e-29   Cucumis melo [Oriental melon]
ref|XP_010414836.1|  PREDICTED: patellin-1-like                         122   8e-29   Camelina sativa [gold-of-pleasure]
ref|NP_177361.1|  patellin-3                                            121   9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007159915.1|  hypothetical protein PHAVU_002G278300g             122   9e-29   Phaseolus vulgaris [French bean]
ref|XP_010912526.1|  PREDICTED: patellin-3-like                         122   9e-29   Elaeis guineensis
ref|XP_008781563.1|  PREDICTED: patellin-3-like isoform X2              121   1e-28   Phoenix dactylifera
ref|XP_009389513.1|  PREDICTED: patellin-3-like                         122   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010064859.1|  PREDICTED: patellin-3                              119   1e-28   Eucalyptus grandis [rose gum]
ref|XP_010498725.1|  PREDICTED: patellin-2                              123   1e-28   Camelina sativa [gold-of-pleasure]
gb|KFK41636.1|  hypothetical protein AALP_AA2G153300                    120   1e-28   Arabis alpina [alpine rockcress]
gb|KHN09674.1|  Patellin-3                                              121   2e-28   Glycine soja [wild soybean]
ref|XP_010415949.1|  PREDICTED: patellin-1-like isoform X2              121   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_004506378.1|  PREDICTED: patellin-3-like                         120   2e-28   Cicer arietinum [garbanzo]
ref|XP_010415948.1|  PREDICTED: patellin-1-like isoform X1              121   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010477513.1|  PREDICTED: patellin-2-like                         122   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_003532213.1|  PREDICTED: patellin-3-like                         121   2e-28   Glycine max [soybeans]
emb|CDY05051.1|  BnaC03g28490D                                          122   2e-28   
ref|XP_010460011.1|  PREDICTED: patellin-2-like                         122   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_003526897.2|  PREDICTED: patellin-1-like                         121   2e-28   
ref|NP_001131001.1|  uncharacterized protein LOC100192106               121   3e-28   Zea mays [maize]
ref|NP_192655.2|  patellin-5                                            121   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397198.1|  hypothetical protein EUTSA_v10028522mg             121   3e-28   Eutrema salsugineum [saltwater cress]
ref|XP_010534141.1|  PREDICTED: patellin-2-like                         122   5e-28   Tarenaya hassleriana [spider flower]
gb|EPS60309.1|  hypothetical protein M569_14496                         117   6e-28   Genlisea aurea
ref|XP_007137815.1|  hypothetical protein PHAVU_009G157900g             119   6e-28   Phaseolus vulgaris [French bean]
emb|CBI21668.3|  unnamed protein product                                118   7e-28   Vitis vinifera
ref|XP_010930773.1|  PREDICTED: patellin-3-like                         119   7e-28   Elaeis guineensis
ref|XP_003525154.1|  PREDICTED: patellin-3-like                         119   8e-28   Glycine max [soybeans]
ref|XP_008807685.1|  PREDICTED: patellin-3-like                         119   8e-28   Phoenix dactylifera
gb|KDP31746.1|  hypothetical protein JCGZ_14978                         120   9e-28   Jatropha curcas
gb|ACJ85524.1|  unknown                                                 118   1e-27   Medicago truncatula
ref|XP_002271899.2|  PREDICTED: patellin-3-like                         119   2e-27   Vitis vinifera
ref|XP_009134136.1|  PREDICTED: patellin-5                              119   2e-27   Brassica rapa
ref|XP_006426421.1|  hypothetical protein CICLE_v10025217mg             118   3e-27   Citrus clementina [clementine]
ref|XP_002872438.1|  SEC14 cytosolic factor family protein              118   4e-27   Arabidopsis lyrata subsp. lyrata
gb|KHG11540.1|  Patellin-5 -like protein                                117   6e-27   Gossypium arboreum [tree cotton]
gb|KDO58730.1|  hypothetical protein CISIN_1g007602mg                   117   6e-27   Citrus sinensis [apfelsine]
ref|XP_010685643.1|  PREDICTED: patellin-3                              115   1e-26   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX68279.1|  BnaA07g23190D                                          115   1e-26   
gb|AFW81858.1|  putative patellin family protein                        115   1e-26   
ref|XP_010455330.1|  PREDICTED: patellin-5-like                         115   3e-26   Camelina sativa [gold-of-pleasure]
gb|KHG30248.1|  Patellin-3 -like protein                                115   3e-26   Gossypium arboreum [tree cotton]
gb|KJB71407.1|  hypothetical protein B456_011G121700                    115   3e-26   Gossypium raimondii
ref|XP_010435861.1|  PREDICTED: patellin-5-like                         115   4e-26   Camelina sativa [gold-of-pleasure]
gb|KFK44348.1|  hypothetical protein AALP_AA1G246000                    115   5e-26   Arabis alpina [alpine rockcress]
ref|XP_006287267.1|  hypothetical protein CARUB_v10000458mg             115   5e-26   Capsella rubella
dbj|BAD82082.1|  cytosolic factor-like protein                          112   6e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009123116.1|  PREDICTED: patellin-2                              114   1e-25   Brassica rapa
ref|XP_008781561.1|  PREDICTED: patellin-3-like isoform X1              113   2e-25   Phoenix dactylifera
ref|XP_010421836.1|  PREDICTED: patellin-5                              113   2e-25   Camelina sativa [gold-of-pleasure]
gb|KJB18714.1|  hypothetical protein B456_003G066500                    112   3e-25   Gossypium raimondii
ref|XP_009416925.1|  PREDICTED: patellin-3-like                         112   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006307148.1|  hypothetical protein CARUB_v10008738mg             110   1e-24   Capsella rubella
ref|XP_010499612.1|  PREDICTED: patellin-4-like                         110   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_003568396.1|  PREDICTED: patellin-3-like                         111   1e-24   Brachypodium distachyon [annual false brome]
ref|XP_009617343.1|  PREDICTED: patellin-3                              110   1e-24   Nicotiana tomentosiformis
ref|XP_010478499.1|  PREDICTED: patellin-4-like                         110   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009773028.1|  PREDICTED: patellin-3                              108   7e-24   Nicotiana sylvestris
ref|NP_564360.1|  Sec14p-like phosphatidylinositol transfer prote...    105   7e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59666.1|  unknown protein                                         105   7e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009144742.1|  PREDICTED: patellin-4-like                         105   9e-23   Brassica rapa
emb|CDX77578.1|  BnaA07g07160D                                          105   9e-23   
ref|XP_010460876.1|  PREDICTED: patellin-4-like                         105   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_002890888.1|  predicted protein                                  104   2e-22   Arabidopsis lyrata subsp. lyrata
emb|CDY50723.1|  BnaA05g35500D                                          104   2e-22   Brassica napus [oilseed rape]
emb|CDY58916.1|  BnaCnng33910D                                        99.0    2e-22   Brassica napus [oilseed rape]
ref|XP_009393444.1|  PREDICTED: patellin-3-like                         104   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY02316.1|  BnaA09g25860D                                          102   3e-22   
emb|CDY09549.1|  BnaC05g23700D                                          103   3e-22   Brassica napus [oilseed rape]
ref|XP_009115058.1|  PREDICTED: patellin-4                              103   4e-22   Brassica rapa
gb|ABR18053.1|  unknown                                                 103   6e-22   Picea sitchensis
emb|CBI31068.3|  unnamed protein product                                101   1e-21   Vitis vinifera
ref|XP_002268764.1|  PREDICTED: patellin-4                              101   2e-21   Vitis vinifera
emb|CAN83643.1|  hypothetical protein VITISV_004911                   99.4    9e-21   Vitis vinifera
ref|XP_010538273.1|  PREDICTED: patellin-4-like                       99.4    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_006448836.1|  hypothetical protein CICLE_v10015053mg           98.6    2e-20   Citrus clementina [clementine]
gb|KDO77594.1|  hypothetical protein CISIN_1g011383mg                 98.6    2e-20   Citrus sinensis [apfelsine]
ref|XP_006468362.1|  PREDICTED: patellin-4-like                       98.2    2e-20   Citrus sinensis [apfelsine]
ref|XP_011460422.1|  PREDICTED: patellin-4 isoform X2                 97.8    4e-20   Fragaria vesca subsp. vesca
ref|XP_010053031.1|  PREDICTED: patellin-4                            97.8    4e-20   Eucalyptus grandis [rose gum]
ref|XP_004293682.1|  PREDICTED: patellin-4 isoform X1                 97.8    4e-20   
ref|XP_010926887.1|  PREDICTED: patellin-4                            97.8    7e-20   
ref|XP_006853302.1|  hypothetical protein AMTR_s00032p00036450        97.8    9e-20   
emb|CAB78040.1|  putative protein                                     97.1    1e-19   
ref|XP_006415435.1|  hypothetical protein EUTSA_v10007252mg           96.7    1e-19   
ref|XP_010540642.1|  PREDICTED: patellin-4-like                       96.7    2e-19   
ref|XP_008445767.1|  PREDICTED: patellin-4                            95.5    2e-19   
ref|XP_007211823.1|  hypothetical protein PRUPE_ppa004336mg           95.9    2e-19   
ref|XP_006415468.1|  hypothetical protein EUTSA_v10009675mg           91.3    2e-19   
ref|XP_004966295.1|  PREDICTED: patellin-4-like                       95.5    3e-19   
gb|EYU19094.1|  hypothetical protein MIMGU_mgv1a004827mg              95.1    3e-19   
gb|KJB29852.1|  hypothetical protein B456_005G121300                  94.7    4e-19   
ref|XP_008225675.1|  PREDICTED: patellin-4                            94.7    5e-19   
ref|XP_010098531.1|  hypothetical protein L484_025971                 94.7    5e-19   
ref|XP_008661065.1|  PREDICTED: patellin-4-like                       92.8    5e-19   
ref|XP_008235676.1|  PREDICTED: patellin-4-like                       94.0    7e-19   
ref|XP_007023035.1|  Sec14p-like phosphatidylinositol transfer fa...  94.4    7e-19   
gb|EPS70777.1|  hypothetical protein M569_03982                       92.8    8e-19   
ref|XP_011039291.1|  PREDICTED: patellin-4                            94.4    8e-19   
ref|XP_003563396.1|  PREDICTED: patellin-4                            94.0    1e-18   
ref|XP_002437434.1|  hypothetical protein SORBIDRAFT_10g027000        94.0    1e-18   
ref|XP_011086348.1|  PREDICTED: patellin-4-like                       94.4    1e-18   
ref|XP_010673841.1|  PREDICTED: patellin-5-like                       90.5    1e-18   
ref|XP_002513365.1|  Patellin-4, putative                             93.6    2e-18   
gb|KHG20731.1|  Patellin-4 -like protein                              92.8    2e-18   
gb|AAT45009.1|  unknown                                               86.7    2e-18   
ref|XP_008807187.1|  PREDICTED: patellin-4                            93.6    2e-18   
ref|XP_010906382.1|  PREDICTED: LOW QUALITY PROTEIN: patellin-4-like  92.8    2e-18   
ref|XP_004486495.1|  PREDICTED: patellin-4-like                       92.4    2e-18   
ref|NP_001058333.1|  Os06g0671800                                     92.8    3e-18   
ref|XP_002299019.1|  hypothetical protein POPTR_0001s46570g           92.8    3e-18   
ref|XP_009362181.1|  PREDICTED: patellin-4                            92.4    3e-18   
gb|AEW08180.1|  hypothetical protein 2_2352_02                        85.9    3e-18   
ref|XP_008365992.1|  PREDICTED: patellin-4-like                       92.0    4e-18   
ref|XP_002273072.1|  PREDICTED: patellin-4                            91.7    4e-18   
emb|CDP13579.1|  unnamed protein product                              92.0    5e-18   
ref|XP_004135556.1|  PREDICTED: patellin-4-like                       91.7    6e-18   
gb|KEH37089.1|  Sec14p-like phosphatidylinositol transfer family ...  91.3    7e-18   
ref|XP_009353862.1|  PREDICTED: patellin-4-like                       91.3    7e-18   
ref|XP_010097608.1|  hypothetical protein L484_000774                 90.9    8e-18   
ref|XP_002523147.1|  Patellin-4, putative                             91.3    9e-18   
ref|XP_006656367.1|  PREDICTED: patellin-4-like                       90.9    1e-17   
ref|NP_001149129.1|  LOC100282751                                     90.9    1e-17   
ref|XP_003535132.1|  PREDICTED: patellin-4-like                       90.5    1e-17   
gb|KHN44660.1|  Patellin-4                                            90.5    1e-17   
ref|XP_008364316.1|  PREDICTED: patellin-4-like                       90.1    2e-17   
ref|XP_009354950.1|  PREDICTED: patellin-4-like                       89.7    2e-17   
ref|XP_007200855.1|  hypothetical protein PRUPE_ppa026824mg           89.0    2e-17   
gb|KDP34841.1|  hypothetical protein JCGZ_09129                       89.7    2e-17   
dbj|BAK05295.1|  predicted protein                                    88.2    3e-17   
ref|XP_007147437.1|  hypothetical protein PHAVU_006G124500g           89.7    3e-17   
ref|XP_008392266.1|  PREDICTED: patellin-4-like isoform X1            89.7    3e-17   
ref|NP_001242249.1|  uncharacterized protein LOC100779100             89.0    4e-17   
gb|KHN14294.1|  Patellin-4                                            89.0    4e-17   
emb|CBI24189.3|  unnamed protein product                              89.4    4e-17   
emb|CAN63609.1|  hypothetical protein VITISV_019134                   89.4    4e-17   
ref|XP_002263951.1|  PREDICTED: patellin-4                            89.4    4e-17   
gb|EYU33790.1|  hypothetical protein MIMGU_mgv1a003190mg              89.4    4e-17   
ref|XP_004495099.1|  PREDICTED: patellin-4-like                       88.2    6e-17   
gb|KDP25078.1|  hypothetical protein JCGZ_22613                       89.0    6e-17   
ref|XP_008392269.1|  PREDICTED: patellin-4-like isoform X2            88.6    6e-17   
ref|XP_008805237.1|  PREDICTED: patellin-4-like                       87.8    8e-17   
ref|XP_008793601.1|  PREDICTED: LOW QUALITY PROTEIN: patellin-4-like  86.7    1e-16   
gb|KDO63274.1|  hypothetical protein CISIN_1g014036mg                 87.0    2e-16   
ref|XP_006429498.1|  hypothetical protein CICLE_v10011768mg           86.7    2e-16   
ref|XP_006481119.1|  PREDICTED: patellin-6-like                       86.7    2e-16   
ref|XP_002981400.1|  hypothetical protein SELMODRAFT_114197           85.9    3e-16   
ref|XP_002969927.1|  hypothetical protein SELMODRAFT_65145            84.7    4e-16   
ref|XP_002990612.1|  hypothetical protein SELMODRAFT_132116           84.7    4e-16   
ref|XP_010104230.1|  hypothetical protein L484_016373                 85.5    4e-16   
ref|XP_009768496.1|  PREDICTED: patellin-4                            86.3    4e-16   
ref|XP_010935907.1|  PREDICTED: patellin-4-like                       85.5    4e-16   
ref|XP_009419547.1|  PREDICTED: patellin-4                            86.7    4e-16   
ref|XP_010042244.1|  PREDICTED: patellin-4-like                       84.0    4e-16   
dbj|BAD94580.1|  hypothetical protein                                 79.7    5e-16   
ref|XP_007134632.1|  hypothetical protein PHAVU_010G063300g           85.5    5e-16   
ref|XP_011096706.1|  PREDICTED: patellin-4                            85.9    6e-16   
ref|XP_002526693.1|  Patellin-6, putative                             85.1    7e-16   
ref|XP_008447424.1|  PREDICTED: patellin-4-like                       85.1    7e-16   
tpg|DAA39576.1|  TPA: hypothetical protein ZEAMMB73_704804            86.3    7e-16   
ref|XP_009598366.1|  PREDICTED: patellin-4                            85.5    8e-16   
ref|XP_007144897.1|  hypothetical protein PHAVU_007G192700g           85.1    8e-16   
ref|XP_002264479.1|  PREDICTED: patellin-6                            84.7    8e-16   
ref|XP_008392314.1|  PREDICTED: patellin-4-like                       84.3    9e-16   
emb|CBI18097.3|  unnamed protein product                              84.7    1e-15   
ref|XP_006576481.1|  PREDICTED: patellin-6-like                       84.0    1e-15   
ref|XP_010262495.1|  PREDICTED: patellin-4-like                       84.0    2e-15   
ref|XP_010037658.1|  PREDICTED: patellin-6                            84.0    2e-15   
ref|XP_010690123.1|  PREDICTED: patellin-4                            84.3    2e-15   
ref|XP_002451242.1|  hypothetical protein SORBIDRAFT_05g026380        84.3    2e-15   
ref|XP_009387643.1|  PREDICTED: patellin-6-like isoform X2            83.2    2e-15   
ref|XP_007026555.1|  SEC14 cytosolic factor family protein / phos...  83.6    2e-15   
ref|XP_007213615.1|  hypothetical protein PRUPE_ppa002198mg           84.7    2e-15   
ref|XP_004514256.1|  PREDICTED: patellin-6-like                       83.6    2e-15   
ref|XP_004492509.1|  PREDICTED: patellin-6-like                       83.6    2e-15   
ref|XP_009387637.1|  PREDICTED: patellin-6-like isoform X1            83.2    3e-15   
emb|CDP12598.1|  unnamed protein product                              84.0    3e-15   
ref|XP_006828153.1|  hypothetical protein AMTR_s00023p00086020        83.2    3e-15   
ref|XP_010921052.1|  PREDICTED: LOW QUALITY PROTEIN: patellin-6-like  82.8    3e-15   
gb|KHG17179.1|  Patellin-6 -like protein                              82.8    3e-15   
ref|XP_008226129.1|  PREDICTED: patellin-4-like                       84.3    4e-15   
ref|XP_002968725.1|  hypothetical protein SELMODRAFT_450422           81.6    4e-15   
ref|XP_004152051.1|  PREDICTED: patellin-4-like                       82.8    4e-15   
ref|XP_009373098.1|  PREDICTED: patellin-6                            82.4    5e-15   
ref|XP_011032599.1|  PREDICTED: patellin-6                            82.4    5e-15   
gb|KGN57904.1|  hypothetical protein Csa_3G384790                     82.8    5e-15   
ref|XP_010039232.1|  PREDICTED: patellin-4-like                       82.8    6e-15   
ref|XP_004233146.1|  PREDICTED: patellin-4                            82.8    6e-15   
ref|XP_009399906.1|  PREDICTED: patellin-6-like                       82.0    7e-15   
gb|KJB36991.1|  hypothetical protein B456_006G185800                  82.4    7e-15   
ref|XP_010676841.1|  PREDICTED: patellin-6                            82.0    8e-15   
ref|XP_008364272.1|  PREDICTED: patellin-4-like                       83.2    8e-15   
ref|XP_002307646.1|  hypothetical protein POPTR_0005s24620g           81.3    9e-15   
ref|XP_008370205.1|  PREDICTED: patellin-6-like                       81.6    9e-15   
ref|XP_002323032.2|  SEC14 cytosolic factor family protein            82.0    9e-15   
gb|KEH28820.1|  SEC14 cytosolic factor family protein                 81.6    1e-14   
gb|KEH42526.1|  CRAL/TRIO, amino-terminal domain protein              81.6    1e-14   
gb|KDP22819.1|  hypothetical protein JCGZ_00406                       81.3    1e-14   
ref|XP_011004068.1|  PREDICTED: patellin-4-like                       81.6    1e-14   
ref|XP_009777461.1|  PREDICTED: patellin-6                            81.3    1e-14   
ref|XP_009420495.1|  PREDICTED: patellin-4-like                       81.3    2e-14   
gb|KHG22460.1|  Patellin-6 -like protein                              80.9    2e-14   
ref|XP_003516408.1|  PREDICTED: patellin-6-like                       80.9    2e-14   
ref|XP_006655212.1|  PREDICTED: patellin-6-like                       79.3    2e-14   
ref|XP_008388302.1|  PREDICTED: patellin-6-like                       80.5    3e-14   
ref|XP_004246302.1|  PREDICTED: patellin-6                            80.5    3e-14   
ref|XP_003541355.1|  PREDICTED: patellin-4-like                       80.5    3e-14   
ref|XP_009591185.1|  PREDICTED: patellin-6                            80.1    3e-14   
ref|XP_006360825.1|  PREDICTED: patellin-6-like                       80.1    3e-14   
gb|KJB17128.1|  hypothetical protein B456_002G266700                  80.1    4e-14   
ref|XP_011095081.1|  PREDICTED: patellin-6-like                       80.1    4e-14   
ref|XP_007050294.1|  Sec14p-like phosphatidylinositol transfer fa...  80.5    4e-14   
ref|XP_009115856.1|  PREDICTED: patellin-6                            79.7    4e-14   
gb|ADZ24716.1|  Sec14-like protein                                    79.7    5e-14   
ref|XP_007022594.1|  Sec14p-like phosphatidylinositol transfer fa...  80.5    5e-14   
ref|XP_004148600.1|  PREDICTED: patellin-6-like                       79.3    5e-14   
ref|XP_008244793.1|  PREDICTED: patellin-6                            79.3    5e-14   
ref|XP_011458007.1|  PREDICTED: patellin-4-like                       79.7    6e-14   
gb|ACL54702.1|  unknown                                               77.4    6e-14   
emb|CDX73705.1|  BnaC08g22980D                                        79.3    7e-14   
ref|XP_003623411.1|  Patellin-6                                       79.3    8e-14   
gb|KHN44959.1|  Patellin-4                                            79.3    8e-14   
ref|XP_007140188.1|  hypothetical protein PHAVU_008G091400g           79.0    9e-14   
gb|ACF88405.1|  unknown                                               77.4    1e-13   
ref|XP_007205268.1|  hypothetical protein PRUPE_ppa006443mg           78.6    1e-13   
ref|XP_010247807.1|  PREDICTED: patellin-4-like                       78.2    2e-13   
ref|XP_004302562.1|  PREDICTED: LOW QUALITY PROTEIN: patellin-6       77.8    2e-13   
ref|XP_010257012.1|  PREDICTED: patellin-6-like                       77.8    2e-13   
ref|XP_009417975.1|  PREDICTED: patellin-6-like isoform X2            77.8    2e-13   
ref|XP_008804155.1|  PREDICTED: patellin-6-like                       77.4    3e-13   
ref|NP_001148370.1|  patellin-5                                       77.4    3e-13   
ref|XP_009417974.1|  PREDICTED: patellin-6-like isoform X1            77.4    3e-13   
ref|XP_003558543.1|  PREDICTED: patellin-6                            77.4    3e-13   
emb|CAB43521.1|  hypothetical protein                                 73.9    3e-13   
dbj|BAJ87870.1|  predicted protein                                    77.4    3e-13   
gb|KHN03883.1|  Patellin-4                                            77.4    4e-13   
ref|XP_006589817.1|  PREDICTED: patellin-4-like                       77.4    4e-13   
gb|AAV43799.1|  hypothetical protein                                  76.6    5e-13   
gb|EEE63334.1|  hypothetical protein OsJ_18145                        76.6    5e-13   
gb|EAY97615.1|  hypothetical protein OsI_19539                        76.6    6e-13   
ref|XP_008809969.1|  PREDICTED: patellin-6-like                       76.3    6e-13   
gb|KHN40688.1|  Patellin-6                                            75.9    7e-13   
ref|XP_009631520.1|  PREDICTED: patellin-4-like                       76.3    8e-13   
ref|XP_002439598.1|  hypothetical protein SORBIDRAFT_09g015930        76.3    8e-13   
ref|XP_004962411.1|  PREDICTED: patellin-6-like                       75.9    1e-12   
ref|XP_006602689.1|  PREDICTED: patellin-6-like                       75.5    1e-12   
ref|XP_009392065.1|  PREDICTED: patellin-6-like                       75.5    1e-12   
ref|XP_006290352.1|  hypothetical protein CARUB_v10017297mg           75.5    1e-12   
ref|XP_006443836.1|  hypothetical protein CICLE_v10023752mg           75.5    1e-12   
ref|NP_001151467.1|  patellin-5                                       75.5    1e-12   
gb|KFK34411.1|  hypothetical protein AALP_AA5G141300                  75.1    2e-12   
ref|XP_010515597.1|  PREDICTED: patellin-6                            74.7    2e-12   
gb|AFW77755.1|  putative patellin family protein                      75.1    2e-12   
ref|XP_006403894.1|  hypothetical protein EUTSA_v10010417mg           74.7    2e-12   
ref|XP_010426743.1|  PREDICTED: patellin-6-like                       74.7    2e-12   
ref|XP_010937963.1|  PREDICTED: patellin-6-like                       74.7    2e-12   
ref|XP_002986839.1|  hypothetical protein SELMODRAFT_124840           75.1    3e-12   
ref|XP_002876098.1|  SEC14 cytosolic factor family protein            74.3    3e-12   
ref|XP_002969274.1|  hypothetical protein SELMODRAFT_91570            74.7    3e-12   
ref|NP_190735.1|  patellin-6                                          74.3    3e-12   
gb|EYU41969.1|  hypothetical protein MIMGU_mgv1a006545mg              74.3    4e-12   
ref|NP_001055255.2|  Os05g0345100                                     70.1    4e-12   
gb|KDO60492.1|  hypothetical protein CISIN_1g045317mg                 74.3    4e-12   
gb|ABK94464.1|  unknown                                               68.6    5e-12   
ref|XP_006857285.1|  hypothetical protein AMTR_s00067p00033540        73.9    5e-12   
gb|ABK95599.1|  unknown                                               68.6    5e-12   
ref|XP_009766462.1|  PREDICTED: patellin-4-like                       73.9    5e-12   
gb|EAY97614.1|  hypothetical protein OsI_19538                        70.1    5e-12   
ref|XP_006351692.1|  PREDICTED: patellin-4-like                       73.6    6e-12   
ref|XP_004246944.1|  PREDICTED: patellin-4-like                       73.6    7e-12   
emb|CDY29036.1|  BnaC07g32420D                                        73.9    7e-12   
ref|XP_010503862.1|  PREDICTED: patellin-6-like                       73.2    9e-12   
ref|XP_010529922.1|  PREDICTED: patellin-6                            72.8    1e-11   
emb|CDX90637.1|  BnaA03g41440D                                        72.4    1e-11   
emb|CDP06420.1|  unnamed protein product                              71.2    2e-11   
ref|XP_009136628.1|  PREDICTED: patellin-6-like                       72.0    2e-11   
gb|KJB42255.1|  hypothetical protein B456_007G146400                  72.0    2e-11   
gb|EPS65619.1|  hypothetical protein M569_09158                       67.0    3e-11   
gb|KJB11324.1|  hypothetical protein B456_001G253700                  71.2    4e-11   
ref|XP_006352994.1|  PREDICTED: patellin-4-like                       71.2    4e-11   
ref|XP_010264525.1|  PREDICTED: patellin-6-like                       69.3    1e-10   
gb|EMT23710.1|  hypothetical protein F775_32191                       68.9    2e-10   
ref|XP_009784254.1|  PREDICTED: uncharacterized protein LOC104232692  67.8    6e-10   
emb|CDY21368.1|  BnaA09g30590D                                        67.8    7e-10   
gb|EMT33642.1|  hypothetical protein F775_33003                       65.5    9e-10   
ref|XP_011468862.1|  PREDICTED: patellin-5-like                       67.4    1e-09   
ref|XP_010679303.1|  PREDICTED: patellin-4-like                       66.2    2e-09   
gb|KDP26528.1|  hypothetical protein JCGZ_17686                       64.7    2e-09   
emb|CDP03745.1|  unnamed protein product                              61.2    8e-08   
emb|CBI17199.3|  unnamed protein product                              60.1    2e-07   
ref|XP_002532029.1|  Patellin-4, putative                             52.4    7e-05   
gb|EYU46454.1|  hypothetical protein MIMGU_mgv1a007141mg              52.4    8e-05   
ref|XP_006480086.1|  PREDICTED: patellin-4-like                       52.0    1e-04   
emb|CDY28485.1|  BnaC02g36750D                                        47.4    2e-04   



