BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS049A04

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABY40731.1|  FERONIA receptor-like kinase                            346   1e-114   Citrus trifoliata [hardy orange]
ref|XP_007033491.1|  Malectin/receptor-like protein kinase family...    358   2e-114   Theobroma cacao [chocolate]
ref|XP_011095158.1|  PREDICTED: receptor-like protein kinase FERONIA    350   3e-111   Sesamum indicum [beniseed]
ref|XP_009617447.1|  PREDICTED: receptor-like protein kinase FERONIA    350   4e-111   Nicotiana tomentosiformis
ref|XP_009791682.1|  PREDICTED: receptor-like protein kinase FERONIA    350   4e-111   Nicotiana sylvestris
ref|XP_006341293.1|  PREDICTED: receptor-like protein kinase FERO...    348   1e-110   Solanum tuberosum [potatoes]
ref|XP_004246282.1|  PREDICTED: receptor-like protein kinase FERONIA    348   2e-110   Solanum lycopersicum
gb|KJB29840.1|  hypothetical protein B456_005G120700                    348   2e-110   Gossypium raimondii
gb|KDO64141.1|  hypothetical protein CISIN_1g036624mg                   347   5e-110   Citrus sinensis [apfelsine]
gb|AAL40864.1|  receptor protein kinase-like protein                    341   5e-110   Capsicum annuum
ref|XP_006429617.1|  hypothetical protein CICLE_v10011034mg             347   5e-110   Citrus clementina [clementine]
gb|KJB71481.1|  hypothetical protein B456_011G124900                    341   3e-109   Gossypium raimondii
gb|KDP21852.1|  hypothetical protein JCGZ_00639                         338   4e-109   Jatropha curcas
ref|XP_002279218.3|  PREDICTED: receptor-like protein kinase FERONIA    343   8e-109   
ref|XP_011018979.1|  PREDICTED: receptor-like protein kinase FERONIA    325   1e-108   Populus euphratica
gb|EYU42039.1|  hypothetical protein MIMGU_mgv1a001343mg                341   2e-108   Erythranthe guttata [common monkey flower]
gb|KJB71482.1|  hypothetical protein B456_011G124900                    342   4e-108   Gossypium raimondii
ref|XP_002528705.1|  kinase, putative                                   342   5e-108   
ref|XP_002308259.1|  kinase family protein                              338   6e-107   
gb|KJB38065.1|  hypothetical protein B456_006G235700                    337   2e-106   Gossypium raimondii
ref|XP_010043538.1|  PREDICTED: receptor-like protein kinase FERONIA    335   1e-105   Eucalyptus grandis [rose gum]
ref|XP_010098025.1|  Receptor-like protein kinase FERONIA               334   3e-105   Morus notabilis
ref|XP_002323088.2|  kinase family protein                              332   2e-104   Populus trichocarpa [western balsam poplar]
ref|XP_008463270.1|  PREDICTED: receptor-like protein kinase FERONIA    331   6e-104   Cucumis melo [Oriental melon]
ref|XP_004142677.1|  PREDICTED: receptor-like protein kinase FERO...    331   6e-104   Cucumis sativus [cucumbers]
ref|XP_004302537.1|  PREDICTED: receptor-like protein kinase FERONIA    330   9e-104   Fragaria vesca subsp. vesca
ref|XP_008244701.1|  PREDICTED: receptor-like protein kinase FERONIA    330   2e-103   Prunus mume [ume]
ref|XP_009337788.1|  PREDICTED: receptor-like protein kinase FERONIA    328   6e-103   Pyrus x bretschneideri [bai li]
ref|XP_011016728.1|  PREDICTED: receptor-like protein kinase FERONIA    327   1e-102   Populus euphratica
emb|CDP06378.1|  unnamed protein product                                327   3e-102   Coffea canephora [robusta coffee]
ref|XP_007208402.1|  hypothetical protein PRUPE_ppa001164mg             326   3e-102   Prunus persica
ref|XP_011001679.1|  PREDICTED: receptor-like protein kinase FERONIA    325   2e-101   Populus euphratica
ref|XP_010683454.1|  PREDICTED: receptor-like protein kinase FERONIA    323   4e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010244547.1|  PREDICTED: receptor-like protein kinase FERONIA    320   6e-100   Nelumbo nucifera [Indian lotus]
ref|XP_004492579.1|  PREDICTED: receptor-like protein kinase FERO...    317   1e-98    Cicer arietinum [garbanzo]
ref|XP_010252026.1|  PREDICTED: receptor-like protein kinase FERONIA    317   1e-98    Nelumbo nucifera [Indian lotus]
ref|NP_001237656.1|  FERONIA receptor-like kinase precursor             316   2e-98    Glycine max [soybeans]
gb|KHN29489.1|  Receptor-like protein kinase FERONIA                    316   3e-98    Glycine soja [wild soybean]
ref|XP_003609098.1|  FERONIA receptor-like kinase                       314   1e-97    
gb|KEH23293.1|  feronia receptor-like kinase                            314   1e-97    Medicago truncatula
ref|XP_010529939.1|  PREDICTED: receptor-like protein kinase FERONIA    312   7e-97    Tarenaya hassleriana [spider flower]
ref|XP_008364006.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    308   2e-96    
ref|XP_007140079.1|  hypothetical protein PHAVU_008G082400g             311   3e-96    Phaseolus vulgaris [French bean]
ref|XP_002877809.1|  hypothetical protein ARALYDRAFT_485507             310   6e-96    Arabidopsis lyrata subsp. lyrata
ref|NP_001238686.1|  receptor-like kinase                               309   7e-96    Glycine max [soybeans]
ref|XP_007140062.1|  hypothetical protein PHAVU_008G081000g             310   7e-96    Phaseolus vulgaris [French bean]
gb|KHN40613.1|  Receptor-like protein kinase FERONIA                    310   7e-96    Glycine soja [wild soybean]