>ref|XP_009617344.1| PREDICTED: patellin-3-like [Nicotiana tomentosiformis]
Length=629

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT + ATEDTIKPTSKHTIEFPVTEK +LVWEARVIGWDV+YG+EFVP+AEG YTIIV
Sbjct  520  EFTTAEAATEDTIKPTSKHTIEFPVTEKTSLVWEARVIGWDVSYGAEFVPSAEGGYTIIV  579

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            EKSRK+  ADET+I+N+Y    AGKVVLTFDNQTSKRKKLLYRSKTK SD
Sbjct  580  EKSRKVAAADETVITNTYTAVEAGKVVLTFDNQTSKRKKLLYRSKTKPSD  629



>ref|XP_006339369.1| PREDICTED: patellin-2-like [Solanum tuberosum]
Length=616

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   DPATED +KP SKHTIEFPVTEK  LVWEARV+GWDV YG+EFVP+AEG YTIIV
Sbjct  507  EFPIADPATEDIVKPASKHTIEFPVTEKSNLVWEARVVGWDVCYGAEFVPSAEGGYTIIV  566

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            EKSRKI  A+ET+I+N+Y    AGKVVLTFDNQTSKRKKL+YRSKTK SD
Sbjct  567  EKSRKIAAANETVITNNYTAPEAGKVVLTFDNQTSKRKKLVYRSKTKPSD  616



>ref|XP_004250845.1| PREDICTED: patellin-3-like [Solanum lycopersicum]
Length=589

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  D ATEDT+KP SKHT+EFPVTEK  LVWEARV+GWDV YG+EFVP+AEG YTIIV
Sbjct  480  EFTIADSATEDTVKPASKHTVEFPVTEKSNLVWEARVVGWDVCYGAEFVPSAEGGYTIIV  539

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            EKSRKI  A+ET+I+N+Y    AGKVVLTFDNQTSKRKKL+YRSKTK SD
Sbjct  540  EKSRKIAAANETVITNNYTAPEAGKVVLTFDNQTSKRKKLVYRSKTKSSD  589



>ref|XP_009612346.1| PREDICTED: patellin-3-like [Nicotiana tomentosiformis]
Length=569

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  +PATED IKP SKHTIEFPVTEKCTLVWEARV GWDV+YG+EFVP AEG YTII+
Sbjct  461  EFTIAEPATEDIIKPASKHTIEFPVTEKCTLVWEARVTGWDVSYGAEFVPTAEGGYTIII  520

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            EKSRK+G A+E +ISN+YK    GKVV+TFDNQ+SK+KKL+YRSK K SD
Sbjct  521  EKSRKVG-ANEKVISNTYKAGEPGKVVITFDNQSSKKKKLVYRSKNKPSD  569



>ref|XP_009775359.1| PREDICTED: patellin-3-like [Nicotiana sylvestris]
Length=566

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  +PATED IKP SKHTIEFPVTEKC+LVWEARV GWDV+YG+EFVP AEG YTII+
Sbjct  458  EFTVAEPATEDIIKPASKHTIEFPVTEKCSLVWEARVTGWDVSYGAEFVPTAEGGYTIII  517

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            EKSRK+  A+ET+ISN+YK    GKVV+TFDNQ+SK+KKL+YRSK K SD
Sbjct  518  EKSRKVV-ANETVISNTYKAGEQGKVVITFDNQSSKKKKLVYRSKNKPSD  566



>ref|XP_004241867.1| PREDICTED: patellin-3-like [Solanum lycopersicum]
Length=580

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT +PATE+ IKP SKHTIEFPVTEK TLVWEARV GWDV+YG+EFVP+AEG YTI++
Sbjct  471  EFTTAEPATEEIIKPASKHTIEFPVTEKSTLVWEARVTGWDVSYGAEFVPSAEGGYTILI  530

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            EKSRK+G A+E++IS SYK   AGKVV+T DNQTSK+KKL+YRSK K SD
Sbjct  531  EKSRKVG-ANESVISTSYKASEAGKVVITIDNQTSKKKKLVYRSKNKISD  579



>ref|XP_006356506.1| PREDICTED: patellin-2-like [Solanum tuberosum]
Length=577

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF T +PATE+ IKP SK TIEFPVTEKCTLVWEARV GWDV+YG+EFVP+AEG YTI++
Sbjct  468  EFITAEPATEEIIKPASKQTIEFPVTEKCTLVWEARVTGWDVSYGAEFVPSAEGGYTILI  527

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            EKSRK+G A+E++IS SYK   AGKVV+T DNQTSK+KKL+YRSK K SD
Sbjct  528  EKSRKVG-ANESVISTSYKASEAGKVVITIDNQTSKKKKLVYRSKNKLSD  576



>gb|EYU22784.1| hypothetical protein MIMGU_mgv1a003476mg [Erythranthe guttata]
Length=583

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT DPATE+ IKP  KH +E P+TE  T VWEARVIGWDV+YG+EFVP+AEG YT IV
Sbjct  474  EFTTADPATEEIIKPACKHIVELPITEAGTFVWEARVIGWDVSYGAEFVPSAEGGYTWIV  533

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            +KSRKIGP DET++S S+K    GKVVLTFDNQTSK+KKLLYRSKTK S+
Sbjct  534  QKSRKIGPVDETVVSCSFKVGETGKVVLTFDNQTSKKKKLLYRSKTKASE  583



>ref|XP_010063754.1| PREDICTED: patellin-3-like [Eucalyptus grandis]
 gb|KCW71009.1| hypothetical protein EUGRSUZ_F04114 [Eucalyptus grandis]
Length=616

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    YEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTII  181
            +EFTT D AT+ TIKP SKHT+EFPVTEKC LVWE RV+GWDV YG+EFVP+ EGAYT+I
Sbjct  505  HEFTTADAATDITIKPYSKHTVEFPVTEKCLLVWETRVVGWDVVYGAEFVPSTEGAYTVI  564

Query  182  VEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKG  328
            V+K+RK+ PADETIIS ++K    GK+VLT DNQ+SK+KKLLYRSKTK 
Sbjct  565  VQKTRKVAPADETIISETFKGGEPGKIVLTIDNQSSKKKKLLYRSKTKA  613



>ref|XP_009774158.1| PREDICTED: patellin-3-like [Nicotiana sylvestris]
Length=631

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT + ATEDTIKPTSKHTIEFPVTEK TLVWEA VIGWDV+YG+EFVP+AEG YTIIV
Sbjct  522  EFTTTEAATEDTIKPTSKHTIEFPVTEKITLVWEATVIGWDVSYGAEFVPSAEGGYTIIV  581

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            EKSRK+  ADET+I+N+Y T  AGK+VLTFDNQTSKRKKL+YRSKTK SD
Sbjct  582  EKSRKVAAADETVITNTYTTVEAGKIVLTFDNQTSKRKKLVYRSKTKPSD  631



>ref|XP_004506377.1| PREDICTED: patellin-2-like [Cicer arietinum]
Length=612

 Score =   167 bits (423),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT DPATE TIKP +KH +EFP+ EK TLVWE RV+GWDV+YG+EFVP+AE  YT+IV
Sbjct  502  EFTTADPATEVTIKPATKHAVEFPIPEKSTLVWEVRVVGWDVSYGAEFVPSAEDGYTVIV  561

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKT  322
            +K+RKI PADET+I+N++K    GKVVLT DNQTSK+KKLLYRSKT
Sbjct  562  QKNRKIAPADETVINNTFKIGEPGKVVLTIDNQTSKKKKLLYRSKT  607



>emb|CAB95829.1| hypothetical protein [Cicer arietinum]
Length=482

 Score =   166 bits (419),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT DPATE TIKP +KH +EFP+ EK TLVWE RV+GWDV+YG+EFVP+AE  YT+IV
Sbjct  372  EFTTADPATEVTIKPATKHAVEFPIPEKSTLVWEVRVVGWDVSYGAEFVPSAEDGYTVIV  431

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKT  322
            +K+RKI PADET+I+N++K    GKVVLT DNQTSK+KKLLYRSKT
Sbjct  432  QKNRKIAPADETVINNTFKIGEPGKVVLTIDNQTSKKKKLLYRSKT  477



>ref|XP_006585750.1| PREDICTED: patellin-3-like isoform X2 [Glycine max]
 ref|XP_006585751.1| PREDICTED: patellin-3-like isoform X3 [Glycine max]
Length=540

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT DP TE TIKP +KH +EFPV+EK   VWE RV+GWDV+YG+EFVP AE  YT+IV
Sbjct  430  EFTTSDPVTEVTIKPATKHAVEFPVSEKSHAVWEIRVVGWDVSYGAEFVPGAEDGYTVIV  489

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K+RKIGPADET+I+N++K    GK+VLT DNQTSK+KKLLYRSKTK
Sbjct  490  QKNRKIGPADETVITNAFKIGEPGKIVLTIDNQTSKKKKLLYRSKTK  536



>ref|XP_003531832.1| PREDICTED: patellin-3-like isoform X1 [Glycine max]
Length=576

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT DP TE TIKP +KH +EFPV+EK   VWE RV+GWDV+YG+EFVP AE  YT+IV
Sbjct  466  EFTTSDPVTEVTIKPATKHAVEFPVSEKSHAVWEIRVVGWDVSYGAEFVPGAEDGYTVIV  525

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K+RKIGPADET+I+N++K    GK+VLT DNQTSK+KKLLYRSKTK
Sbjct  526  QKNRKIGPADETVITNAFKIGEPGKIVLTIDNQTSKKKKLLYRSKTK  572



>gb|KHM98825.1| Patellin-3 [Glycine soja]
Length=638

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT DP TE TIKP +KH +EFPV+EK   VWE RV+GWDV+YG+EFVP AE  YT+IV
Sbjct  528  EFTTSDPVTEVTIKPATKHAVEFPVSEKSHAVWEIRVVGWDVSYGAEFVPGAEDGYTVIV  587

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K+RKIGPADET+I+N++K    GK+VLT DNQTSK+KKLLYRSKTK
Sbjct  588  QKNRKIGPADETVITNAFKIGEPGKIVLTIDNQTSKKKKLLYRSKTK  634



>gb|KHN32468.1| Patellin-5 [Glycine soja]
Length=306

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT+  P TE TIKP +KH++EFPV+EK  LVWE RV+GWDV+YG+EFVP+AE  YT+IV
Sbjct  196  EFTSAYPVTEFTIKPATKHSVEFPVSEKSHLVWEIRVVGWDVSYGAEFVPSAEDGYTVIV  255

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             KSRKI PADET+++N +K    GK+VLT DNQTSK+KKLLYRSKTK
Sbjct  256  HKSRKIAPADETVLTNGFKIGEPGKIVLTIDNQTSKKKKLLYRSKTK  302



>gb|KHG00007.1| Patellin-5 -like protein [Gossypium arboreum]
Length=521

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  D ATE TIKP +KH++EFPVTEK T+VWE RV+GWDV YG+EFVP AE  YT+IV
Sbjct  411  EFTVADAATEVTIKPATKHSVEFPVTEKSTVVWEVRVVGWDVNYGAEFVPTAEDGYTVIV  470

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             K+RK+GPADET+ISNS+KT   GK+VLT DNQT+K+KKL+YRSK K
Sbjct  471  SKTRKVGPADETVISNSFKTGEPGKIVLTIDNQTTKKKKLVYRSKAK  517



>ref|XP_011096139.1| PREDICTED: patellin-3-like [Sesamum indicum]
Length=601

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DPATE+ IKPT KHT+E P+TE  TLVWE RV+GWDV+YG+EFVP+ EG YT IV
Sbjct  492  EFTPADPATEEIIKPTCKHTVELPITEAGTLVWEVRVVGWDVSYGAEFVPSDEGGYTWIV  551

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            +KSRKIGP DE +I  S+K    GK+VLTFDNQTSK+KKLLYRSKTK S+
Sbjct  552  QKSRKIGPTDEQVIGCSFKVGETGKIVLTFDNQTSKKKKLLYRSKTKPSE  601



>gb|KJB81306.1| hypothetical protein B456_013G138100 [Gossypium raimondii]
Length=573

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  D ATE TIKP +KH++EFPVTEK T+VWE RV+GWDV YG+EFVP AE  YT+IV
Sbjct  463  EFTVADAATEVTIKPATKHSVEFPVTEKSTVVWEVRVVGWDVNYGAEFVPTAEDGYTVIV  522

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             K+RK+GPADET+ISNS+KT   GK+VLT DNQT+K+KKL+YRSK K
Sbjct  523  SKTRKVGPADETVISNSFKTGEPGKIVLTIDNQTTKKKKLVYRSKAK  569



>gb|KJB81305.1| hypothetical protein B456_013G138100 [Gossypium raimondii]
Length=591

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  D ATE TIKP +KH++EFPVTEK T+VWE RV+GWDV YG+EFVP AE  YT+IV
Sbjct  481  EFTVADAATEVTIKPATKHSVEFPVTEKSTVVWEVRVVGWDVNYGAEFVPTAEDGYTVIV  540

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             K+RK+GPADET+ISNS+KT   GK+VLT DNQT+K+KKL+YRSK K
Sbjct  541  SKTRKVGPADETVISNSFKTGEPGKIVLTIDNQTTKKKKLVYRSKAK  587



>ref|XP_007224786.1| hypothetical protein PRUPE_ppa023884mg, partial [Prunus persica]
 gb|EMJ25985.1| hypothetical protein PRUPE_ppa023884mg, partial [Prunus persica]
Length=584

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT DP TE T+KP +KHT+E PV+E   LVWE RV+GWDV+YG+EFVP+AE  YTII+
Sbjct  474  EFTTSDPVTEITVKPATKHTVEIPVSENGLLVWEVRVVGWDVSYGAEFVPSAEDGYTIIL  533

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K+RK+ PADE +ISNSYK   AGKVVLT DNQ+SK+KKLLYRSKTK
Sbjct  534  QKTRKVAPADEPVISNSYKIGEAGKVVLTIDNQSSKKKKLLYRSKTK  580



>gb|KEH29320.1| patellin-like protein [Medicago truncatula]
Length=595

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT DPATE TIKP +KH +EFPV+EK TLVWE RV+ W+V+YG+EFVP+AE  YT+I+
Sbjct  485  EFTTADPATEVTIKPATKHAVEFPVSEKSTLVWEVRVVDWNVSYGAEFVPSAEDGYTVII  544

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKT  322
            +K+RKI  ADET+ISN++K    GKVVLT DNQTSK+KKLLYRSKT
Sbjct  545  QKNRKIAAADETVISNTFKVGEPGKVVLTIDNQTSKKKKLLYRSKT  590



>dbj|BAE71201.1| putative cytosolic factor [Trifolium pratense]
Length=607

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT DPATE TIKP +KH +EFP++EK TLVWE RV+ W V YG+EFVP+AE  YT+I+
Sbjct  497  EFTTADPATEVTIKPATKHAVEFPISEKSTLVWEVRVVDWSVNYGAEFVPSAEDGYTVII  556

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKT  322
            +K+RK+ PADETIISN++K    GKV+LT DNQ+SK+KKLLYRSKT
Sbjct  557  QKNRKVAPADETIISNTFKIGEPGKVILTIDNQSSKKKKLLYRSKT  602



>emb|CBI39339.3| unnamed protein product [Vitis vinifera]
Length=274

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+  DP T  TIKP  KH IEFP +E C L+WE RVIGWDV YG+EFVP  EG YT+IV
Sbjct  165  EFSICDPVTLVTIKPGCKHVIEFPYSEPCQLIWELRVIGWDVTYGAEFVPTVEGGYTVIV  224

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            +K+RKI P DE +ISNS+K    GKV+LT DNQTSK+KKLLYRSKT+  D
Sbjct  225  QKARKIAPTDEPVISNSFKIGEPGKVILTIDNQTSKKKKLLYRSKTQPCD  274



>ref|XP_007020114.1| SEC14 cytosolic factor family protein / phosphoglyceride transfer 
family protein isoform 1 [Theobroma cacao]
 gb|EOY17339.1| SEC14 cytosolic factor family protein / phosphoglyceride transfer 
family protein isoform 1 [Theobroma cacao]
Length=625

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  D  TE TIKP++KHT+EFP+TEKC LVWE RV+GWDV YG+EFVP+AE  YT+IV
Sbjct  515  EFTVADAVTEVTIKPSTKHTVEFPITEKCNLVWELRVVGWDVNYGAEFVPSAEDGYTVIV  574

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             K+RK+  ADE +IS+S+KT   GKVVLT DNQTSK+KKLLYRSKTK
Sbjct  575  SKTRKVTTADEAVISDSFKTGDPGKVVLTVDNQTSKKKKLLYRSKTK  621



>gb|ABK95051.1| unknown [Populus trichocarpa]
Length=157

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  D  T+ TIKPTSKHT+EFPV+E C LVWE RV GWDV+YG+EFVP+AE  YT+IV
Sbjct  47   EFTGADTVTDVTIKPTSKHTVEFPVSEACVLVWELRVFGWDVSYGAEFVPSAEDGYTVIV  106

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             K+RKI  +D+ +IS+++K    GKVVLT DNQTSK+KKLLYRSKTK
Sbjct  107  SKTRKIISSDDPVISDTFKIGEPGKVVLTIDNQTSKKKKLLYRSKTK  153



>ref|XP_007131297.1| hypothetical protein PHAVU_011G002100g [Phaseolus vulgaris]
 gb|ESW03291.1| hypothetical protein PHAVU_011G002100g [Phaseolus vulgaris]
Length=612

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT D  TE TIKP +KH +EFPV+EK  LVWE RV+GWDV+Y +EFVP+ E  YT+IV
Sbjct  502  EFTTADAVTEVTIKPATKHAVEFPVSEKSHLVWEIRVVGWDVSYVAEFVPSTEDGYTVIV  561

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKG  328
            +K+RKI PADET+ISN +K+  AGKVVLT DNQTSK+KKLLYRSKTK 
Sbjct  562  QKNRKIAPADETVISNGFKSGEAGKVVLTIDNQTSKKKKLLYRSKTKA  609



>ref|XP_006591943.1| PREDICTED: patellin-2-like isoform X3 [Glycine max]
Length=587

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT+  P TE TIKP +KH++EFPV+EK  LVWE RV+GWDV+YG+EFVP+AE  YT+IV
Sbjct  477  EFTSAYPVTEFTIKPATKHSVEFPVSEKSHLVWEIRVVGWDVSYGAEFVPSAEDGYTVIV  536

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             KSRKI PADET+++N +K    GK+VLT DNQTSK+KKLLYRSKTK
Sbjct  537  HKSRKIAPADETVLTNGFKIGEPGKIVLTIDNQTSKKKKLLYRSKTK  583



>ref|XP_003540055.1| PREDICTED: patellin-2-like isoform X1 [Glycine max]
Length=606

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT+  P TE TIKP +KH++EFPV+EK  LVWE RV+GWDV+YG+EFVP+AE  YT+IV
Sbjct  496  EFTSAYPVTEFTIKPATKHSVEFPVSEKSHLVWEIRVVGWDVSYGAEFVPSAEDGYTVIV  555

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             KSRKI PADET+++N +K    GK+VLT DNQTSK+KKLLYRSKTK
Sbjct  556  HKSRKIAPADETVLTNGFKIGEPGKIVLTIDNQTSKKKKLLYRSKTK  602



>ref|XP_006591942.1| PREDICTED: patellin-2-like isoform X2 [Glycine max]
Length=596

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT+  P TE TIKP +KH++EFPV+EK  LVWE RV+GWDV+YG+EFVP+AE  YT+IV
Sbjct  486  EFTSAYPVTEFTIKPATKHSVEFPVSEKSHLVWEIRVVGWDVSYGAEFVPSAEDGYTVIV  545

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             KSRKI PADET+++N +K    GK+VLT DNQTSK+KKLLYRSKTK
Sbjct  546  HKSRKIAPADETVLTNGFKIGEPGKIVLTIDNQTSKKKKLLYRSKTK  592



>ref|XP_004141567.1| PREDICTED: patellin-1-like [Cucumis sativus]
Length=152

 Score =   150 bits (378),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+  DP TE  IK  +KHT+EFP++E   LVWE RV+GWDV+YG+EF P+AEG YT+IV
Sbjct  41   EFSVEDPVTEVAIKAAAKHTVEFPISEPSLLVWELRVVGWDVSYGAEFSPSAEGGYTVIV  100