ref|NP_190723.1|  receptor-like protein kinase FERONIA                  309   1e-95    Arabidopsis thaliana [mouse-ear cress]
gb|AAK59558.1|  putative receptor-protein kinase                        309   1e-95    Arabidopsis thaliana [mouse-ear cress]
gb|ABT18100.1|  FERONIA receptor-like kinase                            308   2e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008370279.1|  PREDICTED: receptor-like protein kinase FERONIA    308   2e-95    
ref|XP_006290584.1|  hypothetical protein CARUB_v10016673mg             307   6e-95    Capsella rubella
ref|XP_010503851.1|  PREDICTED: receptor-like protein kinase FERONIA    307   6e-95    
ref|XP_010515573.1|  PREDICTED: receptor-like protein kinase FERONIA    307   6e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010426729.1|  PREDICTED: receptor-like protein kinase FERONIA    307   8e-95    Camelina sativa [gold-of-pleasure]
dbj|BAJ91215.1|  predicted protein                                      293   2e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009370899.1|  PREDICTED: receptor-like protein kinase FERONIA    305   3e-94    Pyrus x bretschneideri [bai li]
gb|ABT18099.1|  FERONIA receptor-like kinase                            305   4e-94    Cardamine flexuosa
gb|ABT18098.1|  FERONIA receptor-like kinase                            305   5e-94    Cardamine flexuosa
ref|XP_009115840.1|  PREDICTED: receptor-like protein kinase FERONIA    304   9e-94    Brassica rapa
ref|NP_001141864.1|  uncharacterized protein LOC100274007               285   1e-93    
gb|ABT18097.1|  FERONIA receptor-like kinase                            301   7e-93    Cardamine flexuosa
gb|ABT18095.1|  FERONIA receptor-like kinase                            301   9e-93    Cardamine flexuosa
gb|ABT18094.1|  FERONIA receptor-like kinase                            298   2e-91    Brassica oleracea
ref|XP_009416326.1|  PREDICTED: receptor-like protein kinase FERONIA    298   2e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006403905.1|  hypothetical protein EUTSA_v10010114mg             297   4e-91    Eutrema salsugineum [saltwater cress]
gb|EMT27425.1|  Receptor-like protein kinase FERONIA                    295   9e-91    
ref|XP_002467915.1|  hypothetical protein SORBIDRAFT_01g036260          296   1e-90    Sorghum bicolor [broomcorn]
gb|EMS54122.1|  Receptor-like protein kinase FERONIA                    295   2e-90    Triticum urartu
ref|XP_010921184.1|  PREDICTED: receptor-like protein kinase FERONIA    295   2e-90    Elaeis guineensis
ref|XP_008660180.1|  PREDICTED: receptor-like protein kinase FERONIA    294   5e-90    Zea mays [maize]
ref|XP_008810848.1|  PREDICTED: receptor-like protein kinase FERONIA    294   6e-90    Phoenix dactylifera
ref|XP_009136619.1|  PREDICTED: receptor-like protein kinase FERONIA    293   1e-89    Brassica rapa
ref|XP_009148931.1|  PREDICTED: receptor-like protein kinase FERONIA    293   1e-89    Brassica rapa
tpg|DAA45217.1|  TPA: putative receptor-like protein kinase famil...    293   1e-89    
ref|XP_010938035.1|  PREDICTED: receptor-like protein kinase FERONIA    293   1e-89    Elaeis guineensis
gb|EMT17007.1|  Receptor-like protein kinase FERONIA                    292   2e-89    
ref|XP_004984479.1|  PREDICTED: receptor-like protein kinase FERO...    292   2e-89    Setaria italica
ref|XP_009412649.1|  PREDICTED: receptor-like protein kinase FERONIA    292   3e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006646366.1|  PREDICTED: receptor-like protein kinase FERO...    290   5e-89    Oryza brachyantha
gb|EPS73118.1|  hypothetical protein M569_01631                         291   7e-89    Genlisea aurea
gb|EMS63765.1|  Receptor-like protein kinase FERONIA                    290   7e-89    Triticum urartu
emb|CDY33271.1|  BnaA01g19380D                                          290   8e-89    Brassica napus [oilseed rape]
emb|CDY29022.1|  BnaC07g32280D                                          289   8e-89    Brassica napus [oilseed rape]
emb|CDY16299.1|  BnaC01g23340D                                          290   1e-88    Brassica napus [oilseed rape]
emb|CDX90645.1|  BnaA03g41360D                                          289   1e-88    
emb|CDX78012.1|  BnaA09g32070D                                          289   1e-88    
ref|XP_010252025.1|  PREDICTED: receptor-like protein kinase FERONIA    290   2e-88    Nelumbo nucifera [Indian lotus]
ref|XP_003557976.1|  PREDICTED: receptor-like protein kinase FERONIA    289   3e-88    Brachypodium distachyon [annual false brome]
ref|NP_001044372.1|  Os01g0769700                                       288   8e-88    
gb|EEC75192.1|  hypothetical protein OsI_11431                          288   8e-88    Oryza sativa Indica Group [Indian rice]
ref|XP_009391670.1|  PREDICTED: receptor-like protein kinase FERONIA    288   9e-88    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX73714.1|  BnaC08g22890D                                          289   5e-87    
ref|NP_001050022.1|  Os03g0333200                                       286   6e-87    
ref|XP_008813242.1|  PREDICTED: receptor-like protein kinase FERONIA    285   7e-87    Phoenix dactylifera
ref|XP_006842554.1|  hypothetical protein AMTR_s00077p00138840          280   1e-84    
ref|XP_009414253.1|  PREDICTED: receptor-like protein kinase FERONIA    280   1e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006844774.1|  hypothetical protein AMTR_s00016p00259140          263   9e-79    
ref|XP_002447169.1|  hypothetical protein SORBIDRAFT_06g029710          262   4e-78    Sorghum bicolor [broomcorn]
ref|XP_004962463.1|  PREDICTED: receptor-like protein kinase FERO...    261   5e-78    Setaria italica
ref|XP_003568697.1|  PREDICTED: receptor-like protein kinase FERONIA    261   9e-78    Brachypodium distachyon [annual false brome]
ref|XP_010553161.1|  PREDICTED: receptor-like protein kinase FERONIA    259   3e-77    Tarenaya hassleriana [spider flower]
gb|EEE63237.1|  hypothetical protein OsJ_18047                          256   4e-76    Oryza sativa Japonica Group [Japonica rice]
gb|EAY97521.1|  hypothetical protein OsI_19449                          255   7e-76    Oryza sativa Indica Group [Indian rice]
gb|EMT16871.1|  Receptor-like protein kinase FERONIA                    256   7e-76    
ref|XP_006654257.1|  PREDICTED: receptor-like protein kinase FERO...    255   1e-75    Oryza brachyantha
ref|XP_002271113.1|  PREDICTED: receptor-like protein kinase ANXUR1     254   2e-75    Vitis vinifera
ref|XP_010914574.1|  PREDICTED: receptor-like protein kinase ANXUR2     254   3e-75    Elaeis guineensis
ref|XP_009388382.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    243   4e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008668826.1|  PREDICTED: receptor-like protein kinase FERONIA    254   4e-75    
ref|XP_009385155.1|  PREDICTED: receptor-like protein kinase ANXUR2     253   5e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006424004.1|  hypothetical protein CICLE_v10029897mg             253   9e-75    
ref|NP_001159308.1|  uncharacterized protein LOC100304400               241   1e-74    
ref|XP_002311383.2|  hypothetical protein POPTR_0008s10500g             252   1e-74    
dbj|BAJ93584.1|  predicted protein                                      253   1e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO54400.1|  hypothetical protein CISIN_1g039107mg                   251   1e-74    Citrus sinensis [apfelsine]
ref|XP_006487877.1|  PREDICTED: receptor-like protein kinase ANXU...    252   2e-74    Citrus sinensis [apfelsine]
ref|XP_011019995.1|  PREDICTED: receptor-like protein kinase ANXUR1     251   2e-74    Populus euphratica
gb|KJB80895.1|  hypothetical protein B456_013G120400                    251   3e-74    Gossypium raimondii
ref|XP_007030540.1|  Malectin/receptor-like protein kinase family...    251   3e-74    
ref|XP_008809255.1|  PREDICTED: receptor-like protein kinase ANXUR1     251   4e-74    Phoenix dactylifera
ref|XP_010242732.1|  PREDICTED: receptor-like protein kinase ANXUR1     250   5e-74    Nelumbo nucifera [Indian lotus]
ref|XP_002272797.2|  PREDICTED: receptor-like protein kinase ANXUR1     250   6e-74    Vitis vinifera
ref|XP_010258502.1|  PREDICTED: receptor-like protein kinase ANXUR1     250   6e-74    Nelumbo nucifera [Indian lotus]
ref|XP_010494105.1|  PREDICTED: receptor-like protein kinase ANXUR2     249   1e-73    Camelina sativa [gold-of-pleasure]
emb|CDP17056.1|  unnamed protein product                                249   1e-73    Coffea canephora [robusta coffee]
ref|XP_010921463.1|  PREDICTED: receptor-like protein kinase ANXUR2     249   2e-73    Elaeis guineensis
ref|XP_006382811.1|  serine-threonine kinase family protein             249   2e-73    
emb|CDX86206.1|  BnaA06g29230D                                          248   4e-73    
gb|KCW61585.1|  hypothetical protein EUGRSUZ_H04319                     247   4e-73    Eucalyptus grandis [rose gum]
ref|XP_009151260.1|  PREDICTED: receptor-like protein kinase ANXUR2     248   4e-73    Brassica rapa
ref|XP_011032387.1|  PREDICTED: receptor-like protein kinase ANXUR1     248   5e-73    Populus euphratica
ref|XP_006395027.1|  hypothetical protein EUTSA_v10003639mg             248   5e-73    Eutrema salsugineum [saltwater cress]
ref|XP_002531275.1|  ATP binding protein, putative                      248   5e-73    
ref|XP_006355833.1|  PREDICTED: receptor-like protein kinase ANXU...    247   6e-73    Solanum tuberosum [potatoes]
ref|XP_010025009.1|  PREDICTED: receptor-like protein kinase ANXUR1     247   7e-73    Eucalyptus grandis [rose gum]
dbj|BAF01824.1|  receptor protein kinase like protein                   230   8e-73    Arabidopsis thaliana [mouse-ear cress]
gb|KCW87969.1|  hypothetical protein EUGRSUZ_A00377                     246   1e-72    Eucalyptus grandis [rose gum]
gb|EEE63235.1|  hypothetical protein OsJ_18045                          230   1e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004240569.1|  PREDICTED: receptor-like protein kinase ANXUR1     247   1e-72    Solanum lycopersicum
emb|CAB92960.1|  putative serine threonine kinase                       234   1e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010065050.1|  PREDICTED: receptor-like protein kinase ANXUR2     246   1e-72    Eucalyptus grandis [rose gum]
gb|AAL83882.1|AF354500_1  PTH-2                                         233   2e-72    Cucumis melo [Oriental melon]