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK-LLYRSKTK  325
            +K+ K+GPADE +ISNSY+   AGK+VLT DN +SK+KK LLYRSKTK
Sbjct  101  QKTTKLGPADEPVISNSYRVGEAGKIVLTIDNLSSKKKKILLYRSKTK  148



>ref|XP_008378750.1| PREDICTED: patellin-3-like [Malus domestica]
Length=615

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 95/113 (84%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    YEFTTGDPATEDTIKPTSKHTIEFPVTEKC--TLVWEARVIGWDVAYGSEFVPAAEGAYT  175
            +EFTT DP TE T+KP SKHT+E PV+E C   LVWE RV+GW+V+YG+EFVP+AE +YT
Sbjct  503  HEFTTSDPVTEVTVKPASKHTVEIPVSE-CGEVLVWEVRVVGWEVSYGAEFVPSAEDSYT  561

Query  176  IIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            II++K+RK+G ADE +ISN+YK   AGKVVLT DNQ+SK+KKLLYRSKTK S+
Sbjct  562  IILQKTRKVGAADEPVISNTYKIGEAGKVVLTIDNQSSKKKKLLYRSKTKPSE  614



>gb|KHG10355.1| Patellin-5 -like protein [Gossypium arboreum]
Length=600

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+  D  TE TIKP +KH++EFP+TE C LVWE RV+GW+V YG+EFVP AE  YT+IV
Sbjct  490  EFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIV  549

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             K+RK+  ADET+IS+S+KT   GKVVLT DNQTSK+KKLLYRSKTK
Sbjct  550  SKTRKVSSADETVISDSFKTGEPGKVVLTIDNQTSKKKKLLYRSKTK  596



>gb|KJB81308.1| hypothetical protein B456_013G138100 [Gossypium raimondii]
Length=590

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  D ATE TIKP +KH++EFPVTE  T+VWE RV+GWDV YG+EFVP AE  YT+IV
Sbjct  481  EFTVADAATEVTIKPATKHSVEFPVTE-STVVWEVRVVGWDVNYGAEFVPTAEDGYTVIV  539

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             K+RK+GPADET+ISNS+KT   GK+VLT DNQT+K+KKL+YRSK K
Sbjct  540  SKTRKVGPADETVISNSFKTGEPGKIVLTIDNQTTKKKKLVYRSKAK  586



>ref|XP_009379334.1| PREDICTED: patellin-3-like [Pyrus x bretschneideri]
Length=616

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 94/112 (84%), Gaps = 3/112 (3%)
 Frame = +2

Query  2    YEFTTGDPATEDTIKPTSKHTIEFPVTEKCT--LVWEARVIGWDVAYGSEFVPAAEGAYT  175
            +EFTT DP TE T+KP SKHTIE PV+E C   LVWE RV+GW+V+YG+EFVP+AE +YT
Sbjct  503  HEFTTSDPVTEVTVKPASKHTIEIPVSE-CGEFLVWEVRVLGWEVSYGAEFVPSAEDSYT  561

Query  176  IIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            II++K+RK+G ADE +ISN+YK   AGKVVLT DNQ+SK+KKLLYRSKTK S
Sbjct  562  IILQKTRKVGAADEPVISNTYKIGEAGKVVLTIDNQSSKKKKLLYRSKTKPS  613



>ref|XP_011003949.1| PREDICTED: patellin-1-like [Populus euphratica]
Length=157

 Score =   148 bits (373),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  D  T+ TIKPTSKHT+EFPV+E C L WE RV+GWDV+Y +EF+P+AE  YT+IV
Sbjct  47   EFTVADSVTDVTIKPTSKHTVEFPVSEACILAWELRVLGWDVSYEAEFMPSAEDGYTVIV  106

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             K+RK+   DE +IS+++K    GKVVLT DNQTSK+KKLLYRSKTK
Sbjct  107  SKTRKVTSTDEPVISDTFKIGEPGKVVLTIDNQTSKKKKLLYRSKTK  153



>ref|XP_011464747.1| PREDICTED: patellin-3-like isoform X2 [Fragaria vesca subsp. 
vesca]
Length=588

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT DP TE T+KP  KHT+E PV+E   LVWE RV+ WDV+YG+EFVP+AE  YTII+
Sbjct  478  EFTTADPVTEVTVKPACKHTVEIPVSESGVLVWEVRVVAWDVSYGAEFVPSAEDGYTIIL  537

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K+RK+ P DE +ISNSYK   AGKVVLT DNQ+SK+KKLLYRSK K
Sbjct  538  QKTRKVAPTDEPVISNSYKIGEAGKVVLTIDNQSSKKKKLLYRSKIK  584



>ref|XP_004299816.1| PREDICTED: patellin-3-like isoform X1 [Fragaria vesca subsp. 
vesca]
Length=603

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT DP TE T+KP  KHT+E PV+E   LVWE RV+ WDV+YG+EFVP+AE  YTII+
Sbjct  493  EFTTADPVTEVTVKPACKHTVEIPVSESGVLVWEVRVVAWDVSYGAEFVPSAEDGYTIIL  552

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+ P DE +ISNSYK   AGKVVLT DNQ+SK+KKLLYRSK K +
Sbjct  553  QKTRKVAPTDEPVISNSYKIGEAGKVVLTIDNQSSKKKKLLYRSKIKPA  601



>ref|XP_007020115.1| SEC14 cytosolic factor family protein / phosphoglyceride transfer 
family protein isoform 2 [Theobroma cacao]
 gb|EOY17340.1| SEC14 cytosolic factor family protein / phosphoglyceride transfer 
family protein isoform 2 [Theobroma cacao]
Length=626

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 89/108 (82%), Gaps = 1/108 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTE-KCTLVWEARVIGWDVAYGSEFVPAAEGAYTII  181
            EFT  D  TE TIKP++KHT+EFP+TE KC LVWE RV+GWDV YG+EFVP+AE  YT+I
Sbjct  515  EFTVADAVTEVTIKPSTKHTVEFPITEQKCNLVWELRVVGWDVNYGAEFVPSAEDGYTVI  574

Query  182  VEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            V K+RK+  ADE +IS+S+KT   GKVVLT DNQTSK+KKLLYRSKTK
Sbjct  575  VSKTRKVTTADEAVISDSFKTGDPGKVVLTVDNQTSKKKKLLYRSKTK  622



>gb|KJB60075.1| hypothetical protein B456_009G288200 [Gossypium raimondii]
Length=545

 Score =   155 bits (393),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+  D  TE TIKP +KH++EFP+TE C LVWE RV+GW+V YG+EFVP AE  YT+IV
Sbjct  435  EFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIV  494

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             K+RK+   DET+IS+S+KT   GKVVLT DNQTSK+KKLLYRSKTK
Sbjct  495  SKTRKVSSVDETVISDSFKTGEPGKVVLTIDNQTSKKKKLLYRSKTK  541



>gb|KCW69563.1| hypothetical protein EUGRSUZ_F02993 [Eucalyptus grandis]
Length=443

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  +PAT  TIKP SKHT+EFPVTE C LVWEA+V+G DV+YG+EFVP+ EG+YT+IV
Sbjct  328  EFTAAEPATGVTIKPASKHTVEFPVTETCLLVWEAKVVGCDVSYGAEFVPSTEGSYTVIV  387

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K+RKI PADE II   +K    GKVVLT DNQ+S+RK LLYRSKTK
Sbjct  388  QKTRKITPADEPIICGRFKAGEPGKVVLTVDNQSSRRKTLLYRSKTK  434



>gb|KJB60073.1| hypothetical protein B456_009G288200 [Gossypium raimondii]
Length=598

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+  D  TE TIKP +KH++EFP+TE C LVWE RV+GW+V YG+EFVP AE  YT+IV
Sbjct  488  EFSVADAVTEVTIKPAAKHSVEFPITENCNLVWELRVVGWEVNYGAEFVPTAEDGYTVIV  547

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             K+RK+   DET+IS+S+KT   GKVVLT DNQTSK+KKLLYRSKTK
Sbjct  548  SKTRKVSSVDETVISDSFKTGEPGKVVLTIDNQTSKKKKLLYRSKTK  594



>ref|XP_002267428.1| PREDICTED: patellin-3 [Vitis vinifera]
Length=606

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+  DP T  TIKP  KH IEFP +E C L+WE RVIGWDV YG+EFVP  EG YT+IV
Sbjct  497  EFSICDPVTLVTIKPGCKHVIEFPYSEPCQLIWELRVIGWDVTYGAEFVPTVEGGYTVIV  556

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            +K+RKI P DE +ISNS+K    GKV+LT DNQTSK+KKLLYRSKT+  D
Sbjct  557  QKARKIAPTDEPVISNSFKIGEPGKVILTIDNQTSKKKKLLYRSKTQPCD  606



>ref|XP_011074963.1| PREDICTED: patellin-3-like [Sesamum indicum]
Length=581

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    YEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTII  181
            +EFTT D ATE+TIKP SKHTI  P+ E  TL+WE RV GWDV+YG+EFVP+ E  YT I
Sbjct  471  HEFTTADAATEETIKPASKHTIVLPIAEAGTLIWEVRVAGWDVSYGAEFVPSNEEGYTWI  530

Query  182  VEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            V+KSRK+G  DE ++S ++K   AGKVVLTFDNQTSK+KKLLYRSKTK S+
Sbjct  531  VQKSRKMGAGDEQVVSCTFKIGEAGKVVLTFDNQTSKKKKLLYRSKTKPSE  581



>ref|XP_006434672.1| hypothetical protein CICLE_v10000682mg [Citrus clementina]
 gb|ESR47912.1| hypothetical protein CICLE_v10000682mg [Citrus clementina]
Length=582

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT DP TE  +KP SK+T+E PVTE+  LVWE RV+GWDV+YG+EFVP+AEG+YT+IV
Sbjct  472  EFTTTDPVTEVVVKPASKYTVEIPVTERSILVWELRVLGWDVSYGAEFVPSAEGSYTVIV  531

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
             K+RK+ P DE +I +++K    GKVVLT DNQ+SK+KKLLYRSKTK S
Sbjct  532  SKTRKVAPTDEPVICDTFKIGEPGKVVLTIDNQSSKKKKLLYRSKTKPS  580



>ref|XP_006473247.1| PREDICTED: patellin-2-like [Citrus sinensis]
 gb|KDO84005.1| hypothetical protein CISIN_1g008033mg [Citrus sinensis]
Length=580

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT DP TE  +KP SK+T+E PVTE+  LVWE RV+GWDV+YG+EFVP+AEG+YT+IV
Sbjct  470  EFTTTDPVTEVVVKPASKYTVEIPVTERSILVWELRVLGWDVSYGAEFVPSAEGSYTVIV  529

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
             K+RK+ P DE +I +++K    GKVVLT DNQ+SK+KKLLYRSKTK S
Sbjct  530  SKTRKVAPTDEPVICDTFKIGEPGKVVLTIDNQSSKKKKLLYRSKTKPS  578



>gb|KDP27341.1| hypothetical protein JCGZ_20273 [Jatropha curcas]
Length=306

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+  DP TE  +KPT+KHT+EF  +E+  LVWE RV+GWDV+YG+EFVP+AE  YT+IV
Sbjct  196  EFSVNDPVTEVVVKPTAKHTVEFSFSERTLLVWELRVLGWDVSYGAEFVPSAEDGYTVIV  255

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             K+RKI P DE +IS+++K    GKVVLT DNQ+SK+KKLLYRSKTK
Sbjct  256  SKTRKISPTDEPVISDTFKISEPGKVVLTIDNQSSKKKKLLYRSKTK  302



>ref|XP_010062424.1| PREDICTED: patellin-3-like [Eucalyptus grandis]
 gb|KCW69564.1| hypothetical protein EUGRSUZ_F02993 [Eucalyptus grandis]
Length=572

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  +PAT  TIKP SKHT+EFPVTE C LVWEA+V+G DV+YG+EFVP+ EG+YT+IV
Sbjct  457  EFTAAEPATGVTIKPASKHTVEFPVTETCLLVWEAKVVGCDVSYGAEFVPSTEGSYTVIV  516

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K+RKI PADE II   +K    GKVVLT DNQ+S+RK LLYRSKTK
Sbjct  517  QKTRKITPADEPIICGRFKAGEPGKVVLTVDNQSSRRKTLLYRSKTK  563



>ref|XP_010095907.1| hypothetical protein L484_008304 [Morus notabilis]
 gb|EXB62501.1| hypothetical protein L484_008304 [Morus notabilis]
Length=635

 Score =   153 bits (387),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT DP TE T+KP +KHT+E PV+E   LVWE R +GWDV YG+EFVP+AE  YT+IV
Sbjct  525  EFTTSDPVTEITVKPAAKHTVEIPVSESSILVWEIRALGWDVTYGAEFVPSAEDHYTVIV  584

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RKI  ADE +I+NS+K    GK+VLT DNQ+SK+KKLLYRSKTK S
Sbjct  585  QKARKISLADEPVIANSFKVGEPGKIVLTIDNQSSKKKKLLYRSKTKPS  633



>emb|CAN80424.1| hypothetical protein VITISV_013163 [Vitis vinifera]
Length=595

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+  DP T  TIKP  KH IEFP +E C L+WE R IGWDV YG+EFVP  EG YT+IV
Sbjct  486  EFSICDPVTLVTIKPGCKHVIEFPYSEPCQLIWELRXIGWDVTYGAEFVPTVEGGYTVIV  545

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            +K+RKI P DE +ISNS+K    GKV+LT DNQTSK+KKLLYRSKT+  D
Sbjct  546  QKARKIAPTDEPVISNSFKIGEPGKVILTIDNQTSKKKKLLYRSKTQPCD  595



>ref|XP_011031501.1| PREDICTED: patellin-3 [Populus euphratica]
Length=619

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  D  T+ TIKPTSKHT+EFPV+E C L+WE RV GWDV+YG+EFVP+AE  YT+IV
Sbjct  509  EFTVADTVTDVTIKPTSKHTVEFPVSEACVLIWELRVFGWDVSYGAEFVPSAEDGYTVIV  568

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             K+RKI  +D+ +IS+++K    GKVVLT DNQTSK+KKLLYRSKTK
Sbjct  569  SKTRKIISSDDPVISDTFKIGEPGKVVLTIDNQTSKKKKLLYRSKTK  615



>ref|XP_006371458.1| hypothetical protein POPTR_0019s10830g [Populus trichocarpa]
 gb|ERP49255.1| hypothetical protein POPTR_0019s10830g [Populus trichocarpa]
Length=623

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  D  T+ TIKPTSKHT+EFPV+E C LVWE RV GWDV+YG+EFVP+AE  YT+IV
Sbjct  513  EFTGADTVTDVTIKPTSKHTVEFPVSEACVLVWELRVFGWDVSYGAEFVPSAEDGYTVIV  572

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             K+RKI  +D+ +IS+++K    GKVVLT DNQTSK+KKLLYRSKTK
Sbjct  573  SKTRKIISSDDPVISDTFKIGEPGKVVLTIDNQTSKKKKLLYRSKTK  619



>emb|CDP10711.1| unnamed protein product [Coffea canephora]
Length=620

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKC-TLVWEARVIGWDVAYGSEFVPAAEGAYTII  181
            EFT  + ATE+ IKP+SK T+EFP TE   TLVWE RV+GW+V +G+EFVP+AEG YT+I
Sbjct  511  EFTIAEAATEEIIKPSSKQTVEFPATEAGRTLVWEVRVVGWEVTHGAEFVPSAEGGYTVI  570

Query  182  VEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            V+KSRK GP DE +IS SYK    GK+VLTFDNQTS++KKLLYRSK K
Sbjct  571  VQKSRKSGPTDEPVISGSYKIGEPGKIVLTFDNQTSRKKKLLYRSKIK  618



>gb|EYU28219.1| hypothetical protein MIMGU_mgv1a004573mg [Erythranthe guttata]
Length=520

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEK-CTLVWEARVIGWDVAYGSEFVPAAEGAYTII  181
            EF T D ATE+TIKP  KHTIE P+TE   TLVWE RV+GWDV+YG+EFVP+AEG YT I
Sbjct  409  EFATADAATEETIKPACKHTIELPITEGGTTLVWEVRVVGWDVSYGAEFVPSAEGGYTWI  468

Query  182  VEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKT  322
            V+KSRKIG ADE  +S S+K+   GK+VLTFDNQTSK+KKL+YR+KT
Sbjct  469  VQKSRKIGAADEQSLSCSFKSGETGKLVLTFDNQTSKKKKLVYRTKT  515



>ref|XP_008361618.1| PREDICTED: patellin-3-like [Malus domestica]
Length=614

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = +2

Query  2    YEFTTGDPATEDTIKPTSKHTIEFPVTEKC-TLVWEARVIGWDVAYGSEFVPAAEGAYTI  178
            +EFTT D  TE T+KP SKHT+E PV+E    LVWE RV+GW+V YG+EFVP+AE  YTI
Sbjct  501  HEFTTSDXVTEITVKPASKHTVEIPVSESGEVLVWEVRVVGWEVTYGAEFVPSAEDGYTI  560

Query  179  IVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            I+ K+RK+G ADE +I+N+YK   AGKVVLT DNQ+SK+KKLLYRSKTK S
Sbjct  561  ILHKARKVGAADEPVITNTYKIGEAGKVVLTIDNQSSKKKKLLYRSKTKPS  611



>ref|XP_008339156.1| PREDICTED: patellin-3-like [Malus domestica]
 ref|XP_008368133.1| PREDICTED: patellin-3-like [Malus domestica]
Length=614

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = +2

Query  2    YEFTTGDPATEDTIKPTSKHTIEFPVTEKC-TLVWEARVIGWDVAYGSEFVPAAEGAYTI  178
            +EFTT D  TE T+KP SKHT+E PV+E    LVWE RV+GW+V YG+EFVP+AE  YTI
Sbjct  501  HEFTTSDXVTEITVKPASKHTVEIPVSESGEVLVWEVRVVGWEVTYGAEFVPSAEDGYTI  560

Query  179  IVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            I+ K+RK+G ADE +I+N+YK   AGKVVLT DNQ+SK+KKLLYRSKTK S
Sbjct  561  ILHKARKVGAADEPVITNTYKIGEAGKVVLTIDNQSSKKKKLLYRSKTKPS  611



>gb|ABB77236.1| patellin 1 [Cucurbita pepo]
Length=604

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 88/108 (81%), Gaps = 1/108 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+  DP TE  IK  +KHT+EFP++E   LVWE RV+GWDV+YG+EF+P+AEG YT+IV
Sbjct  493  EFSIDDPVTEVAIKAATKHTVEFPISEPSLLVWELRVVGWDVSYGAEFLPSAEGGYTVIV  552

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK-LLYRSKTK  325
            +K+ K+GPADE +ISNSY+   AGK+VLT DN +SK+KK LLYRSKTK
Sbjct  553  QKTAKLGPADEPVISNSYRVGEAGKIVLTIDNLSSKKKKILLYRSKTK  600



>gb|KGN52721.1| hypothetical protein Csa_5G652260 [Cucumis sativus]
Length=606

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+  DP TE  IK  +KHT+EFP++E   LVWE RV+GWDV+YG+EF P+AEG YT+IV
Sbjct  495  EFSVEDPVTEVAIKAAAKHTVEFPISEPSLLVWELRVVGWDVSYGAEFSPSAEGGYTVIV  554

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK-LLYRSKTK  325
            +K+ K+GPADE +ISNSY+   AGK+VLT DN +SK+KK LLYRSKTK
Sbjct  555  QKTTKLGPADEPVISNSYRVGEAGKIVLTIDNLSSKKKKILLYRSKTK  602



>ref|XP_002521801.1| Patellin-3, putative [Ricinus communis]
 gb|EEF40611.1| Patellin-3, putative [Ricinus communis]
Length=627

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+  D  TE TIKP +KHT+EF  +E+C LVWE RV+GWDV+YG+EFVP+A+  YT+IV
Sbjct  517  EFSVSDAVTEVTIKPATKHTVEFSFSERCLLVWELRVVGWDVSYGAEFVPSADDGYTVIV  576

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             K+RK+ P+DE +I +++K    GKVVLT DNQTSK+KKLLYRSKTK
Sbjct  577  SKARKVSPSDEPVICDTFKISEPGKVVLTIDNQTSKKKKLLYRSKTK  623



>ref|XP_004170401.1| PREDICTED: patellin-3-like [Cucumis sativus]
Length=606

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+  DP TE  IK  +KHT+EFP++E   LVWE RV+GWDV+YG+EF P+AEG YT+IV
Sbjct  495  EFSVEDPVTEVAIKAAAKHTVEFPISEPSLLVWELRVVGWDVSYGAEFSPSAEGGYTVIV  554

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK-LLYRSKTK  325
            +K+ K+GPADE +ISNSY+   AGK+VLT DN +SK+KK LLYRSKTK
Sbjct  555  QKTTKLGPADEPVISNSYRVGEAGKIVLTIDNLSSKKKKILLYRSKTK  602



>ref|XP_003630420.1| Patellin-5 [Medicago truncatula]
 gb|AET04896.1| patellin-3 protein [Medicago truncatula]
Length=503

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D  TE TI+P SKHT+EFPVTEKC L WE RVIGW+V YG+EFVP+ EG+YT+IV
Sbjct  392  EFGNSDSVTEITIRPASKHTVEFPVTEKCLLSWEVRVIGWEVRYGAEFVPSNEGSYTVIV  451

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+  ++E ++ NS+K +  GKVVLT DN +S++KKLLYR KTK S
Sbjct  452  QKARKVASSEEAVLCNSFKINEPGKVVLTIDNTSSRKKKLLYRLKTKTS  500



>ref|XP_008459681.1| PREDICTED: patellin-3-like [Cucumis melo]
Length=603

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+  DP TE  IK  +KHT+EFP++E   LVWE RV+GWDV+YG+EF P+AEG YT+IV
Sbjct  492  EFSVEDPVTEVAIKAATKHTVEFPISEPSLLVWELRVVGWDVSYGAEFSPSAEGGYTVIV  551

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK-LLYRSKTK  325
            +K+ K+GPADE +ISNSY+   AGK+VLT DN +SK+KK LLYRSKTK
Sbjct  552  QKTTKLGPADEPVISNSYRVGEAGKIVLTIDNLSSKKKKILLYRSKTK  599



>ref|XP_006376222.1| hypothetical protein POPTR_0013s11070g [Populus trichocarpa]
 gb|ERP54019.1| hypothetical protein POPTR_0013s11070g [Populus trichocarpa]
Length=623

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  D  T+ TIKPTSKHT+EFPV+E C L WE RV+GWDV+Y +EF+P+AE  YT+IV
Sbjct  513  EFTVADSVTDVTIKPTSKHTVEFPVSEACILAWELRVLGWDVSYEAEFMPSAEDGYTVIV  572

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             K+RK+   DE +IS+++K    GKVVLT DNQTSK+KKLLYRSKTK
Sbjct  573  SKTRKVTSTDEPVISDTFKIGEPGKVVLTIDNQTSKKKKLLYRSKTK  619



>ref|XP_009362426.1| PREDICTED: patellin-3-like [Pyrus x bretschneideri]
Length=610

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = +2

Query  2    YEFTTGDPATEDTIKPTSKHTIEFPVTEKC-TLVWEARVIGWDVAYGSEFVPAAEGAYTI  178
            +EFTT D  TE T+KP SKHT+E PV+E    LVWE RV+GW+V YG+EFVP+AE  YTI
Sbjct  497  HEFTTSDAVTEITVKPASKHTVEIPVSESGEVLVWEVRVVGWEVTYGAEFVPSAEDGYTI  556

Query  179  IVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            I++K+ K+G ADE +I+N+YK   AGKVVLT DNQ+SK+KKLLYRSKTK S
Sbjct  557  ILQKAWKVGAADEPVITNTYKIGEAGKVVLTIDNQSSKKKKLLYRSKTKPS  607



>ref|XP_011003948.1| PREDICTED: patellin-3-like [Populus euphratica]
Length=629

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  D  T+ TIKPTSKHT+EFPV+E C L WE RV+GWDV+Y +EF+P+AE  YT+IV
Sbjct  519  EFTVADSVTDVTIKPTSKHTVEFPVSEACILAWELRVLGWDVSYEAEFMPSAEDGYTVIV  578

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             K+RK+   DE +IS+++K    GKVVLT DNQTSK+KKLLYRSKTK
Sbjct  579  SKTRKVTSTDEPVISDTFKIGEPGKVVLTIDNQTSKKKKLLYRSKTK  625