ref|XP_004240568.1|  PREDICTED: receptor-like protein kinase ANXUR1     246   2e-72    Solanum lycopersicum
gb|KCW45810.1|  hypothetical protein EUGRSUZ_L00361                     232   2e-72    Eucalyptus grandis [rose gum]
ref|XP_006654205.1|  PREDICTED: receptor-like protein kinase FERO...    246   2e-72    Oryza brachyantha
ref|XP_010455191.1|  PREDICTED: receptor-like protein kinase ANXUR2     246   3e-72    Camelina sativa [gold-of-pleasure]
ref|NP_001055089.1|  Os05g0280700                                       246   3e-72    
ref|XP_010421701.1|  PREDICTED: receptor-like protein kinase ANXUR2     246   3e-72    Camelina sativa [gold-of-pleasure]
emb|CDY48659.1|  BnaC07g27500D                                          229   3e-72    Brassica napus [oilseed rape]
ref|XP_010039671.1|  PREDICTED: receptor-like protein kinase HERK 1     232   4e-72    
ref|XP_004156494.1|  PREDICTED: receptor-like protein kinase ANXU...    244   8e-72    
ref|XP_008456162.1|  PREDICTED: receptor-like protein kinase ANXU...    243   1e-71    
ref|XP_004139382.1|  PREDICTED: receptor-like protein kinase ANXU...    244   1e-71    Cucumis sativus [cucumbers]
ref|XP_008456155.1|  PREDICTED: receptor-like protein kinase ANXU...    244   1e-71    Cucumis melo [Oriental melon]
gb|KDP27915.1|  hypothetical protein JCGZ_18995                         244   1e-71    Jatropha curcas
ref|XP_002439522.1|  hypothetical protein SORBIDRAFT_09g009320          244   2e-71    Sorghum bicolor [broomcorn]
ref|XP_006408164.1|  hypothetical protein EUTSA_v10020050mg             243   2e-71    Eutrema salsugineum [saltwater cress]
ref|XP_008218280.1|  PREDICTED: receptor-like protein kinase ANXUR1     243   2e-71    Prunus mume [ume]
ref|XP_002874434.1|  kinase family protein                              243   2e-71    Arabidopsis lyrata subsp. lyrata
ref|XP_010463957.1|  PREDICTED: receptor-like protein kinase ANXUR1     243   2e-71    Camelina sativa [gold-of-pleasure]
ref|XP_003568703.1|  PREDICTED: receptor-like protein kinase ANXUR1     243   3e-71    Brachypodium distachyon [annual false brome]
ref|NP_001174345.1|  Os05g0318600                                       229   3e-71    
ref|XP_010485852.1|  PREDICTED: receptor-like protein kinase ANXUR1     243   3e-71    
ref|XP_006289663.1|  hypothetical protein CARUB_v10003221mg             243   3e-71    Capsella rubella
ref|XP_007035799.1|  Malectin/receptor-like protein kinase family...    243   4e-71    
ref|XP_002319081.1|  kinase family protein                              243   4e-71    Populus trichocarpa [western balsam poplar]
ref|NP_198220.1|  receptor-like protein kinase ANXUR2                   243   4e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010519979.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    242   5e-71    
ref|XP_009785956.1|  PREDICTED: receptor-like protein kinase ANXUR1     242   7e-71    Nicotiana sylvestris
gb|AFW77551.1|  putative receptor-like protein kinase family protein    242   7e-71    
ref|XP_006595442.1|  PREDICTED: receptor-like protein kinase THES...    233   8e-71    Glycine max [soybeans]
ref|XP_010417830.1|  PREDICTED: receptor-like protein kinase ANXUR1     241   8e-71    Camelina sativa [gold-of-pleasure]
ref|XP_004514615.1|  PREDICTED: uncharacterized protein LOC101497599    243   1e-70    
gb|AAQ82660.1|  Pto-like serine/threonine kinase                        231   1e-70    
ref|XP_010102280.1|  Receptor-like protein kinase                       241   1e-70    
ref|XP_004962493.1|  PREDICTED: receptor-like protein kinase ANXU...    241   1e-70    Setaria italica
ref|XP_008390536.1|  PREDICTED: receptor-like protein kinase ANXUR1     241   1e-70    
ref|XP_009372137.1|  PREDICTED: receptor-like protein kinase ANXUR1     241   2e-70    
gb|EMS48200.1|  Receptor-like protein kinase HERK 1                     240   2e-70    Triticum urartu
ref|XP_004304753.1|  PREDICTED: receptor-like protein kinase ANXUR1     241   2e-70    Fragaria vesca subsp. vesca
ref|XP_011079535.1|  PREDICTED: receptor-like protein kinase ANXUR1     241   2e-70    Sesamum indicum [beniseed]
emb|CDO98765.1|  unnamed protein product                                241   2e-70    Coffea canephora [robusta coffee]
ref|NP_187120.1|  receptor-like protein kinase ANXUR1                   240   2e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007208221.1|  hypothetical protein PRUPE_ppa018611mg             241   2e-70    Prunus persica
ref|XP_007227151.1|  hypothetical protein PRUPE_ppa026453mg             241   2e-70    Prunus persica
ref|XP_008223394.1|  PREDICTED: receptor-like protein kinase ANXUR1     240   2e-70    Prunus mume [ume]
ref|XP_002884459.1|  kinase family protein                              240   2e-70    Arabidopsis lyrata subsp. lyrata
ref|XP_004487672.1|  PREDICTED: receptor-like protein kinase THES...    240   3e-70    Cicer arietinum [garbanzo]
ref|XP_009129817.1|  PREDICTED: receptor-like protein kinase ANXUR2     240   4e-70    Brassica rapa
emb|CDY05602.1|  BnaC02g39350D                                          239   4e-70    
ref|XP_002534744.1|  kinase, putative                                   232   4e-70    Ricinus communis
emb|CDY33885.1|  BnaA02g31020D                                          239   4e-70    Brassica napus [oilseed rape]
gb|EMT04378.1|  Receptor-like protein kinase FERONIA                    239   4e-70    
ref|XP_009385224.1|  PREDICTED: receptor-like protein kinase ANXUR1     239   5e-70    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010685859.1|  PREDICTED: receptor-like protein kinase HERK 1     239   6e-70    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011038554.1|  PREDICTED: receptor-like protein kinase ANXUR1     239   6e-70    Populus euphratica
dbj|BAK06468.1|  predicted protein                                      239   6e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008226684.1|  PREDICTED: receptor-like protein kinase THES...    239   8e-70    Prunus mume [ume]
ref|XP_006488842.1|  PREDICTED: receptor-like protein kinase ANXU...    239   8e-70    Citrus sinensis [apfelsine]
ref|XP_002316044.1|  Pto-like kinase OGw family protein                 239   8e-70    
ref|XP_006419383.1|  hypothetical protein CICLE_v10004295mg             239   9e-70    Citrus clementina [clementine]
gb|KDO71938.1|  hypothetical protein CISIN_1g041565mg                   239   9e-70    Citrus sinensis [apfelsine]
gb|KDO73010.1|  hypothetical protein CISIN_1g003341mg                   238   1e-69    Citrus sinensis [apfelsine]
ref|XP_009799586.1|  PREDICTED: receptor-like protein kinase ANXUR1     238   1e-69    Nicotiana sylvestris
gb|KDO73009.1|  hypothetical protein CISIN_1g003341mg                   238   1e-69    Citrus sinensis [apfelsine]
emb|CAB62020.1|  receptor-like protein kinase homolog                   232   1e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006424719.1|  hypothetical protein CICLE_v10027823mg             238   1e-69    
ref|XP_009601576.1|  PREDICTED: receptor-like protein kinase ANXUR1     238   1e-69    Nicotiana tomentosiformis
ref|XP_002519226.1|  ATP binding protein, putative                      238   2e-69    Ricinus communis
gb|KDP44164.1|  hypothetical protein JCGZ_05631                         238   2e-69    Jatropha curcas
ref|XP_004294627.1|  PREDICTED: receptor-like protein kinase HERK 1     238   2e-69    Fragaria vesca subsp. vesca
gb|KHN28027.1|  Receptor-like protein kinase THESEUS 1                  236   2e-69    Glycine soja [wild soybean]
ref|XP_004499646.1|  PREDICTED: receptor-like protein kinase FERO...    241   2e-69    
ref|XP_009602553.1|  PREDICTED: receptor-like protein kinase ANXUR1     238   2e-69    Nicotiana tomentosiformis
gb|KDP38931.1|  hypothetical protein JCGZ_00688                         230   2e-69    Jatropha curcas
ref|XP_007213653.1|  hypothetical protein PRUPE_ppa001400mg             237   2e-69    
ref|XP_011089398.1|  PREDICTED: receptor-like protein kinase HERK 1     237   3e-69    Sesamum indicum [beniseed]
ref|XP_009334606.1|  PREDICTED: receptor-like protein kinase THES...    237   3e-69    Pyrus x bretschneideri [bai li]
ref|XP_003634651.1|  PREDICTED: receptor-like protein kinase THES...    237   3e-69    Vitis vinifera
ref|XP_010644229.1|  PREDICTED: receptor-like protein kinase THES...    237   3e-69    Vitis vinifera
emb|CDY49572.1|  BnaA10g12680D                                          225   3e-69    Brassica napus [oilseed rape]
gb|KEH38803.1|  malectin/receptor-like kinase family protein            237   3e-69    Medicago truncatula
emb|CBI16212.3|  unnamed protein product                                237   3e-69    Vitis vinifera
ref|XP_010426068.1|  PREDICTED: receptor-like protein kinase HERK 1     234   3e-69    Camelina sativa [gold-of-pleasure]
ref|XP_011458098.1|  PREDICTED: receptor-like protein kinase THES...    237   3e-69    Fragaria vesca subsp. vesca
gb|KJB20195.1|  hypothetical protein B456_003G137700                    237   3e-69    Gossypium raimondii
gb|EYU38427.1|  hypothetical protein MIMGU_mgv1a001092mg                237   3e-69    Erythranthe guttata [common monkey flower]
ref|XP_010672753.1|  PREDICTED: receptor-like protein kinase HERK 1     237   4e-69    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010550913.1|  PREDICTED: receptor-like protein kinase ANXUR2     237   4e-69    Tarenaya hassleriana [spider flower]
emb|CAN65310.1|  hypothetical protein VITISV_043086                     224   5e-69    Vitis vinifera
ref|XP_006841758.1|  hypothetical protein AMTR_s00003p00263880          236   5e-69    Amborella trichopoda
ref|XP_009793250.1|  PREDICTED: receptor-like protein kinase THES...    236   5e-69    Nicotiana sylvestris
emb|CAN68061.1|  hypothetical protein VITISV_037438                     224   5e-69    Vitis vinifera
ref|XP_010097778.1|  Receptor-like protein kinase                       236   6e-69    Morus notabilis
ref|XP_010327142.1|  PREDICTED: receptor-like protein kinase THES...    236   6e-69    Solanum lycopersicum
gb|KHN36342.1|  Receptor-like protein kinase THESEUS 1                  235   8e-69    Glycine soja [wild soybean]
ref|XP_009613068.1|  PREDICTED: receptor-like protein kinase THES...    236   8e-69    Nicotiana tomentosiformis
gb|KHN24812.1|  Receptor-like protein kinase THESEUS 1                  233   8e-69    Glycine soja [wild soybean]
ref|XP_009342432.1|  PREDICTED: receptor-like protein kinase THES...    236   8e-69    Pyrus x bretschneideri [bai li]
gb|EPS72234.1|  hypothetical protein M569_02521                         236   9e-69    Genlisea aurea