>ref|XP_010244944.1| PREDICTED: patellin-3-like [Nelumbo nucifera]
Length=578

 Score =   147 bits (371),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT D A+E TIK  +K T+EFPV+E   LVWE RV+GWDV+YG+EFVP+AE  YT+IV
Sbjct  468  EFTTADTASEITIKSATKQTVEFPVSEASHLVWEVRVVGWDVSYGAEFVPSAEDGYTVIV  527

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +KSRK+  ++E +I NS+K    GK+VLT DNQ+SK+KKLLYRSKTK S
Sbjct  528  QKSRKVAASEEPVICNSFKIGEPGKIVLTIDNQSSKKKKLLYRSKTKPS  576



>ref|XP_010245412.1| PREDICTED: patellin-3-like [Nelumbo nucifera]
Length=561

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  D A E TIK  +K T+EFP +E C LVWE RV+GWDV+YG+EFVP+AE  YT+IV
Sbjct  451  EFTDSDAANEITIKAATKQTVEFPASEACHLVWEVRVVGWDVSYGAEFVPSAEDGYTVIV  510

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +KSRKI  ++E ++ NS+K    GK+VLT DNQ+SK+KKLLYRSKTK S
Sbjct  511  QKSRKIASSEEPVLCNSFKIGEPGKIVLTIDNQSSKKKKLLYRSKTKPS  559



>ref|XP_006859149.1| hypothetical protein AMTR_s00070p00121170 [Amborella trichopoda]
 gb|ERN20616.1| hypothetical protein AMTR_s00070p00121170 [Amborella trichopoda]
Length=626

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+T D ATE TIKP SK+T+E PVTE C LVWE R++GWDV+YG+EFVP+AE  YT+IV
Sbjct  513  EFSTADAATEFTIKPASKNTVEIPVTEACILVWELRILGWDVSYGAEFVPSAEDGYTVIV  572

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K+RKI   DE +I NS+K    GK+VLT DN +SK+KKL+YR KTK
Sbjct  573  QKARKIAITDEPVIRNSFKIGEPGKIVLTVDNTSSKKKKLIYRYKTK  619



>ref|XP_010095909.1| hypothetical protein L484_008306 [Morus notabilis]
 gb|EXB62503.1| hypothetical protein L484_008306 [Morus notabilis]
Length=510

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+  DP TE  IKP +K T+E  + EKC ++WE RV+GW+V+YGSEFVP AEG YTII+
Sbjct  400  EFSISDPVTEVNIKPGTKQTVEIIIYEKCVIIWELRVVGWEVSYGSEFVPNAEGRYTIII  459

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             KSRK  P+DE ++  S+K D  GK++LT DN TSK+K+LLYR K K
Sbjct  460  HKSRKFAPSDEPVVHTSFKVDELGKILLTIDNPTSKKKRLLYRFKIK  506



>ref|XP_010909148.1| PREDICTED: patellin-3-like isoform X2 [Elaeis guineensis]
Length=588

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT+ D  TE TIKP+SK T+E PV+E C LVWE RV+GW+V YG+EFVP+AE  YT+IV
Sbjct  476  DFTSADAVTEVTIKPSSKQTVEIPVSETCLLVWELRVLGWEVIYGAEFVPSAEDGYTVIV  535

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K RK+   DE ++   +K    GKVVLT DN TSK+KKLLYRSK K S
Sbjct  536  QKMRKLAATDEPVMKAFFKVGEPGKVVLTIDNPTSKKKKLLYRSKAKSS  584



>ref|XP_010675154.1| PREDICTED: patellin-3-like [Beta vulgaris subsp. vulgaris]
Length=563

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D AT+  +KPTSK T+EF VTE C L WE RV+GW+V+YG+EFVP A+  YT+I+
Sbjct  453  EFGNKDGATQIMVKPTSKETVEFAVTEACHLTWEVRVLGWEVSYGAEFVPNAKDGYTVII  512

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKT  322
            +K RK+GP +ETIISN++KT   GKVVLT  N +SK+K+LLYR K+
Sbjct  513  QKLRKVGPTEETIISNTFKTSEPGKVVLTIHNSSSKKKRLLYRLKS  558



>ref|XP_008352805.1| PREDICTED: patellin-3-like [Malus domestica]
Length=226

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DP  + T+KP +K T+E  + EKCT+VWE RV+GW+V+YG+EFVP AE  YTIIV
Sbjct  116  EFTIEDPVADVTVKPATKQTVEIIIYEKCTIVWELRVVGWEVSYGAEFVPNAENGYTIIV  175

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            +K+ K+ P DE ++SNS+K    GK++L  DN T K+K+LLYR K +  D
Sbjct  176  QKATKMSPTDEPVVSNSFKVTELGKILLKIDNPTPKKKRLLYRFKIEPLD  225



>ref|XP_008783367.1| PREDICTED: patellin-3-like [Phoenix dactylifera]
Length=581

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FTT D  TE TIKP+SK T+E PV E C +VWE RV+GW+V+YG+EFVP AE  YT+IV
Sbjct  469  DFTTSDAVTEVTIKPSSKQTVEIPVAETCLVVWELRVLGWEVSYGAEFVPDAEDGYTVIV  528

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   D+ ++  S+K    GKVVL  DN TSK+KKLLYRSK K S
Sbjct  529  QKTRKLAATDDPVVKTSFKVGEPGKVVLIVDNPTSKKKKLLYRSKAKSS  577



>ref|XP_008442083.1| PREDICTED: patellin-3-like [Cucumis melo]
Length=570

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF T D  TE T+KP++KH++E+PV + C + WE RV+GWDV YG+EFVP+ EG+YT+I+
Sbjct  460  EFETCDSVTEITVKPSAKHSVEYPVAQGCAVTWEVRVVGWDVNYGAEFVPSGEGSYTVII  519

Query  185  EKSRKIGPA--DETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKG  328
            +K+R++G +  D  +ISN++K    GKVVL+ DN TSK+KKLLYR KTK 
Sbjct  520  DKARRVGSSSQDHPVISNTFKISEPGKVVLSVDNPTSKKKKLLYRFKTKS  569



>ref|XP_010683337.1| PREDICTED: patellin-3 [Beta vulgaris subsp. vulgaris]
Length=579

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    YEFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTII  181
            +EF+  D  TE TIKP SKH IEF  +E+  LVWE RVIGWDV+YG+EF+P  EG YT+ 
Sbjct  469  HEFSPADTVTEVTIKPGSKHPIEFAFSEETELVWELRVIGWDVSYGAEFLPTKEGGYTLN  528

Query  182  VEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            + K +K+ PADE +I +++K    GKVV+T DNQ+SK+KKLLYRSK K S
Sbjct  529  IAKPKKVTPADEPVICDTFKVTEPGKVVITIDNQSSKKKKLLYRSKVKTS  578



>ref|XP_002456720.1| hypothetical protein SORBIDRAFT_03g041370 [Sorghum bicolor]
 gb|EES01840.1| hypothetical protein SORBIDRAFT_03g041370 [Sorghum bicolor]
Length=580

 Score =   136 bits (342),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT D  TE TIKP+SK TIE PVTE  T+VWE RV+GW+V+YG+EF P AEG YT+IV
Sbjct  470  EFTTSDIVTELTIKPSSKETIEIPVTENSTIVWELRVLGWEVSYGAEFTPDAEGGYTVIV  529

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +KSRK+   +E I+  S+K    GK+VLT +N  SK+KKLLYRSK K +
Sbjct  530  QKSRKVPANEEPIMKGSFKVGEPGKLVLTVNNPASKKKKLLYRSKVKST  578



>ref|XP_008378744.1| PREDICTED: patellin-3-like [Malus domestica]
 ref|XP_008347858.1| PREDICTED: patellin-3-like [Malus domestica]
Length=515

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DP  + TIKP +K T+E  + EKCT+VWE RV+GW+V+YG+EFVP AE  YTII+
Sbjct  402  EFTIADPVADVTIKPATKQTVEIIIYEKCTIVWELRVVGWEVSYGAEFVPEAENGYTIII  461

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            +K+ K+ P DE ++SNS+K    GK++L  DN TSK+K+LLYR K +  D
Sbjct  462  QKATKMSPTDEPVVSNSFKVGELGKILLKIDNPTSKKKRLLYRFKIEPLD  511



>ref|XP_004146380.1| PREDICTED: patellin-3-like [Cucumis sativus]
 gb|KGN54828.1| Patellin-3 [Cucumis sativus]
Length=568

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 85/111 (77%), Gaps = 3/111 (3%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D  TE T+KP++KHT+E+PVT+ C + WE RV+GWDV YG+EFVP+ EG+YT+I+
Sbjct  457  EFEACDSVTEITVKPSAKHTVEYPVTQGCAVTWEVRVVGWDVNYGAEFVPSGEGSYTVII  516

Query  185  EKSRKIGPA---DETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKG  328
            +K+R++G +    + +ISN++K    GKVVL+ DN TSK+KKLLYR KTK 
Sbjct  517  DKARRVGSSSQDQQPVISNTFKISEPGKVVLSVDNPTSKKKKLLYRFKTKS  567



>ref|XP_004970742.1| PREDICTED: patellin-1-like [Setaria italica]
Length=597

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT D  TE TIKP+SK T+E PVTE  T+VWE RV+GW+V+YG+EF P AEG YT+IV
Sbjct  487  EFTTSDAVTELTIKPSSKETVEIPVTENSTIVWELRVLGWEVSYGAEFTPEAEGGYTVIV  546

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K    GK+VLT +N  SK+KKLLYRSK K +
Sbjct  547  QKTRKVPANEEPIMKGSFKVGEPGKLVLTINNPASKKKKLLYRSKVKST  595



>ref|XP_010909147.1| PREDICTED: patellin-3-like isoform X1 [Elaeis guineensis]
Length=589

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 82/110 (75%), Gaps = 1/110 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEK-CTLVWEARVIGWDVAYGSEFVPAAEGAYTII  181
            +FT+ D  TE TIKP+SK T+E PV+E+ C LVWE RV+GW+V YG+EFVP+AE  YT+I
Sbjct  476  DFTSADAVTEVTIKPSSKQTVEIPVSEQTCLLVWELRVLGWEVIYGAEFVPSAEDGYTVI  535

Query  182  VEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            V+K RK+   DE ++   +K    GKVVLT DN TSK+KKLLYRSK K S
Sbjct  536  VQKMRKLAATDEPVMKAFFKVGEPGKVVLTIDNPTSKKKKLLYRSKAKSS  585



>gb|EPS60308.1| hypothetical protein M569_14495, partial [Genlisea aurea]
Length=384

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 87/110 (79%), Gaps = 4/110 (4%)
 Frame = +2

Query  2    YEFTTGDPATEDTIKPTSKHTIEFPVTEK--CTLVWEARVIGWDVAYGSEFVPAAEGAYT  175
            ++F+  DPATE+ +KPTSKHTIE PV+ +   +++WEARVIGWDV YG+EFVP  EG+YT
Sbjct  272  HQFSPTDPATEEILKPTSKHTIEIPVSSERSGSVIWEARVIGWDVRYGAEFVPNGEGSYT  331

Query  176  IIVEKSRKIGPADET-IISNSYKTDCAGKVVLTFDNQTS-KRKKLLYRSK  319
             IV+K+RKI P DE  ++S S+K   AGK+VLTFDNQ S K+KKL+YR K
Sbjct  332  WIVDKARKIDPTDERFVVSYSFKIAEAGKIVLTFDNQLSRKKKKLIYRFK  381



>ref|XP_010910883.1| PREDICTED: patellin-3-like isoform X2 [Elaeis guineensis]
Length=575

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FTT D   E TIKP+ K T+E PVTE C +VWE RV+GW+V+YG+EFVP AE  YT+IV
Sbjct  463  DFTTSDAVAEVTIKPSFKQTVEIPVTEPCLVVWELRVLGWEVSYGAEFVPNAEDGYTVIV  522

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E ++  S+K    GKVVL  DN TSK+KKLLYRSK K S
Sbjct  523  QKTRKLAATEEPVVKASFKVSEPGKVVLIVDNPTSKKKKLLYRSKAKSS  571



>ref|XP_009404974.1| PREDICTED: patellin-3-like [Musa acuminata subsp. malaccensis]
Length=604

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FTT D  TE TIKP+SK +IE PV E   LVWE RV+GW+V+YG+EFVP+AE  YT+IV
Sbjct  492  DFTTADAVTEVTIKPSSKQSIEIPVPETTLLVWELRVLGWEVSYGAEFVPSAEDGYTVIV  551

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   DE +I  S+K    GKVVL  +N TSK+KKLLYRSK K S
Sbjct  552  QKTRKLIATDEPVIKTSFKIGEPGKVVLNIENPTSKKKKLLYRSKAKSS  600



>gb|EMS62735.1| Patellin-5 [Triticum urartu]
Length=312

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FTT D  TE TIK +SK  IE PVTE  T+VWE RV+GW+V++G+EF P AEGAYT+IV
Sbjct  199  DFTTSDSVTELTIKASSKEAIEIPVTENSTIVWELRVLGWEVSHGAEFTPDAEGAYTVIV  258

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K   AGK+VLT  N  SK+KKLLYRSK K S
Sbjct  259  QKTRKVPANEEPIMKGSFKAGEAGKIVLTVSNAASKKKKLLYRSKVKSS  307



>dbj|BAJ87818.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=580

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FTT D  TE TIK +SK  IE PVTE  T+VWE RV+GW+V+YG+EF P AEGAYT+IV
Sbjct  468  DFTTSDSVTELTIKASSKEAIEIPVTENSTIVWELRVLGWEVSYGAEFTPDAEGAYTVIV  527

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K   AGK+VLT  N  SK+KKLLYRSK K S
Sbjct  528  QKTRKVPANEEPIMKGSFKASEAGKIVLTISNAASKKKKLLYRSKVKSS  576



>ref|XP_003564746.1| PREDICTED: patellin-3-like [Brachypodium distachyon]
Length=585

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT D  TE TIK +SK TIE PVTE  T+VWE RV+GW+V+YG+EF P AEG YT+IV
Sbjct  473  EFTTSDSVTELTIKASSKETIEIPVTENSTIVWELRVLGWEVSYGAEFTPDAEGGYTVIV  532

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K   +GK+VLT +N  SK+KKLLYRSK K +
Sbjct  533  QKTRKVPANEEPIMKGSFKVSESGKIVLTINNPASKKKKLLYRSKVKST  581



>emb|CDM85203.1| unnamed protein product [Triticum aestivum]
Length=578

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FTT D  TE TIK +SK TIE PVTE  T+VWE RV+GW+V++G+EF P AEGAYT+IV
Sbjct  465  DFTTSDSVTELTIKASSKETIEIPVTENSTIVWELRVLGWEVSHGAEFTPDAEGAYTVIV  524

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K   AGK+VLT  N  SK+KKLLYRSK K S
Sbjct  525  QKTRKVPANEEPIMKGSFKAGEAGKIVLTISNAASKKKKLLYRSKVKSS  573



>ref|XP_002521798.1| Patellin-5, putative [Ricinus communis]
 gb|EEF40608.1| Patellin-5, putative [Ricinus communis]
Length=587

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DPATE T+KP +K T+E  + EKC +VWE RV+GWDV+YG+EF P A+ AYT+I+
Sbjct  477  EFTVADPATEITVKPATKQTVEIIIYEKCVIVWELRVVGWDVSYGAEFAPDAKDAYTVII  536

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSK  319
            +K  K+ P DE +I++S+K    GK++LT DN TSK+KKLLYR K
Sbjct  537  QKPTKLSPTDEPVITSSFKVGELGKILLTVDNPTSKKKKLLYRFK  581



>ref|XP_006473246.1| PREDICTED: patellin-3-like [Citrus sinensis]
Length=538

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DPATE T+KP +K  +E  + EKCT+VWE RV+GW+V+YG+EFVP A+  YTII+
Sbjct  430  EFTIDDPATEITVKPATKQNVEIIIYEKCTVVWEIRVVGWEVSYGAEFVPEAKDKYTIII  489

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K  K+ PADE ++   +K D  GK++LT DN TSK+KKLLYR K +
Sbjct  490  QKPTKLSPADEPVVCQRFKVDELGKILLTVDNPTSKKKKLLYRFKVE  536



>ref|XP_009385108.1| PREDICTED: patellin-3-like [Musa acuminata subsp. malaccensis]
Length=603

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  D AT+ +IKP+SK TIE P TE C LVWE RV+GW+V+YG+EF P+AE  YT+IV
Sbjct  491  DFTAADAATDVSIKPSSKQTIEMPATEACVLVWELRVLGWEVSYGAEFTPSAEDGYTVIV  550

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             K+RK+   DE +I  S+K    GKVVL+ DN TSK+K LLYR K K
Sbjct  551  HKTRKLAAVDEPVIKGSFKIGEPGKVVLSIDNPTSKKKLLLYRHKVK  597



>gb|EMT12738.1| hypothetical protein F775_27688 [Aegilops tauschii]
Length=424

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FTT D  TE TIK +SK TIE PVTE  T+VWE RV+GW+V++G+EF P AEGAYT+IV
Sbjct  306  DFTTSDSVTELTIKASSKETIEIPVTENSTIVWELRVLGWEVSHGAEFTPDAEGAYTVIV  365

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K   AGK+VLT  N  SK+KKLLYRSK K S
Sbjct  366  QKTRKVPANEEPIMKGSFKAGEAGKIVLTVSNAASKKKKLLYRSKVKCS  414



>gb|KDP27342.1| hypothetical protein JCGZ_20274 [Jatropha curcas]
Length=589

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DPATE T+KP +K T++  + EKC +VWE RV+GW+V+YG+EFVP A+ AYT+I+
Sbjct  479  EFTVADPATEITVKPGTKQTVQIIIYEKCVIVWEIRVVGWEVSYGAEFVPEAKDAYTVII  538

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K  K+ P DE +I++S+K    GK++LT DN TSK+KKLLYR K +
Sbjct  539  QKPTKLAPTDEPVITSSFKVGELGKILLTVDNSTSKKKKLLYRFKIQ  585



>ref|XP_009403697.1| PREDICTED: patellin-3-like [Musa acuminata subsp. malaccensis]
Length=576

 Score =   133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT+ D  TE TIKP+ +  IE  VTEKC LVWE RV+GW+V YG+EFVP +E  YT+IV
Sbjct  464  DFTSSDAVTEITIKPSMRQAIEIQVTEKCLLVWELRVLGWEVTYGAEFVPRSENGYTVIV  523

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K RK+  ADE ++  S+K   AGK+VLT  N  SKRKKLLYR K K S
Sbjct  524  QKERKLVAADEPVLKGSFKIGEAGKIVLTVHNSGSKRKKLLYRYKIKSS  572



>gb|EAY76673.1| hypothetical protein OsI_04628 [Oryza sativa Indica Group]
Length=610

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT D  TE TIKP+SK T+E PVTE  T+ WE RV+GW+V+YG+EF P AEG YT+IV
Sbjct  498  EFTTSDAVTELTIKPSSKETVEIPVTENSTIGWELRVLGWEVSYGAEFTPDAEGGYTVIV  557

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K    GK+VLT +N  SK+KKLLYRSK K +
Sbjct  558  QKTRKVPANEEPIMKGSFKVGEPGKIVLTINNPASKKKKLLYRSKVKST  606



>ref|XP_004299815.1| PREDICTED: patellin-3 [Fragaria vesca subsp. vesca]
Length=542

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DP  E TIKP +K T+E  + EKCT+VWE RV+GW+V+YG+EFVP ++GAYT+I+
Sbjct  433  EFTIADPVAEVTIKPGTKKTVEIIIYEKCTIVWELRVVGWEVSYGAEFVPDSQGAYTLII  492

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+ K+ P DE ++ + +K    GK++LT DN TSK+K+LLYR K + S
Sbjct  493  QKATKMNPTDEPVLHHRFKVSELGKILLTIDNPTSKKKRLLYRFKIEPS  541



>ref|XP_006466197.1| PREDICTED: patellin-3-like [Citrus sinensis]
Length=594

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D  TE T+KP +KHT+EFPVTE+C L WE RV+GW+V+YG+EFVP+ EG+YT+I+
Sbjct  470  EFAATDAVTEITVKPAAKHTVEFPVTEECHLTWEVRVVGWEVSYGAEFVPSTEGSYTVII  529

Query  185  EKSRKIGP-ADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K++K+   A++ ++ +S+K    GKVVLT DN TSK+KKLLYR + K
Sbjct  530  QKAKKLASNAEQPVVCDSFKIVEPGKVVLTIDNPTSKKKKLLYRYRLK  577



>ref|XP_006376221.1| hypothetical protein POPTR_0013s11060g [Populus trichocarpa]
 gb|ERP54018.1| hypothetical protein POPTR_0013s11060g [Populus trichocarpa]
Length=499

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DPAT+ T+KP +K T+E  + EKC LVWE RV+GW+V+Y +EF+P A+ AYTII+
Sbjct  389  EFTIADPATDITVKPATKQTVEIIIYEKCILVWELRVVGWEVSYSAEFMPEAKDAYTIII  448

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSK  319
             K  K+ P DE ++SNS+K    GK++LT DN TSK+KKLLYR K
Sbjct  449  TKPTKMSPTDEPVVSNSFKVGELGKILLTVDNPTSKKKKLLYRFK  493



>ref|NP_001044958.1| Os01g0874700 [Oryza sativa Japonica Group]
 dbj|BAB86220.1| P0648C09.9 [Oryza sativa Japonica Group]
 dbj|BAB92436.1| cytosolic factor-like protein [Oryza sativa Japonica Group]
 dbj|BAF06872.1| Os01g0874700 [Oryza sativa Japonica Group]
 dbj|BAG93276.1| unnamed protein product [Oryza sativa Japonica Group]
Length=613

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT D  TE TIKP+SK T+E PVTE  T+ WE RV+GW+V+YG+EF P AEG YT+IV
Sbjct  501  EFTTSDAVTELTIKPSSKETVEIPVTENSTIGWELRVLGWEVSYGAEFTPDAEGGYTVIV  560

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K    GK+VLT +N  SK+KKLLYRSK K +
Sbjct  561  QKTRKVPANEEPIMKGSFKVGEPGKIVLTINNPASKKKKLLYRSKVKST  609



>ref|XP_008368135.1| PREDICTED: patellin-3-like [Malus domestica]
Length=534

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DP  + T+KP +K T+E  + EKCT+VWE RV+GW+V+YG+EFVP AE  YTIIV
Sbjct  424  EFTIEDPVADVTVKPATKQTVEIIIYEKCTIVWELRVVGWEVSYGAEFVPNAENGYTIIV  483

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            +K+ K+ P DE ++SNS+K    GK++L  DN T K+K+LLYR K +  D
Sbjct  484  QKATKMSPTDEPVVSNSFKVTELGKILLKIDNPTPKKKRLLYRFKIEPLD  533



>ref|XP_002265124.2| PREDICTED: patellin-3 [Vitis vinifera]
Length=530

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F   DP TE T+KP++K T+E  V+E+C +VWE RV+GW+VAYG+EF+P AE  YT++V
Sbjct  420  DFGIADPVTEITVKPSTKQTVEILVSEQCVIVWEVRVVGWEVAYGAEFIPDAEDEYTVVV  479

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K+ K+ P D+ ++ NS+K    GK+V+T DN TSK+KKLLYR K K
Sbjct  480  QKATKMAPTDDPVMCNSFKIKELGKIVITIDNPTSKKKKLLYRFKVK  526



>gb|EAZ14338.1| hypothetical protein OsJ_04261 [Oryza sativa Japonica Group]
Length=595

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT D  TE TIKP+SK T+E PVTE  T+ WE RV+GW+V+YG+EF P AEG YT+IV
Sbjct  483  EFTTSDAVTELTIKPSSKETVEIPVTENSTIGWELRVLGWEVSYGAEFTPDAEGGYTVIV  542

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K    GK+VLT +N  SK+KKLLYRSK K +
Sbjct  543  QKTRKVPANEEPIMKGSFKVGEPGKIVLTINNPASKKKKLLYRSKVKST  591



>ref|XP_010534098.1| PREDICTED: patellin-3-like [Tarenaya hassleriana]
Length=518

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  DPATE T+KP +K T+E  + EKC +VWE RV+GW+V+Y +EFVP A GAYT+++
Sbjct  409  DFTMADPATEITVKPGTKQTVEIIIYEKCEMVWEIRVVGWEVSYTAEFVPEASGAYTMVI  468

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+ P+DE ++S+ +K    GKV+LT DN T K+KKLLYR K K
Sbjct  469  QKPRKMVPSDEPVVSHCFKVTQLGKVLLTVDNATPKKKKLLYRFKVK  515



>ref|XP_009379323.1| PREDICTED: LOW QUALITY PROTEIN: patellin-3-like [Pyrus x bretschneideri]
Length=516

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DP  + TIKP +K T+E  + EKCT+VWE RV+GW+V+ G+EFVP AE  YTII+
Sbjct  407  EFTIADPVADVTIKPATKQTVEIIIYEKCTIVWELRVVGWEVSCGAEFVPEAENGYTIII  466

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSK  319
            +K+ K  P DE ++SNS+K D  GK++L  DN TSK+K+LLYR K
Sbjct  467  QKATKTSPTDEPVVSNSFKVDELGKILLKIDNPTSKKKRLLYRFK  511



>ref|XP_009362429.1| PREDICTED: patellin-3-like [Pyrus x bretschneideri]
Length=527

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DP  + T+KP +K T+E  + EKCT+VWE RV+GW+V+YG+EFVP AE  YTII+
Sbjct  417  EFTIEDPVADVTVKPATKQTVEIIIYEKCTIVWELRVVGWEVSYGAEFVPEAENGYTIII  476

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            +K+ K+ P DE ++SNS+K    GK++L  DN T K+K+LLYR K +  D
Sbjct  477  QKATKMSPIDEPVVSNSFKVTELGKILLKIDNPTPKKKRLLYRFKIEPLD  526



>gb|KDO84003.1| hypothetical protein CISIN_1g009270mg [Citrus sinensis]
Length=538

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DPATE T+KP +K  +E  + EKCT+VWE RV+GW+V+YG+EFVP A+  YTII+
Sbjct  430  EFTIDDPATEITVKPATKQNVEIIIYEKCTVVWEIRVVGWEVSYGAEFVPEAKDKYTIII  489

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K  K+ P DE ++   +K D  GK++LT DN TSK+KKLLYR K +
Sbjct  490  QKPTKLSPTDEPVVCQRFKVDELGKILLTVDNPTSKKKKLLYRFKVE  536



>ref|XP_006434671.1| hypothetical protein CICLE_v10000804mg [Citrus clementina]
 gb|ESR47911.1| hypothetical protein CICLE_v10000804mg [Citrus clementina]
Length=538

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DPATE T+KP +K  +E  + EKCT+VWE RV+GW+V+YG+EFVP A+  YTII+
Sbjct  430  EFTIDDPATEITVKPATKQNVEIIIYEKCTVVWEIRVVGWEVSYGAEFVPEAKDKYTIII  489

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K  K+ P DE ++   +K D  GK++LT DN TSK+KKLLYR K +
Sbjct  490  QKPTKLSPTDEPVVCQRFKVDELGKILLTVDNPTSKKKKLLYRFKVE  536



>emb|CAN80423.1| hypothetical protein VITISV_013162 [Vitis vinifera]
Length=591

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F   DP TE T+KP++K T+E  V+E+C +VWE RV+GW+VAYG+EF+P AE  YT++V
Sbjct  420  DFGIADPVTEITVKPSTKQTVEILVSEQCVIVWEVRVVGWEVAYGAEFIPDAEDEYTVVV  479

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKT  322
            +K+ K+ P D+ ++ NS+K    GK+V+T DN TSK+KKLLYR KT
Sbjct  480  QKATKMAPTDDPVMCNSFKIKELGKIVITIDNPTSKKKKLLYRFKT  525



>emb|CBI39340.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F   DP TE T+KP++K T+E  V+E+C +VWE RV+GW+VAYG+EF+P AE  YT++V
Sbjct  308  DFGIADPVTEITVKPSTKQTVEILVSEQCVIVWEVRVVGWEVAYGAEFIPDAEDEYTVVV  367

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSK  319
            +K+ K+ P D+ ++ NS+K    GK+V+T DN TSK+KKLLYR K
Sbjct  368  QKATKMAPTDDPVMCNSFKIKELGKIVITIDNPTSKKKKLLYRFK  412



>ref|XP_010910878.1| PREDICTED: patellin-3-like isoform X1 [Elaeis guineensis]
Length=576

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 81/110 (74%), Gaps = 1/110 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEK-CTLVWEARVIGWDVAYGSEFVPAAEGAYTII  181
            +FTT D   E TIKP+ K T+E PVTE+ C +VWE RV+GW+V+YG+EFVP AE  YT+I
Sbjct  463  DFTTSDAVAEVTIKPSFKQTVEIPVTEQPCLVVWELRVLGWEVSYGAEFVPNAEDGYTVI  522

Query  182  VEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            V+K+RK+   +E ++  S+K    GKVVL  DN TSK+KKLLYRSK K S
Sbjct  523  VQKTRKLAATEEPVVKASFKVSEPGKVVLIVDNPTSKKKKLLYRSKAKSS  572



>ref|XP_010231340.1| PREDICTED: patellin-3-like isoform X2 [Brachypodium distachyon]
Length=527

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+T D  TE T+KP+SK TIE P TE  T+VWE RV+GW+V+YG EF P AEG YT+IV
Sbjct  415  EFSTSDAVTELTVKPSSKETIEIPATENSTVVWELRVLGWEVSYGVEFTPDAEGGYTVIV  474

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  ++K    GKVVLT +N TS++KKLLYR K K S
Sbjct  475  QKTRKVPANEEPIMKGNFKVTEPGKVVLTVNNPTSRKKKLLYRFKVKSS  523



>ref|XP_011099658.1| PREDICTED: patellin-3-like [Sesamum indicum]
Length=521

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F   D  TE  IKP++KH +EFPV + C + WEARV+GW+V YG+EFVP+A   YTII+
Sbjct  411  DFGLADSVTEIIIKPSAKHIVEFPVPQACDVSWEARVVGWEVGYGAEFVPSAADGYTIII  470

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K R+IG ++E +I +SYK    GK+VL  +N +SK+KKLLYR KTK S
Sbjct  471  QKMRRIGTSEEQVICSSYKVGEPGKMVLAINNLSSKKKKLLYRFKTKSS  519



>ref|XP_009410675.1| PREDICTED: patellin-3-like [Musa acuminata subsp. malaccensis]
Length=564

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT D  TE TIK +SK +IE P TE   LVWE RV GW+V+YG+EF+P+AE  YT+IV
Sbjct  452  EFTTADAVTEVTIKASSKQSIEIPATEATLLVWELRVSGWEVSYGAEFMPSAEDGYTVIV  511

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   DE +I  S+K    GKVVL  +N TSK+KKLLYRSK K S
Sbjct  512  QKTRKLVATDEPVIKTSFKIGEPGKVVLNIENPTSKKKKLLYRSKAKSS  560



>ref|XP_003568397.1| PREDICTED: patellin-3-like isoform X1 [Brachypodium distachyon]
Length=592

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+T D  TE T+KP+SK TIE P TE  T+VWE RV+GW+V+YG EF P AEG YT+IV
Sbjct  480  EFSTSDAVTELTVKPSSKETIEIPATENSTVVWELRVLGWEVSYGVEFTPDAEGGYTVIV  539

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  ++K    GKVVLT +N TS++KKLLYR K K S
Sbjct  540  QKTRKVPANEEPIMKGNFKVTEPGKVVLTVNNPTSRKKKLLYRFKVKSS  588



>ref|XP_006645095.1| PREDICTED: patellin-1-like [Oryza brachyantha]
Length=605

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT D  TE TIK +SK T+E P +E  T+VWE RV+GW+V+YG+EF P AEG YT+IV
Sbjct  493  EFTTSDAVTELTIKASSKETVEIPASENSTIVWELRVLGWEVSYGAEFTPDAEGGYTVIV  552

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K    GK+VLT +N  SK+KKLLYRSK K +
Sbjct  553  QKTRKVPANEEPIMKGSFKVGEPGKIVLTINNAASKKKKLLYRSKVKST  601



>gb|EPS65885.1| hypothetical protein M569_08890, partial [Genlisea aurea]
Length=554

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF++ D A E+ IKP SKH IE PV+E  T+VWE RVIG DV YG+EFVP AEG+YT IV
Sbjct  446  EFSSADSAVEEIIKPASKHAIEIPVSEPGTVVWEVRVIGSDVIYGAEFVPDAEGSYTWIV  505

Query  185  EKSRKIGPADE-TIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKG  328
            +K+RK+ P++E  +I  S+K    GKVV+TF+NQ SK+KKL+YR K K 
Sbjct  506  QKARKMSPSEEQQLIFYSFKIGETGKVVVTFENQNSKKKKLVYRFKIKN  554



>ref|XP_009105873.1| PREDICTED: patellin-1-like [Brassica rapa]
Length=558

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  8    FTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVE  187
             T GD  TE  +KP +K+TIE P +E CTL WE RV+G DV+YG++F P  EG+Y +IV 
Sbjct  448  LTNGDTVTEAIVKPAAKYTIELPASEACTLSWELRVLGADVSYGAQFEPTTEGSYVVIVS  507

Query  188  KSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            K+RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LYR KT+
Sbjct  508  KNRKIGLTDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLYRFKTQ  553



>ref|XP_011003950.1| PREDICTED: patellin-3 [Populus euphratica]
Length=566

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DPAT+ T+KP +K T+E  + EKC LVWE RV+GW+V+Y +EF+P ++ AY II+
Sbjct  456  EFTIADPATDITVKPATKQTVEIIIYEKCILVWELRVVGWEVSYSAEFMPESKDAYAIII  515

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSK  319
             K  K+ P DE ++SNS+K    GK++LT DN TSK+KKLLYR K
Sbjct  516  TKPTKMSPTDEPVVSNSFKVGELGKILLTVDNPTSKKKKLLYRFK  560



>ref|XP_006306912.1| hypothetical protein CARUB_v10008471mg [Capsella rubella]
 gb|EOA39810.1| hypothetical protein CARUB_v10008471mg [Capsella rubella]
Length=694

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  8    FTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVE  187
            FT  D  TE  +KPTSK+TI+ P TE  TL WE RV+G DV+YG++F P+ E +YT+IV 
Sbjct  588  FTVEDGVTEAVVKPTSKYTIDLPATEGSTLSWELRVLGADVSYGAQFEPSNEASYTVIVT  647

Query  188  KSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKG  328
            K+RKIG  DE +I++S+K    GKVV+T DNQTSK+KK+LYRSKT+ 
Sbjct  648  KNRKIGLTDEPVITDSFKASEPGKVVITIDNQTSKKKKVLYRSKTQA  694



>gb|EPS65571.1| hypothetical protein M569_09207, partial [Genlisea aurea]
Length=400

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  DPATE  IKP++K T+E  V EKCT+VWE RV+GW+V Y +EF+P +E  YT+I+
Sbjct  292  DFSMDDPATELAIKPSTKQTVEIIVNEKCTIVWELRVVGWEVGYSAEFLPESERGYTVII  351

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKT  322
            EK+R++ P+DE ++SN +  +  GK++L  +N T KRK+LLYR K 
Sbjct  352  EKARRMSPSDEPVVSNRFVVNEVGKILLIVNNPTPKRKQLLYRFKV  397



>ref|XP_011031504.1| PREDICTED: patellin-3 [Populus euphratica]
 ref|XP_011031505.1| PREDICTED: patellin-3 [Populus euphratica]
Length=589

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DPATE T+KP +K T+E  + EKC +VWE RV+GW+V+Y +EFVP ++ AYTII+
Sbjct  479  EFTIADPATEITVKPATKQTVEIIIYEKCFIVWELRVVGWEVSYSAEFVPDSKDAYTIII  538

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSK  319
             K  K+ P +E ++SNS+K    GK++LT DN TSK+KKLLYR K
Sbjct  539  TKPTKMTPTNEPVVSNSFKVGELGKILLTVDNSTSKKKKLLYRFK  583



>ref|NP_001150957.1| LOC100284590 [Zea mays]
 gb|ACG41076.1| patellin-1 [Zea mays]
Length=567

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT D  +E TIKP+SK T+E PVTE  T+VWE RV+ W+V+YG+EF P AEG YT+IV
Sbjct  457  EFTTSDTVSELTIKPSSKETVEIPVTENSTIVWELRVLSWEVSYGAEFTPDAEGGYTVIV  516

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K    GK+VLT +N  SK+K LLYRSK K +
Sbjct  517  QKTRKVPANEEPIMKGSFKAGEPGKLVLTVNNPASKKKTLLYRSKVKSA  565



>ref|XP_006416189.1| hypothetical protein EUTSA_v10007015mg [Eutrema salsugineum]
 gb|ESQ34542.1| hypothetical protein EUTSA_v10007015mg [Eutrema salsugineum]
Length=660

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +2

Query  8    FTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVE  187
            FT  D  TE  +K ++KHTIE P TE CTL WE RV+G DV+YG++F P  E +YT+IV 
Sbjct  554  FTVEDGVTEVVVKSSAKHTIELPATEACTLSWELRVLGVDVSYGAQFEPTNEASYTVIVS  613

Query  188  KSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKG  328
            K+RKIG  DE +I++S+K    GK+V+T DNQT K+KKLLYR KT+G
Sbjct  614  KNRKIGLTDEPVITDSFKASEPGKIVITIDNQTFKKKKLLYRFKTQG  660



>emb|CDX96377.1| BnaA07g29880D [Brassica napus]
Length=556

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +2

Query  11   TTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVEK  190
            T GD  TE  +KP +K+TIE P +E CTL WE RV+G DV+YG++F P  EG+Y +IV K
Sbjct  447  TNGDTVTEAIVKPAAKYTIELPASEACTLSWELRVLGADVSYGAQFEPTTEGSYVVIVSK  506

Query  191  SRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LYR KT+
Sbjct  507  NRKIGLTDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLYRFKTQ  551



>dbj|BAD95021.1| cytosolic factor [Arabidopsis thaliana]
Length=111

 Score =   121 bits (303),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  D A+E T+KP +K T+E  + EKC LVWE RV GW+V+Y +EFVP  + AYT+++
Sbjct  3    DFSLEDSASEITVKPGTKQTVEIIIYEKCELVWEIRVTGWEVSYKAEFVPEEKDAYTVVI  62

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+ P+DE ++++S+K +  GKV+LT DN TSK+KKL+YR   K
Sbjct  63   QKPRKMRPSDEPVLTHSFKVNELGKVLLTVDNPTSKKKKLVYRFNVK  109



>ref|XP_010543667.1| PREDICTED: patellin-5-like [Tarenaya hassleriana]
Length=423

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  D ATE TIKPT+K T+E  + EKCT+VWE RV+GW+V YG+EF+P    AYT+I+
Sbjct  313  EFTRDDTATEITIKPTTKQTVEIIIYEKCTIVWELRVVGWEVTYGAEFLPENREAYTVII  372

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+   DE ++S S+K    GK++LT DN T+K+KKL+YR K K
Sbjct  373  QKPRKMSSEDEPVVSQSFKVGELGKILLTIDNPTAKKKKLVYRFKVK  419



>gb|ACN27998.1| unknown [Zea mays]
 tpg|DAA56595.1| TPA: putative patellin family protein [Zea mays]
Length=571

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT D  +E TIKP+SK T+E PVTE  T+VWE RV+ W+V+YG+EF P AEG YT+IV
Sbjct  461  EFTTSDTVSELTIKPSSKETVEIPVTENSTIVWELRVLSWEVSYGAEFTPDAEGGYTVIV  520

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K    GK+VLT +N  SK+K LLYRSK K +
Sbjct  521  QKTRKVPANEEPIMKGSFKAGEPGKLVLTVNNPASKKKTLLYRSKVKST  569



>ref|NP_001276245.1| patellin-3-like [Glycine max]
 gb|ACU22967.1| unknown [Glycine max]
Length=424

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  DP TE  IKPT+K T+E  + EKC +VWE RV+GW+V+Y +EF P  E AYT+I+
Sbjct  314  DFTMSDPVTEIPIKPTTKQTVEIAIYEKCIIVWELRVVGWEVSYNAEFKPDVEDAYTVII  373

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K+ K+ P DE ++SNS+K    GK++LT DN T K+K+LLYR K K
Sbjct  374  QKATKMSPTDEPVVSNSFKVVELGKLLLTIDNPTLKKKRLLYRFKIK  420



>ref|XP_007131298.1| hypothetical protein PHAVU_011G002200g [Phaseolus vulgaris]
 gb|ESW03292.1| hypothetical protein PHAVU_011G002200g [Phaseolus vulgaris]
Length=478

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FTT DP TE +IKPT+K T+E  + EKC +VWE RV+GW+V+Y +EF P A+ AYT+++
Sbjct  368  DFTTSDPVTELSIKPTTKQTVEIAIYEKCIIVWELRVVGWEVSYNAEFKPDAKDAYTVVI  427

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K+ K+ P DE ++SNS+K    GK++LT DN T K+K+LLYR   K
Sbjct  428  QKATKMSPTDEPVVSNSFKVGELGKLLLTIDNPTLKKKRLLYRFMIK  474



>ref|XP_002325536.2| hypothetical protein POPTR_0019s10810g [Populus trichocarpa]
 gb|EEE99917.2| hypothetical protein POPTR_0019s10810g [Populus trichocarpa]
Length=531

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DPATE T+KP +K T+E  + EKC +VWE RV+GW+V+Y +EFVP ++ AYTII+
Sbjct  421  EFTFADPATEITVKPATKQTVEIIIYEKCFIVWELRVVGWEVSYSAEFVPDSKDAYTIIM  480

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSK  319
             K  K+ P +E ++SNS+K    GK++LT DN TSK+KKLLYR K
Sbjct  481  TKPTKMTPTNEPVVSNSFKVGELGKILLTVDNSTSKKKKLLYRFK  525



>emb|CDX68278.1| BnaA07g23180D [Brassica napus]
Length=439

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  DPA+E T+KP +K T+E  + EKC +VWE RVIGW+V+Y +EFVP  + AYT++V
Sbjct  331  DFSLDDPASEVTVKPGTKQTVEIIIYEKCEIVWEIRVIGWEVSYKAEFVPEEKDAYTVVV  390

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+ PADE +++ S+K +  GKV+LT DN TSK+KKL+YR   K
Sbjct  391  QKPRKMKPADEPVLTQSFKVNELGKVLLTVDNPTSKKKKLVYRFNVK  437



>ref|XP_004961988.1| PREDICTED: patellin-2-like [Setaria italica]
Length=638

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+T D  TE T+KP+SK TIE P TE  T+VWE RV+GW+V+YG+EF P AEG YT+IV
Sbjct  526  EFSTSDAVTELTVKPSSKETIEIPATENSTVVWELRVLGWEVSYGAEFTPDAEGGYTVIV  585

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K    GKVVL  +N  SK+KKLLYR K K +
Sbjct  586  QKTRKVPAHEEPIMKGSFKVSEPGKVVLIVNNPASKKKKLLYRFKVKST  634



>gb|KHG01147.1| Patellin-3 -like protein [Gossypium arboreum]
 gb|KHG12050.1| Patellin-3 -like protein [Gossypium arboreum]
Length=598

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+  DPATE T+KP +K T+E  + EKC LVWE RV+GW+V+YG+EFVP A+ +Y +I+
Sbjct  488  EFSDADPATEMTVKPGTKQTVEITIFEKCILVWEIRVVGWEVSYGAEFVPDAKDSYAVII  547

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K  K+   DE ++S S+K    GKV+LT DN TSK+KKLLYR K K
Sbjct  548  QKPTKMTAKDEPVVSQSFKVGELGKVLLTVDNPTSKKKKLLYRFKVK  594



>ref|XP_011001253.1| PREDICTED: patellin-3-like [Populus euphratica]
Length=606

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF T D  TE T+KP++KHT+EFPVTE C L WE RV+GWDV+YG+EFVP+AE +YT+I+
Sbjct  496  EFGTADAVTEITVKPSAKHTVEFPVTETCLLTWEMRVVGWDVSYGAEFVPSAEDSYTVII  555

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDN  280
            +K+RK+   +E ++SNS+K    GKVVLT DN
Sbjct  556  QKARKVATTEEPVVSNSFKVGEPGKVVLTIDN  587



>ref|XP_011015061.1| PREDICTED: patellin-3-like [Populus euphratica]
Length=606

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF T D  TE T+KP++KHT+EFPVTE C L WE RV+GWDV+YG+EFVP+AE +YT+I+
Sbjct  496  EFGTADAVTEITVKPSAKHTVEFPVTETCLLTWEMRVVGWDVSYGAEFVPSAEDSYTVII  555

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDN  280
            +K+RK+   +E ++SNS+K    GKVVLT DN
Sbjct  556  QKARKVATTEEPVVSNSFKVGEPGKVVLTIDN  587



>ref|XP_009104870.1| PREDICTED: patellin-3-like [Brassica rapa]
Length=504

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  DPA+E T+KP +K T+E  + EKC +VWE RVIGW+V+Y +EFVP  + AYT++V
Sbjct  396  DFSLDDPASEVTVKPGTKQTVEIIIYEKCEIVWEIRVIGWEVSYKAEFVPEEKDAYTVVV  455

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+ PADE +++ S+K +  GKV+LT DN TSK+KKL+YR   K
Sbjct  456  QKPRKMKPADEPVLTQSFKVNELGKVLLTVDNPTSKKKKLVYRFNVK  502



>emb|CDY50441.1| BnaC06g24230D [Brassica napus]
Length=485

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  DPA+E T+KP +K T+E  + EKC +VWE RVIGW+V+Y +EFVP  + AYT++V
Sbjct  377  DFSLDDPASEVTVKPGTKQTVEIIIYEKCEIVWEIRVIGWEVSYKAEFVPEEKDAYTVVV  436

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+ PADE +++ S+K +  GKV+LT DN TSK+KKL+YR   K
Sbjct  437  QKPRKMKPADEPVLTQSFKVNELGKVLLTVDNPTSKKKKLVYRFNVK  483



>ref|XP_011096149.1| PREDICTED: patellin-3 [Sesamum indicum]
Length=552

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 81/110 (74%), Gaps = 5/110 (5%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTE-----KCTLVWEARVIGWDVAYGSEFVPAAEGA  169
            EFT  DPATE TIKP +K T+E  V E     KCTLVWE RV+GW+V+Y +E+VP AE  
Sbjct  437  EFTVDDPATEITIKPATKQTVEIIVNELCENEKCTLVWELRVVGWEVSYSAEYVPNAERG  496

Query  170  YTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSK  319
            YT+I++K+RK+ P DE ++S+S+     GK++LT DN ++K+KKLLYR K
Sbjct  497  YTVIIQKTRKMLPTDEPVVSSSFNVTELGKILLTIDNPSAKKKKLLYRFK  546



>ref|XP_007020120.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020121.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020122.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020123.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020124.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020125.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020126.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17345.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17346.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17347.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17348.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17349.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17350.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY17351.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
Length=611

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   DPATE T+KP +K T+E  + EKC LVWE RV+GW+V+YG+EF+P A+ +YT+I+
Sbjct  498  EFGDADPATEITVKPGTKQTVEITIYEKCDLVWEIRVVGWEVSYGAEFMPNAKDSYTVII  557

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K  K+ P DE ++S  +K    GKV+LT DN TSK+KKL+YR K K
Sbjct  558  QKPTKMSPKDEPVVSQCFKVGELGKVLLTVDNPTSKKKKLVYRFKVK  604



>gb|KJB60043.1| hypothetical protein B456_009G288100 [Gossypium raimondii]
Length=556

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+  DPATE T+KP +K T+E  + E+C LVWE RV+GW+V+YG+EFVP A+ +Y +I+
Sbjct  446  EFSDADPATEMTVKPGTKQTVEITIFERCILVWEIRVVGWEVSYGAEFVPDAKDSYAVII  505

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K  K+   DE ++S S+K    GKV+LT DN TSK+KKLLYR K K
Sbjct  506  QKPTKMTAKDEPVVSQSFKVGELGKVLLTVDNPTSKKKKLLYRFKVK  552