emb|CDP15747.1|  unnamed protein product                                236   9e-69    Coffea canephora [robusta coffee]
ref|XP_009781981.1|  PREDICTED: receptor-like protein kinase HERK 1     236   9e-69    Nicotiana sylvestris
emb|CAN77769.1|  hypothetical protein VITISV_009237                     235   1e-68    Vitis vinifera
ref|XP_006355856.1|  PREDICTED: receptor-like protein kinase ANXU...    236   1e-68    Solanum tuberosum [potatoes]
gb|KHN36785.1|  Receptor-like protein kinase THESEUS 1                  236   1e-68    Glycine soja [wild soybean]
ref|XP_009586639.1|  PREDICTED: receptor-like protein kinase HERK 1     236   1e-68    Nicotiana tomentosiformis
ref|XP_010268798.1|  PREDICTED: receptor-like protein kinase THES...    236   1e-68    Nelumbo nucifera [Indian lotus]
emb|CDX82981.1|  BnaA01g19810D                                          235   1e-68    
ref|XP_002972798.1|  hypothetical protein SELMODRAFT_15419              222   1e-68    
ref|XP_010247768.1|  PREDICTED: receptor-like protein kinase FERONIA    236   1e-68    Nelumbo nucifera [Indian lotus]
ref|XP_008800166.1|  PREDICTED: receptor-like protein kinase THES...    232   1e-68    
ref|XP_007009484.1|  Receptor-like protein kinase THESEUS 1             235   2e-68    
ref|XP_007149628.1|  hypothetical protein PHAVU_005G085600g             235   2e-68    Phaseolus vulgaris [French bean]
ref|XP_010651080.1|  PREDICTED: receptor-like protein kinase HERK 1     235   2e-68    Vitis vinifera
ref|XP_004154820.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    235   2e-68    
ref|XP_008363971.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    235   2e-68    
ref|XP_010062897.1|  PREDICTED: receptor-like protein kinase THES...    235   2e-68    Eucalyptus grandis [rose gum]
ref|XP_003540082.2|  PREDICTED: receptor-like protein kinase THES...    235   2e-68    Glycine max [soybeans]
ref|XP_007133066.1|  hypothetical protein PHAVU_011G148700g             235   2e-68    Phaseolus vulgaris [French bean]
ref|NP_200249.1|  receptor-like protein kinase THESEUS 1                235   2e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004150104.1|  PREDICTED: receptor-like protein kinase THES...    234   3e-68    Cucumis sativus [cucumbers]
gb|KJB21613.1|  hypothetical protein B456_004G003200                    234   3e-68    Gossypium raimondii
emb|CDY63832.1|  BnaA10g28720D                                          234   3e-68    Brassica napus [oilseed rape]
gb|KFK27051.1|  hypothetical protein AALP_AA8G327900                    234   3e-68    Arabis alpina [alpine rockcress]
ref|XP_004296245.1|  PREDICTED: receptor-like protein kinase ANXUR1     234   3e-68    Fragaria vesca subsp. vesca
ref|XP_010319813.1|  PREDICTED: receptor-like protein kinase ANXUR1     234   4e-68    
ref|XP_008222676.1|  PREDICTED: receptor-like protein kinase HERK 1     234   4e-68    Prunus mume [ume]
ref|XP_009350739.1|  PREDICTED: receptor-like protein kinase HERK 1     233   4e-68    Pyrus x bretschneideri [bai li]
ref|XP_007016572.1|  Kinase                                             234   4e-68    
ref|XP_009354540.1|  PREDICTED: receptor-like protein kinase HERK 1     234   4e-68    Pyrus x bretschneideri [bai li]
ref|XP_009150283.1|  PREDICTED: receptor-like protein kinase HERK 1     234   4e-68    
ref|XP_010093014.1|  Receptor-like protein kinase HERK 1                234   5e-68    
ref|XP_008454657.1|  PREDICTED: receptor-like protein kinase THES...    234   5e-68    Cucumis melo [Oriental melon]
gb|EYU36239.1|  hypothetical protein MIMGU_mgv1a001323mg                234   5e-68    Erythranthe guttata [common monkey flower]
ref|XP_009358295.1|  PREDICTED: receptor-like protein kinase HERK 1     234   5e-68    Pyrus x bretschneideri [bai li]
ref|XP_008357933.1|  PREDICTED: receptor-like protein kinase HERK 1     233   5e-68    
ref|XP_007208086.1|  hypothetical protein PRUPE_ppa001409mg             234   5e-68    Prunus persica
ref|XP_008385197.1|  PREDICTED: receptor-like protein kinase HERK 1     233   6e-68    Malus domestica [apple tree]
ref|XP_006358215.1|  PREDICTED: receptor-like protein kinase ANXU...    233   6e-68    
dbj|BAF79940.1|  receptor-like kinase                                   234   7e-68    
ref|XP_004148239.1|  PREDICTED: receptor-like protein kinase HERK...    233   8e-68    
ref|XP_010503244.1|  PREDICTED: receptor-like protein kinase HERK 1     233   8e-68    
gb|EYU46822.1|  hypothetical protein MIMGU_mgv1a022107mg                233   8e-68    
ref|XP_010684237.1|  PREDICTED: receptor-like protein kinase ANXUR1     233   8e-68    
ref|XP_010535512.1|  PREDICTED: receptor-like protein kinase HERK 1     233   9e-68    
ref|XP_010514958.1|  PREDICTED: receptor-like protein kinase HERK...    233   9e-68    
ref|XP_011029417.1|  PREDICTED: receptor-like protein kinase THES...    233   9e-68    
ref|XP_002316926.1|  kinase family protein                              233   9e-68    
ref|XP_008355881.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    227   9e-68    
ref|XP_004487043.1|  PREDICTED: receptor-like protein kinase HERK...    233   1e-67    
ref|XP_006840306.1|  hypothetical protein AMTR_s00045p00071050          233   1e-67    
ref|XP_007132136.1|  hypothetical protein PHAVU_011G069600g             233   1e-67    
ref|XP_009397265.1|  PREDICTED: probable receptor-like protein ki...    233   1e-67    
ref|NP_001055184.1|  Os05g0318700                                       232   1e-67    
ref|XP_008463843.1|  PREDICTED: receptor-like protein kinase HERK 1     233   1e-67    
emb|CDX99115.1|  BnaA06g18060D                                          233   1e-67    
ref|XP_006418923.1|  hypothetical protein EUTSA_v10002401mg             233   1e-67    
ref|XP_004243035.1|  PREDICTED: receptor-like protein kinase ANXUR1     233   1e-67    
ref|XP_009149977.1|  PREDICTED: receptor-like protein kinase HERK 1     233   1e-67    
ref|XP_006279999.1|  hypothetical protein CARUB_v10025871mg             233   1e-67    
ref|XP_009119966.1|  PREDICTED: receptor-like protein kinase THES...    233   1e-67    
emb|CDX86076.1|  BnaC03g55910D                                          232   1e-67    
ref|XP_006360136.1|  PREDICTED: receptor-like protein kinase THES...    233   1e-67    
ref|XP_002313457.1|  kinase family protein                              232   1e-67    
ref|XP_004240344.1|  PREDICTED: receptor-like protein kinase HERK 1     232   2e-67    
ref|XP_006592253.1|  PREDICTED: receptor-like protein kinase HERK...    232   2e-67    
ref|XP_009759756.1|  PREDICTED: receptor-like protein kinase THES...    232   2e-67    
ref|XP_006366328.1|  PREDICTED: receptor-like protein kinase HERK...    232   2e-67    
ref|XP_006362946.1|  PREDICTED: receptor-like protein kinase THES...    232   2e-67    
emb|CDX68370.1|  BnaC01g24480D                                          232   2e-67    
ref|XP_007038795.1|  Kinase superfamily protein                         232   2e-67    
ref|XP_010243447.1|  PREDICTED: receptor-like protein kinase FERONIA    232   2e-67    
ref|XP_010443015.1|  PREDICTED: receptor-like protein kinase THES...    232   2e-67    
ref|XP_010446855.1|  PREDICTED: receptor-like protein kinase THES...    232   2e-67    
ref|XP_006401580.1|  hypothetical protein EUTSA_v10016077mg             232   2e-67    
ref|XP_010482846.1|  PREDICTED: receptor-like protein kinase THES...    232   2e-67    
gb|KHN43182.1|  Receptor-like protein kinase ANXUR2                     231   2e-67    
ref|XP_011461160.1|  PREDICTED: receptor-like protein kinase THES...    232   2e-67    
ref|XP_009590937.1|  PREDICTED: receptor-like protein kinase THES...    232   2e-67    
ref|XP_011041960.1|  PREDICTED: receptor-like protein kinase HERK 1     232   2e-67    
ref|XP_008800163.1|  PREDICTED: receptor-like protein kinase THES...    232   2e-67    
ref|XP_002866040.1|  hypothetical protein ARALYDRAFT_495518             232   3e-67    
ref|XP_007021303.1|  Kinase family protein                              232   3e-67    
ref|XP_002875777.1|  hypothetical protein ARALYDRAFT_905825             231   3e-67    
ref|XP_004244196.1|  PREDICTED: receptor-like protein kinase THES...    231   3e-67    
gb|KEH30081.1|  receptor-like kinase theseus protein                    229   3e-67    
gb|KJB08837.1|  hypothetical protein B456_001G107000                    231   3e-67    
ref|NP_190214.1|  receptor-like protein kinase HERK 1                   231   3e-67    
gb|KJB62711.1|  hypothetical protein B456_009G432100                    231   3e-67    
ref|XP_006290599.1|  hypothetical protein CARUB_v10016688mg             231   3e-67    
ref|XP_011071382.1|  PREDICTED: receptor-like protein kinase ANXUR1     232   3e-67    
ref|XP_010266323.1|  PREDICTED: probable receptor-like protein ki...    231   4e-67    
ref|XP_010089378.1|  Receptor-like protein kinase THESEUS 1             231   4e-67    
ref|XP_011044568.1|  PREDICTED: receptor-like protein kinase THES...    231   4e-67    
ref|XP_006604845.1|  PREDICTED: receptor-like protein kinase ANXU...    231   5e-67    
ref|XP_002298383.2|  kinase family protein                              231   5e-67    
gb|EPS64671.1|  hypothetical protein M569_10103                         231   6e-67    
ref|XP_003597308.1|  Kinase-like protein                                231   6e-67    
ref|XP_010905238.1|  PREDICTED: receptor-like protein kinase THES...    231   6e-67    
ref|XP_010278350.1|  PREDICTED: receptor-like protein kinase THES...    231   7e-67    
ref|XP_006451957.1|  hypothetical protein CICLE_v10007445mg             231   7e-67    
gb|KDO74175.1|  hypothetical protein CISIN_1g003139mg                   231   7e-67    
ref|XP_006464697.1|  PREDICTED: receptor-like protein kinase THES...    230   8e-67    
ref|XP_006363345.1|  PREDICTED: receptor-like protein kinase HERK...    230   8e-67    
ref|XP_010318820.1|  PREDICTED: probable receptor-like protein ki...    230   8e-67    
ref|XP_009412431.1|  PREDICTED: receptor-like protein kinase THES...    230   8e-67    
ref|XP_010045589.1|  PREDICTED: probable receptor-like protein ki...    233   9e-67    
ref|XP_009416069.1|  PREDICTED: receptor-like protein kinase THES...    230   1e-66    
gb|KHN22011.1|  Receptor-like protein kinase HERK 1                     230   1e-66    
gb|KHN31469.1|  Receptor-like protein kinase ANXUR2                     230   1e-66    
gb|KEH24563.1|  malectin/receptor-like kinase family protein            230   1e-66    