>gb|KJB60040.1| hypothetical protein B456_009G288100 [Gossypium raimondii]
 gb|KJB60044.1| hypothetical protein B456_009G288100 [Gossypium raimondii]
Length=593

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+  DPATE T+KP +K T+E  + E+C LVWE RV+GW+V+YG+EFVP A+ +Y +I+
Sbjct  483  EFSDADPATEMTVKPGTKQTVEITIFERCILVWEIRVVGWEVSYGAEFVPDAKDSYAVII  542

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K  K+   DE ++S S+K    GKV+LT DN TSK+KKLLYR K K
Sbjct  543  QKPTKMTAKDEPVVSQSFKVGELGKVLLTVDNPTSKKKKLLYRFKVK  589



>ref|XP_008657015.1| PREDICTED: patellin-3-like [Zea mays]
 gb|AFW84436.1| putative patellin family protein [Zea mays]
Length=556

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFTT D  TE TIKP+SK TIE PVTE   +VWE RV+GW+V+Y +EF P  EG YT+I+
Sbjct  446  EFTTLDTVTELTIKPSSKETIEIPVTENSAIVWELRVLGWEVSYSAEFTPDTEGGYTVII  505

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K+RK+   +E I+  S+K    GK+VLT +N  SK+KKLLYRSK K
Sbjct  506  QKTRKVPANEEPIMKGSFKVGEPGKLVLTVNNPASKKKKLLYRSKVK  552



>ref|XP_008219012.1| PREDICTED: patellin-3 [Prunus mume]
Length=538

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DP  + T+K  +K T+E  + EKCT+VWE RV+GWDV+YG+EFVP  E  Y II+
Sbjct  428  EFTIADPVADVTVKAGTKQTVEIIIYEKCTIVWELRVVGWDVSYGTEFVPDTENGYIIII  487

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGSD  334
            +KS K+ P DE ++ NS+K    GK++L  DN TSK+K+LLYR K +  D
Sbjct  488  QKSTKMSPTDEPVVQNSFKVGELGKILLKIDNPTSKKKRLLYRFKIEPFD  537



>gb|EMT14507.1| hypothetical protein F775_26247 [Aegilops tauschii]
Length=312

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+T D  TE T+KP+SK T+E P TE  T+VWE RV+GW+V+YG EF P AEG YT+IV
Sbjct  199  EFSTSDGVTELTVKPSSKETVEIPATENSTVVWELRVLGWEVSYGVEFTPDAEGGYTVIV  258

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K    GKVVL  +N TSK+KKLL R K K S
Sbjct  259  QKTRKVPANEEPIMKGSFKAGEPGKVVLIVNNPTSKKKKLLCRFKVKSS  307



>gb|EYU22783.1| hypothetical protein MIMGU_mgv1a004079mg [Erythranthe guttata]
Length=545

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 80/105 (76%), Gaps = 2/105 (2%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DP TE T+KP +K  +E  V EKCTLVWE RV+GW+V+Y +E+VP +   YT+I+
Sbjct  437  EFTVDDPVTEITVKPATKQIVEIIVNEKCTLVWELRVVGWEVSYSAEYVPNS--GYTVII  494

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSK  319
            EK+RK+ P+DE +ISN++  +  GK++LT +N T+K+KKLLYR K
Sbjct  495  EKTRKLLPSDEPVISNNFNINELGKILLTINNPTAKKKKLLYRFK  539



>ref|XP_006390693.1| hypothetical protein EUTSA_v10018429mg [Eutrema salsugineum]
 gb|ESQ27979.1| hypothetical protein EUTSA_v10018429mg [Eutrema salsugineum]
Length=505

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  DPA+E T+KP +K T+E  + EKC +VWE RVIGW+V+Y +EFVP  + AYT++V
Sbjct  397  DFSLDDPASEVTVKPGTKQTVEIIIYEKCEIVWEIRVIGWEVSYKAEFVPEEKDAYTVVV  456

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+ PADE +++ ++K +  GKV+LT DN TSK+KKL+YR   K
Sbjct  457  QKPRKMKPADEPVLTQNFKVNELGKVLLTVDNPTSKKKKLVYRFNVK  503



>dbj|BAK04984.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=681

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+T D  TE T+KP+SK TIE P TE  T+VWE RV+GW+V+YG EF P AEG YT+IV
Sbjct  569  EFSTSDGVTELTVKPSSKETIEIPATENSTVVWELRVLGWEVSYGVEFTPDAEGGYTVIV  628

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K    GKV+LT +N TSK+KKLL R K K S
Sbjct  629  QKTRKVPANEEPIMKGSFKASEPGKVLLTVNNPTSKKKKLLCRFKVKSS  677



>ref|XP_002525405.1| Patellin-3, putative [Ricinus communis]
 gb|EEF36972.1| Patellin-3, putative [Ricinus communis]
Length=606

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF T D  TE TIKP  KHT+EFPV+E C L WE RV+GWDV YG+EFVP+AE +YT+I+
Sbjct  496  EFGTTDTVTEITIKPAGKHTVEFPVSEACLLTWEVRVVGWDVNYGAEFVPSAEQSYTVII  555

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+RKIG  +E ++ NS+K    GK+VLT DN TS
Sbjct  556  QKARKIGVTEEPVVCNSFKIGEPGKIVLTIDNPTS  590



>dbj|BAK01654.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=639

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+T D  TE T+KP+SK TIE P TE  T+VWE RV+GW+V+YG EF P AEG YT+IV
Sbjct  527  EFSTSDGVTELTVKPSSKETIEIPATENSTVVWELRVLGWEVSYGVEFTPDAEGGYTVIV  586

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K    GKV+LT +N TSK+KKLL R K K S
Sbjct  587  QKTRKVPANEEPIMKGSFKASEPGKVLLTVNNPTSKKKKLLCRFKVKSS  635



>ref|XP_007020128.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
9, partial [Theobroma cacao]
 gb|EOY17353.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
9, partial [Theobroma cacao]
Length=611

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   DPATE T+KP +K T+E  + EKC LVWE RV+GW+V+YG+EF+P A+ +YT+I+
Sbjct  498  EFGDADPATEITVKPGTKQTVEITIYEKCDLVWEIRVVGWEVSYGAEFMPNAKDSYTVII  557

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSK  319
            +K  K+ P DE ++S  +K    GKV+LT DN TSK+KKL+YR K
Sbjct  558  QKPTKMSPKDEPVVSQCFKVGELGKVLLTVDNPTSKKKKLVYRFK  602



>gb|EEE63805.1| hypothetical protein OsJ_18629 [Oryza sativa Japonica Group]
Length=465

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+T D  TE  IKP+SK T+E P TE  T+VWE RV+GW+V+YG+EF P AEG YT+IV
Sbjct  352  EFSTSDAVTELPIKPSSKETVEIPATENSTVVWELRVLGWEVSYGAEFTPDAEGGYTVIV  411

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK-LLYRSKTKGS  331
            +K+RK+   +E I+  S+K    GK+VLT DN  SK+KK LLYR K K S
Sbjct  412  QKTRKVPANEEPIMKGSFKVGEPGKIVLTVDNAASKKKKQLLYRFKVKSS  461



>ref|XP_002441147.1| hypothetical protein SORBIDRAFT_09g021240 [Sorghum bicolor]
 gb|EES19577.1| hypothetical protein SORBIDRAFT_09g021240 [Sorghum bicolor]
Length=624

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+T D  TE T+KP+SK TIE P TE  T+VWE RV+GW+V+YG+EF P AEG YT+IV
Sbjct  510  EFSTSDAVTELTVKPSSKETIEIPATENSTVVWELRVLGWEVSYGAEFTPDAEGGYTVIV  569

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K    GKVVL  +N  S +KKLLYR K K +
Sbjct  570  QKTRKVPAHEEPIMKGSFKVTEPGKVVLAVNNPASTKKKLLYRFKVKST  618



>gb|EEC79272.1| hypothetical protein OsI_20058 [Oryza sativa Indica Group]
Length=583

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+T D  TE  IKP+SK T+E P TE  T+VWE RV+GW+V+YG+EF P AEG YT+IV
Sbjct  470  EFSTSDAVTELPIKPSSKETVEIPATENSTVVWELRVLGWEVSYGAEFTPDAEGGYTVIV  529

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK-LLYRSKTKGS  331
            +K+RK+   +E I+  S+K    GK+VLT DN  SK+KK LLYR K K S
Sbjct  530  QKTRKVPANEEPIMKGSFKVGEPGKIVLTVDNAASKKKKQLLYRFKVKSS  579



>ref|NP_001055617.1| Os05g0429400 [Oryza sativa Japonica Group]
 gb|AAV59419.1| putative cellular retinaldehyde-binding/triple function [Oryza 
sativa Japonica Group]
 dbj|BAF17531.1| Os05g0429400 [Oryza sativa Japonica Group]
Length=585

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+T D  TE  IKP+SK T+E P TE  T+VWE RV+GW+V+YG+EF P AEG YT+IV
Sbjct  472  EFSTSDAVTELPIKPSSKETVEIPATENSTVVWELRVLGWEVSYGAEFTPDAEGGYTVIV  531

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK-LLYRSKTKGS  331
            +K+RK+   +E I+  S+K    GK+VLT DN  SK+KK LLYR K K S
Sbjct  532  QKTRKVPANEEPIMKGSFKVGEPGKIVLTVDNAASKKKKQLLYRFKVKSS  581



>gb|EYU20559.1| hypothetical protein MIMGU_mgv1a006872mg [Erythranthe guttata]
Length=428

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 81/111 (73%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLV-WEARVIGWDVAYGSEFVPAAEGAYTII  181
            EF   D  TE T+KP++KH +EFPVT+ C +V WEA V+GW+V YG+EFVP+AE  YTII
Sbjct  314  EFGASDSVTEVTVKPSAKHIVEFPVTQGCCVVSWEASVVGWEVRYGAEFVPSAENGYTII  373

Query  182  VEKSRKI---GPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            ++K RKI   G  D+ I SN Y+    GK++LT DN TS++KKLLYR KTK
Sbjct  374  IQKMRKINNNGGNDQVIRSN-YRVGEPGKLILTIDNLTSRKKKLLYRFKTK  423



>dbj|BAH57191.1| AT1G22530 [Arabidopsis thaliana]
Length=545

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +2

Query  8    FTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVE  187
            FT  D  TE  +K TSK+TI+ P TE  TL WE RV+G DV+YG++F P+ E +YT+IV 
Sbjct  439  FTVEDGVTEAVVKSTSKYTIDLPATEGSTLSWELRVLGADVSYGAQFEPSNEASYTVIVS  498

Query  188  KSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKG  328
            K+RK+G  DE +I++S+K   AGKVV+T DNQT K+KK+LYRSKT+ 
Sbjct  499  KNRKVGLTDEPVITDSFKASEAGKVVITIDNQTFKKKKVLYRSKTQA  545



>emb|CDY03655.1| BnaA02g15820D [Brassica napus]
Length=565

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = +2

Query  17   GDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVEKSR  196
            GD  TE  +KP +K+TIE P +E CTL WE RV+G DV YG++F P  EG+Y +IV K+R
Sbjct  458  GDSVTEAIVKPAAKYTIELPASEACTLSWELRVLGADVTYGAQFEPTTEGSYDVIVSKNR  517

Query  197  KIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            KIG  DE +I+ S+K    GK+V+T DNQTSK+KK+LYR KT+
Sbjct  518  KIGLTDEPVITGSFKAGEPGKIVITIDNQTSKKKKVLYRFKTQ  560



>ref|XP_011011644.1| PREDICTED: patellin-3-like [Populus euphratica]
Length=608

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF + D  TE T+KP +KHT+EFPVTE C L WE RV GWDV+YG+EFVP+AE +YT+I+
Sbjct  496  EFGSADAVTEITVKPAAKHTVEFPVTETCLLTWEVRVAGWDVSYGAEFVPSAEDSYTVII  555

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+RK+   +E ++ NS+K    GKVVLT DN TS
Sbjct  556  QKARKVAATEEPVVCNSFKIGEPGKVVLTIDNSTS  590



>dbj|BAD94747.1| putative cytosolic factor protein [Arabidopsis thaliana]
Length=228

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +2

Query  29   TEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVEKSRKIGP  208
            TE  +KP + +TIE P +E CTL WE RV+G DV+YG++F P  EG+Y +IV K+RKIG 
Sbjct  130  TEAIVKPAANYTIELPASEACTLSWELRVLGADVSYGAQFEPTTEGSYAVIVSKTRKIGS  189

Query  209  ADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             DE +I++S+K    GK+V+T DNQTSK+KK+LYR KT+
Sbjct  190  TDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLYRFKTQ  228



>ref|XP_006654435.1| PREDICTED: patellin-2-like [Oryza brachyantha]
Length=598

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 80/110 (73%), Gaps = 1/110 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+T D  TE T+KP+SK T+E P TE   +VWE RV+GW+V+YG+EF P AEG+YT+IV
Sbjct  485  EFSTSDVVTELTVKPSSKETVEIPATENSIVVWELRVLGWEVSYGAEFTPDAEGSYTVIV  544

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKK-LLYRSKTKGS  331
            +K+RK+   +E I+  S+K    GK+VLT DN  SK+KK LLYR K K S
Sbjct  545  QKTRKVPANEEPIMKGSFKVGDTGKIVLTIDNAASKKKKQLLYRFKVKSS  594



>ref|NP_173669.1| patellin 2 [Arabidopsis thaliana]
 sp|Q56ZI2.2|PATL2_ARATH RecName: Full=Patellin-2 [Arabidopsis thaliana]
 gb|AAF18525.1|AC006551_11 Unknown protein [Arabidopsis thaliana]
 gb|AAM14094.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91744.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30253.1| patellin 2 [Arabidopsis thaliana]
Length=683

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +2

Query  8    FTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVE  187
            FT  D  TE  +K TSK+TI+ P TE  TL WE RV+G DV+YG++F P+ E +YT+IV 
Sbjct  577  FTVEDGVTEAVVKSTSKYTIDLPATEGSTLSWELRVLGADVSYGAQFEPSNEASYTVIVS  636

Query  188  KSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKG  328
            K+RK+G  DE +I++S+K   AGKVV+T DNQT K+KK+LYRSKT+ 
Sbjct  637  KNRKVGLTDEPVITDSFKASEAGKVVITIDNQTFKKKKVLYRSKTQA  683



>ref|XP_003522462.1| PREDICTED: patellin-3-like [Glycine max]
 gb|KHN31218.1| Patellin-5 [Glycine soja]
Length=557

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D  TE T++P +KHT+EFPVTE   L WE RVIGWDV+YG+EFVP +EG+YT+I+
Sbjct  447  EFGISDAVTEITVRPAAKHTVEFPVTENSLLSWELRVIGWDVSYGAEFVPTSEGSYTVII  506

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+RK+  ++E ++ N+YK    GKVVLT DNQ+S
Sbjct  507  QKARKVASSEEPVLCNNYKIGEPGKVVLTIDNQSS  541



>ref|XP_007222319.1| hypothetical protein PRUPE_ppa003964mg [Prunus persica]
 gb|EMJ23518.1| hypothetical protein PRUPE_ppa003964mg [Prunus persica]
Length=537

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DP  + T+K  +K T+E  + EKCT+VWE RV+GWDV+YG+EFVP  E  Y II+
Sbjct  427  EFTIADPVADVTVKAGTKQTVEIIIYEKCTIVWELRVVGWDVSYGTEFVPDTENGYIIII  486

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSK  319
            +K+ K+ P DE ++ NS+K    GK++L  DN TSK+K+LLYR K
Sbjct  487  QKATKMSPTDEPVVQNSFKVGELGKILLKIDNPTSKKKRLLYRFK  531



>ref|XP_007024015.1| Patellin 1, putative [Theobroma cacao]
 gb|EOY26637.1| Patellin 1, putative [Theobroma cacao]
Length=190

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D  TE T+KP+ KHTIEFPVTE C L W+ RV+GWDV+YG+EF+P+AE +YT+I+
Sbjct  80   EFANTDAVTEITVKPSVKHTIEFPVTETCLLTWQVRVVGWDVSYGAEFIPSAEDSYTVII  139

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
             K+RK+   +E ++ N++K    GKV+LT DN TS
Sbjct  140  RKARKVASTEEPVVCNNFKIGEPGKVILTSDNPTS  174



>ref|XP_006390694.1| hypothetical protein EUTSA_v10018354mg [Eutrema salsugineum]
 gb|ESQ27980.1| hypothetical protein EUTSA_v10018354mg [Eutrema salsugineum]
Length=561

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  8    FTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVE  187
             TT D  TE  +KP +++TI+ P +E CTL WE RV+G DV+YG++F P  EG+Y +IV 
Sbjct  451  LTTEDTVTEAIVKPAAQYTIDLPASEACTLSWELRVLGADVSYGAQFEPTTEGSYAVIVS  510

Query  188  KSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            K+RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LYR KT+
Sbjct  511  KNRKIGLTDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLYRFKTQ  556



>ref|XP_009127905.1| PREDICTED: patellin-1-like [Brassica rapa]
Length=562

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = +2

Query  17   GDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVEKSR  196
            GD  TE  +KP +K+TIE P +E CTL WE RV+G DV YG++F P  EG+Y +IV K+R
Sbjct  455  GDSVTEAIVKPAAKYTIELPASEACTLSWELRVLGADVTYGAQFEPTTEGSYDVIVFKNR  514

Query  197  KIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            KIG  DE +I+ S+K    GK+V+T DNQTSK+KK+LYR KT+
Sbjct  515  KIGLTDEPVITGSFKVGEPGKIVITIDNQTSKKKKVLYRFKTQ  557



>ref|XP_010521168.1| PREDICTED: LOW QUALITY PROTEIN: patellin-3 [Tarenaya hassleriana]
Length=477

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  DPATE T+KP +K T+E  + EKC +VWE RV+GW+V+Y +EFVP     YT+++
Sbjct  367  DFTMSDPATEITVKPGTKQTVEIIIYEKCVIVWEMRVVGWEVSYTAEFVPEDREGYTVVI  426

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKG  328
             K RK+ P+DE +IS+S+K    GKV+LT DN T+K+KKL+YR   K 
Sbjct  427  HKPRKMVPSDEPLISHSFKVCDLGKVLLTVDNPTAKKKKLVYRFMVKA  474



>ref|XP_007049994.1| SEC14 cytosolic factor family protein / phosphoglyceride transfer 
family protein [Theobroma cacao]
 gb|EOX94151.1| SEC14 cytosolic factor family protein / phosphoglyceride transfer 
family protein [Theobroma cacao]
Length=612

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D  TE T+KP++KHT+EFPVTE C L WE RV+GWDV+YG+EFVP+AE +YT+I+
Sbjct  502  EFANTDAVTEITVKPSAKHTVEFPVTETCLLTWEVRVVGWDVSYGAEFVPSAEDSYTVII  561

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+RK+   +E ++ N++K    GKV+LT DN TS
Sbjct  562  QKARKVASTEEPVVCNNFKIGEPGKVILTIDNPTS  596



>ref|XP_004503864.1| PREDICTED: patellin-5-like [Cicer arietinum]
Length=557

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D  TE TI+P +KHT+EFPVTEKC L WE RVIGW+V+YG+EFVP+ EG+YT+I+
Sbjct  446  EFGDSDAVTEITIRPAAKHTVEFPVTEKCLLSWEVRVIGWEVSYGAEFVPSTEGSYTVII  505

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+R +  ++E +I N++K    GKVVLT DN +S
Sbjct  506  QKARNVASSEEPVICNNFKIGEPGKVVLTIDNTSS  540



>ref|XP_004169713.1| PREDICTED: patellin-3-like [Cucumis sativus]
Length=349

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F   D ATE +IKP++K T+E  + EKC + WE RV+GW+V+Y +EFVP  E AYT+I+
Sbjct  239  DFDASDQATEVSIKPSTKQTVEIIIYEKCIIAWELRVVGWEVSYSAEFVPNNEEAYTVII  298

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K+RK+   DE +IS+S++    GKV+ T DN TSK+KKL+YR K K
Sbjct  299  QKARKMAATDEPVISHSFQVFELGKVLFTIDNPTSKKKKLMYRFKVK  345



>ref|XP_002888860.1| SEC14 cytosolic factor family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65119.1| SEC14 cytosolic factor family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=497

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  D A+E T+KP +K T+E  + EKC LVWE RVIGW+V+Y +EFVP  + AYT+++
Sbjct  389  DFSLEDSASEITVKPGTKQTVEIIIYEKCELVWEIRVIGWEVSYKAEFVPEEKDAYTVVI  448

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+ P+DE ++++S+K +  GKV+LT DN TSK+KKL+YR   K
Sbjct  449  QKPRKMRPSDEPVLTHSFKVNELGKVLLTVDNPTSKKKKLVYRFNVK  495



>gb|KFK41635.1| hypothetical protein AALP_AA2G153200 [Arabis alpina]
Length=564

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  20   DPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVEKSRK  199
            D  TE  +KP +KHTIE P +E CTL WE RV+G DV+YG++F P +E +Y +IV K+RK
Sbjct  458  DSITEAIVKPAAKHTIELPASEACTLSWELRVLGADVSYGAQFEPTSEESYAVIVSKNRK  517

Query  200  IGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            IG  D+ +I++S+K    GK+V+T DNQTSK+KK+LYR KT+
Sbjct  518  IGLTDDQVITDSFKVGEPGKIVITIDNQTSKKKKVLYRFKTQ  559



>ref|XP_010414837.1| PREDICTED: patellin-3-like [Camelina sativa]
Length=492

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  D A+E T+KP +K T+E  + EKC LVWE RVIGW+V+Y +EFVP  + AYT+++
Sbjct  384  DFSLEDAASEITVKPGTKQTVEIIIYEKCELVWEIRVIGWEVSYKAEFVPEEKDAYTVVI  443

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+ P+DE ++++S+K +  GKV+LT DN TSK+KKL+YR   K
Sbjct  444  QKPRKMRPSDEPVLTHSFKVNELGKVLLTVDNPTSKKKKLVYRFNVK  490



>ref|XP_010471234.1| PREDICTED: patellin-3 [Camelina sativa]
Length=524

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  D A+E T+KP +K T+E  + EKC LVWE RVIGW+V+Y +EFVP  + AYT+++
Sbjct  416  DFSLEDAASEITVKPGTKQTVEIIIYEKCELVWEIRVIGWEVSYKAEFVPEEKDAYTVVI  475

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+ P+DE ++++S+K +  GKV+LT DN TSK+KKL+YR   K
Sbjct  476  QKPRKMRPSDEPVLTHSFKVNELGKVLLTVDNPTSKKKKLVYRFNVK  522



>ref|XP_006339368.1| PREDICTED: patellin-3-like [Solanum tuberosum]
Length=491

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT+ DP TE  +KP +K T+E  V EKC +VWE RV+GW+V Y +E+VP  +  YT+ +
Sbjct  381  EFTSNDPVTEIIVKPATKQTVEIIVNEKCIIVWELRVLGWEVTYSAEYVPNTDSGYTVNI  440

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+  ADE ++S+S+K    GK++LT DN TSK+KKLLYR K K
Sbjct  441  QKPRKMTTADEPVVSSSFKIVELGKILLTIDNPTSKKKKLLYRFKDK  487



>gb|KEH35657.1| patellin-3 protein [Medicago truncatula]
Length=573

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D  TE T++P +KH +EFPVTE C L WE RVIGWD++YG+EFVP++EG+YT+I+
Sbjct  462  EFGITDAVTEITVRPAAKHIVEFPVTENCLLSWELRVIGWDISYGAEFVPSSEGSYTVII  521

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+RKI  ++E ++ N+YK    GKVVLT DN +S
Sbjct  522  QKTRKIASSEEPVLCNNYKIGEPGKVVLTIDNSSS  556



>ref|XP_010428080.1| PREDICTED: patellin-3-like isoform X1 [Camelina sativa]
 ref|XP_010428081.1| PREDICTED: patellin-3-like isoform X2 [Camelina sativa]
Length=493

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  D A+E T+KP +K T+E  + EKC LVWE RVIGW+V+Y +EFVP  + AYT+++
Sbjct  385  DFSLEDAASEITVKPGTKQTVEIIIYEKCELVWEIRVIGWEVSYKAEFVPEEKDAYTVVI  444

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+ P+DE ++++S+K +  GKV+LT DN TSK+KKL+YR   K
Sbjct  445  QKPRKMRPSDEPVLTHSFKVNELGKVLLTVDNPTSKKKKLVYRFNVK  491



>ref|XP_006302172.1| hypothetical protein CARUB_v10020182mg [Capsella rubella]
 gb|EOA35070.1| hypothetical protein CARUB_v10020182mg [Capsella rubella]
Length=496

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  D A+E T+KP +K T+E  + EKC LVWE RVIGW+V+Y +EFVP  + AYT+++
Sbjct  388  DFSLEDAASEITVKPGTKQTVEIIIYEKCELVWEIRVIGWEVSYKAEFVPEEKDAYTVVI  447

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+ P+DE ++++S+K +  GKV+LT DN TSK+KKL+YR   K
Sbjct  448  QKPRKMRPSDEPVLTHSFKVNELGKVLLTVDNPTSKKKKLVYRFNVK  494



>ref|XP_004250635.1| PREDICTED: patellin-3 [Solanum lycopersicum]
Length=490

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT+ DP TE  +KP +K T+E  V EKC +VWE RV+GW+V Y +E+VP  +  YT+ +
Sbjct  380  EFTSNDPVTEIIVKPATKQTVEIIVNEKCIIVWELRVLGWEVTYSAEYVPNTDSGYTVNI  439

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+  ADE ++S+S+K    GK++LT DN TSK+KKLLYR K K
Sbjct  440  QKPRKMTTADEPVVSSSFKIVELGKILLTIDNPTSKKKKLLYRFKDK  486



>gb|KHN32467.1| Patellin-3 [Glycine soja]
Length=424

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT   P TE  IKPT+K T+E  + EKC +VWE RV+GW+V+Y +EF P  E AYT+I+
Sbjct  314  DFTMSYPVTEIPIKPTTKQTVEIAIYEKCIIVWELRVVGWEVSYNAEFKPDVEDAYTVII  373

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K+ K+ P DE +++NS+K    GK++LT DN T K+K+LLYR K K
Sbjct  374  QKATKMSPTDEPVVTNSFKVVELGKLLLTIDNPTLKKKRLLYRFKIK  420



>emb|CDY03654.1| BnaA02g15830D [Brassica napus]
Length=489

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  DPA+E  +KP +K T+E  + EKC +VWE RVIGW+V+Y +EFVP  + AYT++V
Sbjct  381  DFSLDDPASEVIVKPGTKQTVEIIIYEKCEIVWEIRVIGWEVSYKAEFVPEEKDAYTVVV  440

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+ P DE +++ S+K +  GKV+LT DN TSK+KKL+YR   K
Sbjct  441  QKPRKMKPFDEPVLTQSFKVNELGKVLLTVDNPTSKKKKLVYRFSVK  487



>ref|XP_010428078.1| PREDICTED: patellin-1 [Camelina sativa]
Length=575

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = +2

Query  11   TTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVEK  190
            TT +  TE  +KP   +TIE P +E CTL WE RV+G DV+YG++F P  EG+Y +IV K
Sbjct  468  TTVETVTEAIVKPAGNYTIELPASEACTLSWELRVLGADVSYGAQFEPTTEGSYAVIVSK  527

Query  191  SRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LYR KT+
Sbjct  528  TRKIGSTDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLYRFKTQ  572



>ref|XP_002893236.1| hypothetical protein ARALYDRAFT_472493 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69495.1| hypothetical protein ARALYDRAFT_472493 [Arabidopsis lyrata subsp. 
lyrata]
Length=676

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +2

Query  8    FTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVE  187
            FT  D  TE  +K TSK+TI+ P TE  TL WE RV+G DV+YG++F P+ E +YT+IV 
Sbjct  570  FTVEDGVTEAVVKSTSKYTIDLPATEGSTLSWELRVLGADVSYGAQFEPSNEASYTVIVS  629

Query  188  KSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKG  328
            K+RK+G  DE +I++S+K    GKVV+T DNQT K+KK+LYRSKT+ 
Sbjct  630  KNRKVGLTDEPVITDSFKASEPGKVVITIDNQTFKKKKVLYRSKTQA  676



>ref|XP_009127906.1| PREDICTED: patellin-3-like [Brassica rapa]
Length=496

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  DPA+E  +KP +K T+E  + EKC +VWE RVIGW+V+Y +EFVP  + AYT++V
Sbjct  388  DFSLDDPASEVIVKPGTKQTVEIIIYEKCEIVWEIRVIGWEVSYKAEFVPEEKDAYTVVV  447

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+ P DE +++ S+K +  GKV+LT DN TSK+KKL+YR   K
Sbjct  448  QKPRKMKPFDEPVLTQSFKVNELGKVLLTVDNPTSKKKKLVYRFSVK  494



>ref|XP_009402649.1| PREDICTED: patellin-3-like [Musa acuminata subsp. malaccensis]
Length=580

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+T D  T+ +IKP+SK TIE P TE C +VWE RV+G +V+YG+EF P+AE  YT+IV
Sbjct  468  DFSTADVVTDVSIKPSSKQTIEIPATETCLIVWELRVLGCEVSYGAEFTPSAEDGYTVIV  527

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   DE +I  S+K    GKVVL  +N TSK+K LLYR K K S
Sbjct  528  QKNRKLAADDEPVIKGSFKNGEPGKVVLNVENLTSKKKLLLYRYKVKSS  576



>ref|XP_002325736.2| hypothetical protein POPTR_0019s00780g [Populus trichocarpa]
 gb|EEF00118.2| hypothetical protein POPTR_0019s00780g [Populus trichocarpa]
Length=605

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF T D  TE T+K ++KHT+EFPVTE C L WE RV+GWDV+YG+EFVP AE +YT+I+
Sbjct  494  EFCTADAVTEITVKASAKHTVEFPVTETCLLTWEMRVVGWDVSYGAEFVPNAEDSYTVII  553

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDN  280
            +K+RK+   +E ++SNS+K    GKVVLT DN
Sbjct  554  QKARKVAITEEPVVSNSFKVGEPGKVVLTIDN  585



>emb|CDX90715.1| BnaA03g23950D [Brassica napus]
Length=310

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  D ATE T+KPT+K T+E  + E+CT+VWE RV+GW+V YG+EFVP  +  YT+I+
Sbjct  199  DFTHEDTATEITVKPTTKQTVEIIIYERCTIVWEIRVVGWEVMYGAEFVPENKEGYTVII  258

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+   DE ++S S+K    GK++L+ DN TS +K L+YR K K
Sbjct  259  QKPRKMASGDEPVVSQSFKVGEVGKILLSVDNPTSNKKILIYRFKVK  305



>ref|XP_006384383.1| hypothetical protein POPTR_0004s14530g [Populus trichocarpa]
 gb|ERP62180.1| hypothetical protein POPTR_0004s14530g [Populus trichocarpa]
Length=583

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF + D  TE T+KP +KHT+EFPVTE C L WE RV GWDV+Y +EFVP+AE +YT+I+
Sbjct  471  EFGSADAVTEITVKPAAKHTVEFPVTETCLLTWEVRVAGWDVSYSAEFVPSAEDSYTVII  530

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+RK+   +E ++ NS+K    GKVVLT DN TS
Sbjct  531  QKARKVAATEEPVVCNSFKIGEPGKVVLTIDNSTS  565



>ref|XP_010471233.1| PREDICTED: patellin-1-like [Camelina sativa]
Length=562

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = +2

Query  11   TTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVEK  190
            TT +  TE  +KP   +TIE P +E CTL WE RV+G DV+YG++F P  EG+Y +IV K
Sbjct  455  TTVETVTEAIVKPAGNYTIELPASEACTLSWELRVLGADVSYGAQFEPTIEGSYAVIVSK  514

Query  191  SRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LYR KT+
Sbjct  515  TRKIGSTDEPVITDSFKMGEPGKIVITIDNQTSKKKKVLYRFKTQ  559



>ref|XP_006387528.1| hypothetical protein POPTR_0895s00200g [Populus trichocarpa]
 gb|ERP46442.1| hypothetical protein POPTR_0895s00200g [Populus trichocarpa]
Length=605

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF T D  TE T+K ++KHT+EFPVTE C L WE RV+GWDV+YG+EFVP+A+ +YT+I+
Sbjct  494  EFCTADAVTEITVKASAKHTVEFPVTETCLLTWEMRVVGWDVSYGAEFVPSADDSYTVII  553

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDN  280
            +K+RK+   +E ++SNS+K    GKVVLT DN
Sbjct  554  QKARKVATTEEPVVSNSFKVGEPGKVVLTIDN  585



>emb|CDX82182.1| BnaC02g21080D [Brassica napus]
Length=575

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +2

Query  17   GDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVEKSR  196
            GD  TE  +KP +++TIE P +E C L WE RV+G DV YG++F P  EG+Y +IV K+R
Sbjct  468  GDSVTEAIVKPAAQYTIELPASEACALSWELRVLGADVTYGAQFEPTTEGSYDVIVSKNR  527

Query  197  KIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            KIG  DE +I+ S+K    GK+V+T DNQTSK+KK+LYR KT+
Sbjct  528  KIGLTDEPVITGSFKVGEPGKIVITIDNQTSKKKKVLYRFKTQ  570



>ref|XP_002887418.1| hypothetical protein ARALYDRAFT_895064 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63677.1| hypothetical protein ARALYDRAFT_895064 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +2

Query  14   TGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVEKS  193
            T +  TE  +KP + +TIE P +E CTL WE RV+G DV+YG++F P  EG+Y +IV K+
Sbjct  446  TQETITEAIVKPAANYTIELPASEACTLSWELRVLGADVSYGAQFEPTTEGSYAVIVSKT  505

Query  194  RKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LYR KT+
Sbjct  506  RKIGSTDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLYRFKTQ  549



>emb|CDX82180.1| BnaC02g21100D [Brassica napus]
Length=489

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  DPA+E  +KP +K T+E  + EKC +VWE RVIGW+V Y +EFVP  + AYT++V
Sbjct  381  DFSLEDPASEVIVKPGTKQTVEIIIYEKCEIVWEIRVIGWEVRYKAEFVPEEKDAYTVVV  440

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+ P DE +++ S+K +  GKV+LT DN TSK+KKL+YR   K
Sbjct  441  QKPRKMKPFDEPVLTQSFKVNELGKVLLTVDNPTSKKKKLVYRFNVK  487



>ref|XP_004138674.1| PREDICTED: patellin-3-like [Cucumis sativus]
 gb|KGN63050.1| hypothetical protein Csa_2G386180 [Cucumis sativus]
Length=530

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F   D ATE +IKP++K T+E  + EKC + WE RV+GW+V+Y +EFVP  E AYT+I+
Sbjct  420  DFDASDQATEVSIKPSTKQTVEIIIYEKCIIAWELRVVGWEVSYSAEFVPNNEEAYTVII  479

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K+RK+   DE +IS+S++    GKV+ T DN TSK+KKL+YR K K
Sbjct  480  QKARKMAATDEPVISHSFQVFELGKVLFTIDNPTSKKKKLMYRFKVK  526



>gb|AAK82462.1| At1g72160/T9N14_8 [Arabidopsis thaliana]
 gb|AAM91383.1| At1g72160/T9N14_8 [Arabidopsis thaliana]
Length=390

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  D A+E T+KP +K T+E  + EKC LVWE RV GW+V+Y +EFVP  + AYT+++
Sbjct  282  DFSLEDSASEITVKPGTKQTVEIIIYEKCELVWEIRVTGWEVSYKAEFVPEEKDAYTVVI  341

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+ P+DE ++++S+K +  GKV+LT DN TSK+KKL+YR   K
Sbjct  342  QKPRKMRPSDEPVLTHSFKVNELGKVLLTVDNPTSKKKKLVYRFNVK  388



>ref|NP_177360.1| patellin-1 [Arabidopsis thaliana]
 sp|Q56WK6.2|PATL1_ARATH RecName: Full=Patellin-1 [Arabidopsis thaliana]
 gb|AAG51793.1|AC067754_9 cytosolic factor, putative; 12503-14597 [Arabidopsis thaliana]
 gb|AAK76587.1| putative cytosolic factor [Arabidopsis thaliana]
 gb|AAM44913.1| putative cytosolic factor protein [Arabidopsis thaliana]
 gb|AEE35282.1| patellin-1 [Arabidopsis thaliana]
Length=573

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 78/106 (74%), Gaps = 5/106 (5%)
 Frame = +2

Query  23   PATEDTI-----KPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVE  187
            P TE+TI     KP + +TIE P +E CTL WE RV+G DV+YG++F P  EG+Y +IV 
Sbjct  468  PLTEETITEAIVKPAANYTIELPASEACTLSWELRVLGADVSYGAQFEPTTEGSYAVIVS  527

Query  188  KSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            K+RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LYR KT+
Sbjct  528  KTRKIGSTDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLYRFKTQ  573



>ref|XP_006302079.1| hypothetical protein CARUB_v10020065mg [Capsella rubella]
 gb|EOA34977.1| hypothetical protein CARUB_v10020065mg [Capsella rubella]
Length=567

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +2

Query  29   TEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVEKSRKIGP  208
            TE  +KP + +TIE P +E CTL WE RV+G DV+YG++F P  EG+Y +IV K+RKI  
Sbjct  464  TEAIVKPAANYTIELPASEACTLSWELRVLGADVSYGAQFEPTTEGSYAVIVSKTRKIAS  523

Query  209  ADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            ADE +I++S+K    GK+V+T DNQTSK+KK+LYR KT+
Sbjct  524  ADEPVITDSFKVGEPGKIVITIDNQTSKKKKVLYRFKTQ  562



>ref|XP_010535265.1| PREDICTED: patellin-1-like [Tarenaya hassleriana]
Length=615

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  8    FTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVE  187
            F T +  TE  +KP +K++I+ P +E CT+ WE RV+G DV+YG++F P+ EG+YT+IV 
Sbjct  506  FATEETVTEAIVKPAAKYSIDLPASEACTISWELRVLGSDVSYGAQFEPSTEGSYTVIVS  565

Query  188  KSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            K+RK+G  DE ++++++K    GKVV+T DNQ+SK+KKLLYR KT+
Sbjct  566  KNRKMGLTDEPVMTDAFKVGEPGKVVITIDNQSSKKKKLLYRFKTQ  611



>gb|KFK32084.1| hypothetical protein AALP_AA6G197400 [Arabis alpina]
Length=607

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  D ATE TIKP++K T+E  + EKCT+VWE RV+GW+V YG+EFVP  +  YT+I+
Sbjct  496  DFTHDDTATEITIKPSTKQTVEIIIYEKCTIVWEIRVVGWEVLYGAEFVPENKEGYTVII  555

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+   DE ++S S+K    GK++LT DN TS +K L+YR K K
Sbjct  556  QKPRKMAAKDEPVVSQSFKVGEVGKILLTVDNPTSSKKMLIYRFKVK  602



>gb|KCW69562.1| hypothetical protein EUGRSUZ_F029921, partial [Eucalyptus grandis]
Length=244

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  DPATE T+KP +K  +E  + EKC +VWE RV+GW+V+YG+EFVP + G +++ +
Sbjct  135  DFTVSDPATEMTVKPGTKQIVEIIIYEKCVIVWELRVVGWEVSYGAEFVPDS-GEFSVNI  193

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSK  319
            +K +K+ P DE ++  ++K    GKV+LT DN TSK+KKLLYR K
Sbjct  194  QKPKKMSPLDEPVVHGTFKVSELGKVLLTVDNPTSKKKKLLYRFK  238



>ref|XP_008441140.1| PREDICTED: patellin-3-like [Cucumis melo]
Length=530

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F   D ATE +IKP++K T+E  + EKC + WE RV+GW+V+Y +EFVP  E AYT+I+
Sbjct  420  DFDASDQATEVSIKPSTKQTVEIIIYEKCIIAWELRVVGWEVSYSAEFVPNNEEAYTVII  479

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K+RK+   DE +IS+S++    GKV+ T DN TSK+KKL+YR K K
Sbjct  480  QKTRKMAATDEPVISHSFQVFELGKVLFTIDNPTSKKKKLMYRFKVK  526



>ref|XP_010414836.1| PREDICTED: patellin-1-like [Camelina sativa]
Length=565

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +2

Query  29   TEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVEKSRKIGP  208
            TE  +KP   +TIE P +E CTL WE RV+G DV+YG++F P  EG+Y +IV K+RKIG 
Sbjct  464  TEAIVKPAGNYTIELPASEACTLSWELRVLGADVSYGAQFEPTTEGSYAVIVSKTRKIGS  523

Query  209  ADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             DE +I++S+K    GK+V+T DNQTSK+KK+LYR KT+
Sbjct  524  TDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLYRFKTQ  562



>ref|NP_177361.1| patellin-3 [Arabidopsis thaliana]
 sp|Q56Z59.2|PATL3_ARATH RecName: Full=Patellin-3 [Arabidopsis thaliana]
 gb|AAG51796.1|AC067754_12 cytosolic factor, putative; 19554-17768 [Arabidopsis thaliana]
 gb|AEE35283.1| patellin-3 [Arabidopsis thaliana]
Length=490

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  D A+E T+KP +K T+E  + EKC LVWE RV GW+V+Y +EFVP  + AYT+++
Sbjct  382  DFSLEDSASEITVKPGTKQTVEIIIYEKCELVWEIRVTGWEVSYKAEFVPEEKDAYTVVI  441

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+ P+DE ++++S+K +  GKV+LT DN TSK+KKL+YR   K
Sbjct  442  QKPRKMRPSDEPVLTHSFKVNELGKVLLTVDNPTSKKKKLVYRFNVK  488



>ref|XP_007159915.1| hypothetical protein PHAVU_002G278300g [Phaseolus vulgaris]
 gb|ESW31909.1| hypothetical protein PHAVU_002G278300g [Phaseolus vulgaris]
Length=583

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D  TE T++P +KHT+EF VTEKC L WE RVIGW+V+YG+EFVP +EG+YT+IV
Sbjct  472  EFGNTDAVTEITVRPAAKHTVEFSVTEKCLLSWELRVIGWEVSYGAEFVPDSEGSYTVIV  531

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+RK+  ++E ++ NS+K    GKVVLT DN +S
Sbjct  532  QKARKVASSEEPVVCNSFKVGEPGKVVLTIDNTSS  566



>ref|XP_010912526.1| PREDICTED: patellin-3-like [Elaeis guineensis]
Length=558

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT+ D   E TIKP++K  IE PVTEKC LVWE RV+GWDV YG+EFVP++E  YTIIV
Sbjct  446  DFTSADAVAEITIKPSAKQVIEIPVTEKCLLVWELRVLGWDVIYGAEFVPSSEDGYTIIV  505

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+RK+   DE +  NS+K   AGKVVLT DN +S
Sbjct  506  QKARKLVATDEPVEKNSFKIGEAGKVVLTVDNTSS  540



>ref|XP_008781563.1| PREDICTED: patellin-3-like isoform X2 [Phoenix dactylifera]
Length=546

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  D  TE  IKP++K  IE PV EKC LVWE RV+GWDV +G+EFVP++E  YT+IV
Sbjct  434  DFTAADAVTEIAIKPSTKQVIEIPVNEKCLLVWELRVLGWDVTFGAEFVPSSEDGYTVIV  493

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+RK+  ADE +  NS+K   AGKVVLT DN TS
Sbjct  494  QKARKLVAADEPVEKNSFKIGEAGKVVLTVDNTTS  528



>ref|XP_009389513.1| PREDICTED: patellin-3-like [Musa acuminata subsp. malaccensis]
Length=652

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+T D   E TIKP++K  IE PV E C LVWE RV+GWDV YG+EFVP+AE  YT+IV
Sbjct  540  DFSTADAVIETTIKPSTKQAIEIPVAESCILVWELRVLGWDVNYGAEFVPSAEDGYTVIV  599

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +KSRK+   DE ++ +S+K   AGKVVLT DN TSK+KKLLYR KTK S
Sbjct  600  QKSRKMVVTDEPVVKDSFKIGEAGKVVLTVDNTTSKKKKLLYRYKTKSS  648



>ref|XP_010064859.1| PREDICTED: patellin-3 [Eucalyptus grandis]
Length=274

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  DPATE T+KP +K  +E  + EKC +VWE RV+GW+V+YG+EFVP + G +++ +
Sbjct  165  DFTVSDPATEMTVKPGTKQIVEIIIYEKCVIVWELRVVGWEVSYGAEFVPDS-GEFSVNI  223

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSK  319
            +K +K+ P DE ++  ++K    GKV+LT DN TSK+KKLLYR K
Sbjct  224  QKPKKMSPLDEPVVHGTFKVSELGKVLLTVDNPTSKKKKLLYRFK  268



>ref|XP_010498725.1| PREDICTED: patellin-2 [Camelina sativa]
Length=705

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +2

Query  8    FTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVE  187
            F   D  TE  +K TS +TI+FP TE  TL WE RV+G DV+YG++F P+ E +YT+IV 
Sbjct  599  FAVEDGVTEAVVKSTSNYTIDFPATEGSTLSWELRVLGADVSYGAQFEPSNETSYTVIVS  658

Query  188  KSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKG  328
            K+RKIG  DE +I++S+K    GKVV+T DNQTSK+KK+LYR KT+ 
Sbjct  659  KNRKIGLTDEPVITDSFKASEPGKVVITIDNQTSKKKKVLYRFKTQA  705



>gb|KFK41636.1| hypothetical protein AALP_AA2G153300 [Arabis alpina]
Length=485

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  D A+E T+KP +K T+E  + EKC +VWE RVIGW+V+Y +EF P  + AYT+++
Sbjct  377  DFSLDDEASEVTVKPGTKQTVEIIIYEKCEIVWEIRVIGWEVSYKAEFAPEEKDAYTVVI  436

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+ P+DE +++ S+K +  GKV+LT DN TSK+KKL+YR   K
Sbjct  437  QKPRKMKPSDEPVLTQSFKVNELGKVLLTVDNPTSKKKKLVYRFNVK  483



>gb|KHN09674.1| Patellin-3 [Glycine soja]
Length=557

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D  TE T++  +KHT+EFPVTE   L WE RVIGWDV+YG+EFVP +EG+YT+I+
Sbjct  447  EFGISDAVTEITVRSAAKHTVEFPVTENSLLSWELRVIGWDVSYGAEFVPTSEGSYTVII  506

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+RK+  ++E ++ N+YK    GKVVLT DNQ+S
Sbjct  507  QKARKVASSEEPVLCNNYKIGEPGKVVLTIDNQSS  541



>ref|XP_010415949.1| PREDICTED: patellin-1-like isoform X2 [Camelina sativa]
Length=567

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +2

Query  11   TTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVEK  190
             T +  TE  +KP   +TIE P +E CTL WE RV+G DV+YG++F P  EG+Y +IV K
Sbjct  460  NTVETVTEVIVKPAGNYTIELPASEACTLSWELRVLGADVSYGAQFEPTIEGSYAVIVSK  519

Query  191  SRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +RKIG  DE +I++S+K    GK+V+T DNQTSK+KK+LYR KT+
Sbjct  520  TRKIGSTDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLYRFKTQ  564



>ref|XP_004506378.1| PREDICTED: patellin-3-like [Cicer arietinum]
Length=473

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  DP TE  +KPT+K T+E  + EKC +VWE RV+GW+V+Y +EF P A+  Y +I+
Sbjct  363  DFSMSDPITEIPVKPTTKQTVEIAIYEKCIIVWELRVVGWEVSYSAEFKPDAKDGYAVII  422

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K+ K+ P+DE ++S+S+K    GK+ LT DN T K+K+LLYR K K
Sbjct  423  QKATKMSPSDEPVVSSSFKVSELGKLFLTVDNPTLKKKRLLYRFKIK  469



>ref|XP_010415948.1| PREDICTED: patellin-1-like isoform X1 [Camelina sativa]
Length=562

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +2

Query  29   TEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVEKSRKIGP  208
            TE  +KP   +TIE P +E CTL WE RV+G DV+YG++F P  EG+Y +IV K+RKIG 
Sbjct  461  TEVIVKPAGNYTIELPASEACTLSWELRVLGADVSYGAQFEPTIEGSYAVIVSKTRKIGS  520

Query  209  ADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
             DE +I++S+K    GK+V+T DNQTSK+KK+LYR KT+
Sbjct  521  TDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLYRFKTQ  559



>ref|XP_010477513.1| PREDICTED: patellin-2-like [Camelina sativa]
Length=712

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +2

Query  8    FTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVE  187
            F   D  TE  +K TSK+TI+ P TE  TL WE RV+G DV+YG++F P+ E +YT+IV 
Sbjct  606  FAVEDGVTEAVVKSTSKYTIDLPATEGSTLSWELRVLGADVSYGAQFEPSNETSYTVIVS  665

Query  188  KSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKG  328
            K+RKIG  DE +I++S+K    GKVV+T DNQTSK+KK+LYR KT+ 
Sbjct  666  KNRKIGLTDEPVITDSFKASEPGKVVITIDNQTSKKKKVLYRFKTQA  712



>ref|XP_003532213.1| PREDICTED: patellin-3-like [Glycine max]
 gb|KHN16910.1| Patellin-5 [Glycine soja]
Length=575

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D  TE T++P +KHT+EF VTE C L WE RVIGW+V+YG+EFVP++EG+YT+IV
Sbjct  464  EFGNTDAVTEITVRPAAKHTVEFSVTENCLLSWELRVIGWEVSYGAEFVPSSEGSYTVIV  523

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+RK+  ++E ++ NS+K    GKVVLT DN +S
Sbjct  524  QKARKVASSEEPVLCNSFKVGEPGKVVLTIDNTSS  558



>emb|CDY05051.1| BnaC03g28490D [Brassica napus]
Length=694

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  D ATE T+KPT+K T+E  + E+CT+VWE RV+GW+V YG+EFVP  +  YT+I+
Sbjct  583  DFTHEDTATEITVKPTTKQTVEIIIYERCTIVWEIRVVGWEVMYGAEFVPENKEGYTVII  642

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+   DE ++S S+K    GK++LT DN TS +K L+YR K K
Sbjct  643  QKPRKMASGDEPVVSQSFKVGEVGKILLTVDNPTSNKKILIYRFKVK  689



>ref|XP_010460011.1| PREDICTED: patellin-2-like [Camelina sativa]
Length=714

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +2

Query  8    FTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVE  187
            F   D  TE  +K TSK+TI+ P TE  TL WE RV+G DV+YG++F P+ E +YT+IV 
Sbjct  608  FAVEDGVTEAVVKSTSKYTIDLPATEGSTLSWELRVLGADVSYGAQFEPSNETSYTVIVS  667

Query  188  KSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            K+RKIG  DE +I++S+K    GKVV+T DNQTSK+KK+LYR KT+
Sbjct  668  KNRKIGLTDEPVITDSFKASEPGKVVITIDNQTSKKKKVLYRFKTQ  713



>ref|XP_003526897.2| PREDICTED: patellin-1-like [Glycine max]
Length=606

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D  TE T++  +KHT+EFPVTE   L WE RVIGWDV+YG+EFVP +EG+YT+I+
Sbjct  496  EFGISDAVTEITVRSAAKHTVEFPVTENSLLSWELRVIGWDVSYGAEFVPTSEGSYTVII  555

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+RK+  ++E ++ N+YK    GKVVLT DNQ+S
Sbjct  556  QKARKVASSEEPVLCNNYKIGEPGKVVLTIDNQSS  590



>ref|NP_001131001.1| uncharacterized protein LOC100192106 [Zea mays]
 gb|ACF79422.1| unknown [Zea mays]
 gb|ACL54628.1| unknown [Zea mays]
 gb|AFW78093.1| putative patellin family protein [Zea mays]
Length=620

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+T D  TE T+KP+SK T+E P TE  T+VWE RV+GW+V+YG+EF P AEG YT+IV
Sbjct  510  EFSTSDAVTELTVKPSSKETVEIPATENSTVVWELRVLGWEVSYGAEFTPDAEGGYTVIV  569

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K    GK+VL  +N  S++KKLL R K + +
Sbjct  570  QKTRKVPAHEEPIMKGSFKATEPGKLVLGVNNPASRKKKLLCRFKVRSA  618



>ref|NP_192655.2| patellin-5 [Arabidopsis thaliana]
 sp|Q9M0R2.2|PATL5_ARATH RecName: Full=Patellin-5 [Arabidopsis thaliana]
 dbj|BAF01050.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82730.1| patellin-5 [Arabidopsis thaliana]
Length=668

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  D ATE T+KPT+K T+E  V EKCT+VWE RV+GW+V+YG+EFVP  +  YT+I+
Sbjct  557  DFTHDDIATEITVKPTTKQTVEIIVYEKCTIVWEIRVVGWEVSYGAEFVPENKEGYTVII  616

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+   +E ++S+S+K    G+++LT DN TS +K L+YR K K
Sbjct  617  QKPRKMTAKNELVVSHSFKVGEVGRILLTVDNPTSTKKMLIYRFKVK  663



>ref|XP_006397198.1| hypothetical protein EUTSA_v10028522mg [Eutrema salsugineum]
 gb|ESQ38651.1| hypothetical protein EUTSA_v10028522mg [Eutrema salsugineum]
Length=604

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  D ATE TIKPT+K T+E  V EKCT+VWE RV+GW+V YG+EFVP  +G YT+I+
Sbjct  493  DFTHDDTATEITIKPTTKQTVEIIVYEKCTIVWEIRVVGWEVLYGAEFVPENKGGYTVII  552

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+    E ++S S+K    GK++LT DN ++ +K L+YR K K
Sbjct  553  QKPRKMAAKVEPLVSQSFKVGEVGKILLTVDNPSTAKKMLIYRFKVK  599



>ref|XP_010534141.1| PREDICTED: patellin-2-like [Tarenaya hassleriana]
Length=838

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +2

Query  29   TEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVEKSRKIGP  208
            TE  +K  +K+TI+ P +E CTL WE RV+G DV+YG++F P+ EG+YT+IV K+RK+G 
Sbjct  736  TETIVKSAAKYTIDLPASEACTLTWELRVLGSDVSYGAQFEPSTEGSYTVIVSKNRKLGL  795

Query  209  ADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKT  322
             DE +I++S+K    GKVV+T DNQ+SK+KKLLYR KT
Sbjct  796  TDEPVITDSFKVGEPGKVVITIDNQSSKKKKLLYRFKT  833



>gb|EPS60309.1| hypothetical protein M569_14496, partial [Genlisea aurea]
Length=302

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  DPATE  IKP++K  +E  V E CT+VWE RV+GWDV Y +EFVP ++  YT+I+
Sbjct  196  DFSVDDPATELIIKPSTKQIVEIIVNEICTIVWELRVVGWDVGYSAEFVPESDQGYTVII  255

Query  185  EKSRKIGP-ADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKT  322
            +K RK+ P  DE ++SN +  +  GK++L  +N T K+K+LLYR K 
Sbjct  256  QKGRKMVPTTDEPVLSNRFNINEVGKILLIINNPTPKKKQLLYRFKV  302



>ref|XP_007137815.1| hypothetical protein PHAVU_009G157900g [Phaseolus vulgaris]
 gb|ESW09809.1| hypothetical protein PHAVU_009G157900g [Phaseolus vulgaris]
Length=558

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D  TE T++P +KHT+EFPV E   L WE RVIGWDV+YG+EFVP +EG+YT+I+
Sbjct  447  EFGISDAVTEITVRPAAKHTVEFPVAENSLLSWEIRVIGWDVSYGAEFVPCSEGSYTVII  506

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+ K+  ++E ++ N+YK    GKVVLT DNQ+S
Sbjct  507  QKAIKVASSEEPVLCNNYKIGEPGKVVLTIDNQSS  541



>emb|CBI21668.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF T D  TE T+KP +K T+EFPV E C L WE RV+GW+V+YG+EFVP+AE  YT+I+
Sbjct  288  EFGTADAVTEITVKPATKQTVEFPVNETCLLTWEVRVVGWEVSYGAEFVPSAEEGYTVII  347

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+RK+   +E ++ NS+K    GKVV+T DN TS
Sbjct  348  QKARKMAGNEEPVVCNSFKIGEPGKVVITIDNPTS  382



>ref|XP_010930773.1| PREDICTED: patellin-3-like [Elaeis guineensis]
Length=486

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  D  TE TIKP  K  IE P+ EKC LVWE RV+GWDV +G+EFVP++E  YT+IV
Sbjct  374  EFTAADAVTEITIKPLMKQLIEIPLNEKCLLVWELRVLGWDVTFGAEFVPSSEDGYTVIV  433

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+RK+   DE +  N +K   AGKVVLT DN TS
Sbjct  434  QKARKLVATDEPVEKNRFKIGEAGKVVLTVDNTTS  468



>ref|XP_003525154.1| PREDICTED: patellin-3-like [Glycine max]
 gb|KHN17431.1| Patellin-3 [Glycine soja]
Length=539

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D  TE T++P +KH++EF VTE C L WE RVIGW+V YG+EFVP++EG+YT+IV
Sbjct  428  EFGNIDAVTEITVRPAAKHSVEFSVTENCLLSWELRVIGWEVTYGAEFVPSSEGSYTVIV  487

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+RK+  ++E ++ NS+K    GKVVLT DN +S
Sbjct  488  QKARKVASSEEPVLCNSFKVGEPGKVVLTIDNTSS  522



>ref|XP_008807685.1| PREDICTED: patellin-3-like [Phoenix dactylifera]
Length=559

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  D  TE TIKP++K  +E PVTEKC LVWE RV+GWDV YG+EFVP +E  YTIIV
Sbjct  447  DFTAADAVTEITIKPSTKQVVEIPVTEKCLLVWELRVLGWDVTYGAEFVPTSEDGYTIIV  506

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+RK+   DE +  NS+K   AG+VVLT +N TS
Sbjct  507  QKARKLVATDEPMEKNSFKIGEAGEVVLTVNNTTS  541



>gb|KDP31746.1| hypothetical protein JCGZ_14978 [Jatropha curcas]
Length=603

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF T D  TE  +KP  KHT+EFPV+E C L WE RV+GWDV+Y +EFVP+ E +YT+I+
Sbjct  493  EFGTADAVTEIILKPAGKHTVEFPVSETCLLTWEVRVVGWDVSYEAEFVPSGEESYTVII  552

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+RK+   +E ++ NS+K    GKVVLT DN TS
Sbjct  553  QKARKVAANEEPVVCNSFKIGEPGKVVLTIDNPTS  587



>gb|ACJ85524.1| unknown [Medicago truncatula]
 gb|AFK44639.1| unknown [Medicago truncatula]
Length=465

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +F+  DP TE  +KP++K T+E  + EKC +VWE RV+GW+V+Y +EF P  + AY +I+
Sbjct  355  DFSINDPTTEIPVKPSTKQTVEIAIYEKCIIVWELRVVGWEVSYSAEFKPDDKDAYGVII  414

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K+ K+ P DE ++SNS+K    GK+ LT DN T K+K+LLYR K K
Sbjct  415  QKATKMTPTDEPVVSNSFKVAELGKLFLTVDNPTVKKKRLLYRFKIK  461



>ref|XP_002271899.2| PREDICTED: patellin-3-like [Vitis vinifera]
Length=576

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF T D  TE T+KP +K T+EFPV E C L WE RV+GW+V+YG+EFVP+AE  YT+I+
Sbjct  466  EFGTADAVTEITVKPATKQTVEFPVNETCLLTWEVRVVGWEVSYGAEFVPSAEEGYTVII  525

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K+RK+   +E ++ NS+K    GKVV+T DN TS
Sbjct  526  QKARKMAGNEEPVVCNSFKIGEPGKVVITIDNPTS  560



>ref|XP_009134136.1| PREDICTED: patellin-5 [Brassica rapa]
Length=698

 Score =   119 bits (299),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  D ATE T+KPT+K T+E  V E+CT+VWE RV+GW+V YG+EFVP  +  YT+I+
Sbjct  587  DFTHEDTATEITVKPTTKQTVEIIVYERCTIVWEIRVVGWEVMYGAEFVPENKEGYTVII  646

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+   DE ++S S+K    GK++LT DN TS +K L+YR K K
Sbjct  647  QKPRKVASGDEPVVSQSFKVGEVGKILLTVDNPTSNKKILIYRFKVK  693



>ref|XP_006426421.1| hypothetical protein CICLE_v10025217mg [Citrus clementina]
 gb|ESR39661.1| hypothetical protein CICLE_v10025217mg [Citrus clementina]
Length=596

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D  TE T+KP +KHT+EFPVTE+C L WE RV+GW+V+YG+EFVP+ EG+YT+I+
Sbjct  474  EFAATDAVTEITVKPAAKHTVEFPVTEECNLTWEVRVVGWEVSYGAEFVPSTEGSYTVII  533

Query  185  EKSRKIGP-ADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K++K+   A++ ++ +S+K    GKVVLT DN TS
Sbjct  534  QKAKKLASNAEQPVVCDSFKIVEPGKVVLTIDNPTS  569



>ref|XP_002872438.1| SEC14 cytosolic factor family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48697.1| SEC14 cytosolic factor family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=669

 Score =   118 bits (296),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  D ATE TIKPT+K T+E  V EKCT+VWE RV+GW+V+YG+EFVP  +  YT+I+
Sbjct  558  DFTHDDIATEITIKPTTKQTVEIIVYEKCTIVWEIRVVGWEVSYGAEFVPENKEGYTVII  617

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+   +E ++S+S+K    G+++LT DN TS +K L+YR K K
Sbjct  618  QKPRKMTAKNEPVVSHSFKVGEVGRILLTVDNPTSTKKMLIYRFKVK  664



>gb|KHG11540.1| Patellin-5 -like protein [Gossypium arboreum]
Length=544

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF T +  TE T+KP +KHT+EFPVTE C + WE RVIGW V+YG+EFVP+ E +Y +I+
Sbjct  432  EFATTETVTEITVKPAAKHTVEFPVTEACLVRWEVRVIGWGVSYGAEFVPSGENSYAVII  491

Query  185  EKSRKIGPA-DETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKT  322
            +K+RK+  + +E ++ +++K   AGKVVLT  N +SK+KKLLYR K+
Sbjct  492  QKARKVAASTEEPVVCDNFKVGEAGKVVLTIHNPSSKKKKLLYRFKS  538



>gb|KDO58730.1| hypothetical protein CISIN_1g007602mg [Citrus sinensis]
Length=596

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D  TE T+KP +KHT+EFPVTE+C L WE RV+GW+V+YG+EFVP+ EG+YT+I+
Sbjct  474  EFAATDAVTEITVKPAAKHTVEFPVTEECHLTWEVRVVGWEVSYGAEFVPSTEGSYTVII  533

Query  185  EKSRKIGP-ADETIISNSYKTDCAGKVVLTFDNQTS  289
            +K++K+   A++ ++ +S+K    GKVVLT DN TS
Sbjct  534  QKAKKLASNAEQPVVCDSFKIVEPGKVVLTIDNPTS  569



>ref|XP_010685643.1| PREDICTED: patellin-3 [Beta vulgaris subsp. vulgaris]
Length=505

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EFT  DPAT   +K  +K  +E   +EKC +VWE RV+GWDV Y +EFVP+A   YT+++
Sbjct  395  EFTVDDPATVLNLKTATKQFVEIICSEKCIIVWEVRVVGWDVTYSAEFVPSANDKYTVVM  454

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSK  319
            +K+ K+   D+ +IS S+K    GK+VLT DN T KRKKLLYR K
Sbjct  455  QKATKMTSNDDPVISGSFKVSEVGKIVLTVDNPTFKRKKLLYRYK  499



>emb|CDX68279.1| BnaA07g23190D [Brassica napus]
Length=531

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +2

Query  14   TGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVEKS  193
            T D  TE  +KP +K+TI+ P ++ C L WE RV+G DV+YG++F P  EG Y +IV K+
Sbjct  423  TEDTVTEAIVKPAAKYTIDLPASDACMLSWELRVLGADVSYGAQFEPTTEGNYAVIVSKN  482

Query  194  RKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKT  322
            R+I   DE +I+ S+K    GK+V+T DNQTSK+KK+LYR KT
Sbjct  483  RRIESTDEPVITESFKVGEPGKIVITIDNQTSKKKKVLYRFKT  525



>gb|AFW81858.1| putative patellin family protein [Zea mays]
Length=539

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 75/109 (69%), Gaps = 0/109 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF+  +   +  +KP+SK T+E P TE  T+VWE RV+GW+V+Y +EF P AEG YT+IV
Sbjct  425  EFSASNAVIKLIVKPSSKETVEVPATEGSTVVWELRVLGWEVSYDAEFTPDAEGGYTVIV  484

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K+RK+   +E I+  S+K    GKVVL  DN+ SK+K LLYR + K +
Sbjct  485  QKTRKVPAHEEPIMKGSFKAAGPGKVVLAVDNRASKKKMLLYRFRVKST  533



>ref|XP_010455330.1| PREDICTED: patellin-5-like [Camelina sativa]
Length=618

 Score =   115 bits (289),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  D ATE TIKP +K T+E  V EKCT+VWE RV+GW+V+Y +EFVP     YT+I+
Sbjct  507  DFTHDDVATEITIKPATKQTVEIIVYEKCTIVWEIRVVGWEVSYAAEFVPENNEGYTVII  566

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+   +E ++S S+K    G+++LT DN TS +K L+YR K K
Sbjct  567  QKPRKMATKNEPVVSQSFKVGEVGRILLTVDNPTSTKKMLIYRFKVK  613



>gb|KHG30248.1| Patellin-3 -like protein [Gossypium arboreum]
Length=574

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D  TE T+KP +KHT+EFPVTE C L WE RV+GW+V YG+EFVP+ E +YTII+
Sbjct  464  EFGNTDAVTEITVKPAAKHTVEFPVTEACLLTWEVRVVGWEVNYGAEFVPSGEDSYTIII  523

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +KS+K+G ++  ++ +++K    GKVVLT  N TS
Sbjct  524  QKSKKVGCSEGEVVCDNFKVGEPGKVVLTIHNPTS  558



>gb|KJB71407.1| hypothetical protein B456_011G121700 [Gossypium raimondii]
Length=576

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF   D  TE T+KP +KHT+EFPVTE C L WE RV+GW+V YG+EFVP+ E +YTII+
Sbjct  466  EFGNTDAVTEITVKPAAKHTVEFPVTEACLLTWEVRVVGWEVNYGAEFVPSGEDSYTIII  525

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            +KS+K+G ++  ++ +++K    GKVVLT  N TS
Sbjct  526  QKSKKVGCSEGEVVCDNFKVGEPGKVVLTIHNPTS  560



>ref|XP_010435861.1| PREDICTED: patellin-5-like [Camelina sativa]
Length=619

 Score =   115 bits (288),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 53/107 (50%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  D ATE TIKP +K T+E  V EKCT+VWE RV+GW+V+Y +EFVP  +  YT+I+
Sbjct  508  DFTHDDVATEITIKPATKQTVEIIVYEKCTIVWEIRVVGWEVSYAAEFVPENKEGYTVII  567

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+   +E ++S S+K    G+++L+ DN TS +K L+YR K K
Sbjct  568  QKPRKMAAKNEPVVSQSFKVGEVGRILLSVDNPTSTKKMLIYRFKVK  614



>gb|KFK44348.1| hypothetical protein AALP_AA1G246000 [Arabis alpina]
Length=609

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +2

Query  8    FTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVE  187
            F   D  TE  +K ++K TI+ P +E  TL WE RV+G DV+YG+ F P+ E +YT+IV 
Sbjct  503  FAVEDGVTEAVVKSSAKFTIDLPASEGSTLSWELRVLGVDVSYGAHFEPSNEASYTVIVS  562

Query  188  KSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            K+RKIG  DE +I++S+K    GKVV+T DNQT K+KKL+YR KT+
Sbjct  563  KNRKIGLTDEPVITDSFKASEPGKVVITIDNQTFKKKKLIYRFKTQ  608



>ref|XP_006287267.1| hypothetical protein CARUB_v10000458mg [Capsella rubella]
 gb|EOA20165.1| hypothetical protein CARUB_v10000458mg [Capsella rubella]
Length=630

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  D ATE TIKPT+K T+E  V EKCT+ WE RV+GW+V Y  E+VP  +  YT+I+
Sbjct  519  DFTHDDTATEITIKPTTKQTVEIIVYEKCTIAWEIRVVGWEVTYAVEYVPENKEGYTVII  578

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+   +E ++S S+K    G+++LT DN TS +K L+YR K K
Sbjct  579  QKPRKMAAKNEPVVSQSFKVGEVGRILLTVDNPTSTKKMLIYRFKVK  625



>dbj|BAD82082.1| cytosolic factor-like protein [Oryza sativa Japonica Group]
Length=331

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +2

Query  56   KHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVEKSRKIGPADETIISNS  235
            + T+E PVTE  T+ WE RV+GW+V+YG+EF P AEG YT+IV+K+RK+   +E I+  S
Sbjct  236  EETVEIPVTENSTIGWELRVLGWEVSYGAEFTPDAEGGYTVIVQKTRKVPANEEPIMKGS  295

Query  236  YKTDCAGKVVLTFDNQTSKRKKLLYRSKTKGS  331
            +K    GK+VLT +N  SK+KKLLYRSK K +
Sbjct  296  FKVGEPGKIVLTINNPASKKKKLLYRSKVKST  327



>ref|XP_009123116.1| PREDICTED: patellin-2 [Brassica rapa]
Length=706

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = +2

Query  8    FTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIVE  187
            F   D  TE  +K ++KH IE P +E  TL WE RV+G DV+YG++F P  E +YT+IV 
Sbjct  600  FAVEDGVTEAVVKSSAKHIIELPASEGSTLSWELRVLGADVSYGAQFEPTNEASYTVIVS  659

Query  188  KSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTKG  328
            K+RKIG  DE +I++S+K    GK+V+T DN T K+KK++YR KT+ 
Sbjct  660  KNRKIGLTDEPVITDSFKAGEPGKIVITIDNNTFKKKKVIYRFKTQA  706



>ref|XP_008781561.1| PREDICTED: patellin-3-like isoform X1 [Phoenix dactylifera]
Length=558

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 70/107 (65%), Gaps = 12/107 (11%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTE------------KCTLVWEARVIGWDVAYGSEF  148
            +FT  D  TE  IKP++K  IE PV E            KC LVWE RV+GWDV +G+EF
Sbjct  434  DFTAADAVTEIAIKPSTKQVIEIPVNEVRSLFLSPIHQMKCLLVWELRVLGWDVTFGAEF  493

Query  149  VPAAEGAYTIIVEKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTS  289
            VP++E  YT+IV+K+RK+  ADE +  NS+K   AGKVVLT DN TS
Sbjct  494  VPSSEDGYTVIVQKARKLVAADEPVEKNSFKIGEAGKVVLTVDNTTS  540



>ref|XP_010421836.1| PREDICTED: patellin-5 [Camelina sativa]
Length=622

 Score =   113 bits (283),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 53/107 (50%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            +FT  D ATE  IKP +K T+E  V EKCT+VWE RV+GW+V+Y +EFVP  +  YT+I+
Sbjct  511  DFTHDDVATEIAIKPATKQTVEIIVYEKCTIVWEIRVVGWEVSYAAEFVPENKEGYTVII  570

Query  185  EKSRKIGPADETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKTK  325
            +K RK+   +E ++S S+K    G+++LT DN TS +K L+YR K K
Sbjct  571  QKPRKMATKNEPVVSQSFKVGEVGRILLTVDNPTSTKKMLIYRFKVK  617



>gb|KJB18714.1| hypothetical protein B456_003G066500 [Gossypium raimondii]
Length=573

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = +2

Query  5    EFTTGDPATEDTIKPTSKHTIEFPVTEKCTLVWEARVIGWDVAYGSEFVPAAEGAYTIIV  184
            EF T +  TE T+K  +KHT+EFPVTE C + WE RVIGW V+YG+EFVP+ E +Y +I+
Sbjct  461  EFATTETVTEITVKLAAKHTVEFPVTEACLVRWEVRVIGWGVSYGAEFVPSGENSYAVII  520

Query  185  EKSRKIGPA-DETIISNSYKTDCAGKVVLTFDNQTSKRKKLLYRSKT  322
            +K+RK+  + +E ++ +++K   AGKVVLT  N +SK+KKLLYR K+
Sbjct  521  QKARKVAASTEEPVVCDNFKVGEAGKVVLTIHNPSSKKKKLLYRFKS  567



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660