ref|XP_003520841.1|  PREDICTED: receptor-like protein kinase ANXU...    230   1e-66    
gb|KJB13442.1|  hypothetical protein B456_002G074700                    230   1e-66    
ref|XP_002990231.1|  hypothetical protein SELMODRAFT_40963              229   1e-66    
ref|XP_010260899.1|  PREDICTED: probable receptor-like protein ki...    230   1e-66    
ref|XP_004977713.1|  PREDICTED: probable receptor-like protein ki...    226   1e-66    
gb|AAK63934.1|AC084282_15  putative protein kinase                      229   1e-66    
ref|XP_008775443.1|  PREDICTED: receptor-like protein kinase THES...    229   2e-66    
ref|NP_001235040.1|  protein kinase precursor                           229   2e-66    
emb|CDY43828.1|  BnaC03g14610D                                          229   2e-66    
ref|XP_008388681.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    229   2e-66    
ref|XP_009419861.1|  PREDICTED: receptor-like protein kinase FERONIA    227   2e-66    
ref|XP_011098356.1|  PREDICTED: receptor-like protein kinase THES...    229   2e-66    
ref|XP_002992454.1|  hypothetical protein SELMODRAFT_135346             229   2e-66    
ref|XP_010229562.1|  PREDICTED: probable receptor-like protein ki...    229   2e-66    
ref|XP_003606567.1|  Kinase-like protein                                229   2e-66    
ref|XP_004494710.1|  PREDICTED: receptor-like protein kinase ANXU...    229   3e-66    
ref|NP_001132279.1|  uncharacterized protein LOC100193715               218   3e-66    
ref|XP_004251295.1|  PREDICTED: receptor-like protein kinase HERK 1     229   3e-66    
ref|XP_007150266.1|  hypothetical protein PHAVU_005G139800g             229   3e-66    
ref|XP_011038375.1|  PREDICTED: probable receptor-like protein ki...    229   3e-66    
ref|XP_010675594.1|  PREDICTED: receptor-like protein kinase THES...    228   4e-66    
gb|ABF98993.1|  protein kinase family protein, putative, expressed      229   4e-66    
ref|XP_010260051.1|  PREDICTED: receptor-like protein kinase THES...    228   4e-66    
emb|CDY43041.1|  BnaA03g11880D                                          225   4e-66    
ref|XP_010259987.1|  PREDICTED: receptor-like protein kinase HERK 1     228   4e-66    
gb|ACO25565.1|  protein kinase-coding resistance protein                217   5e-66    
gb|KHN30216.1|  Receptor-like protein kinase HERK 1                     228   5e-66    
gb|EYU44220.1|  hypothetical protein MIMGU_mgv1a003782mg                224   5e-66    
gb|ACO25571.1|  protein kinase-coding resistance protein                217   6e-66    
ref|XP_009593506.1|  PREDICTED: receptor-like protein kinase THES...    228   6e-66    
ref|XP_010905592.1|  PREDICTED: receptor-like protein kinase THES...    228   6e-66    
ref|XP_009383157.1|  PREDICTED: probable receptor-like protein ki...    228   6e-66    
ref|NP_001235070.1|  protein kinase precursor                           228   6e-66    
ref|XP_002280183.3|  PREDICTED: probable receptor-like protein ki...    228   6e-66    
gb|KDP23678.1|  hypothetical protein JCGZ_23511                         228   7e-66    
emb|CDX80236.1|  BnaC09g35060D                                          228   7e-66    
ref|XP_011005024.1|  PREDICTED: receptor-like protein kinase HERK 1     228   7e-66    
ref|NP_200778.1|  putative receptor-like protein kinase                 228   7e-66    
ref|XP_009339695.1|  PREDICTED: probable receptor-like protein ki...    228   7e-66    
ref|XP_004505920.1|  PREDICTED: receptor-like protein kinase HERK...    228   8e-66    
ref|XP_008370712.1|  PREDICTED: receptor-like protein kinase ANXUR2     228   8e-66    
ref|XP_010520290.1|  PREDICTED: receptor-like protein kinase HERK...    228   8e-66    
ref|XP_002446044.1|  hypothetical protein SORBIDRAFT_06g000910          217   8e-66    
ref|XP_010520289.1|  PREDICTED: receptor-like protein kinase HERK...    228   9e-66    
ref|XP_002866343.1|  hypothetical protein ARALYDRAFT_496102             227   9e-66    
ref|XP_004240198.2|  PREDICTED: receptor-like protein kinase THES...    228   9e-66    
ref|XP_006280010.1|  hypothetical protein CARUB_v10025884mg             227   1e-65    
gb|EEC76216.1|  hypothetical protein OsI_13615                          227   1e-65    
gb|AFK35668.1|  unknown                                                 216   1e-65    
gb|KJB28740.1|  hypothetical protein B456_005G067100                    227   1e-65    
ref|XP_004513186.1|  PREDICTED: probable receptor-like protein ki...    227   1e-65    
gb|AAL85985.1|  putative receptor-protein kinase                        217   1e-65    
ref|XP_010920748.1|  PREDICTED: probable receptor-like protein ki...    227   1e-65    
ref|XP_009132651.1|  PREDICTED: receptor-like protein kinase THES...    225   1e-65    
ref|XP_009759079.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    230   1e-65    
ref|XP_006836427.1|  hypothetical protein AMTR_s00092p00160980          228   1e-65    
ref|XP_009596877.1|  PREDICTED: receptor-like protein kinase HERK 1     227   1e-65    
emb|CDP00040.1|  unnamed protein product                                227   1e-65    
ref|XP_006372441.1|  kinase family protein                              227   1e-65    
ref|XP_009357768.1|  PREDICTED: receptor-like protein kinase THES...    227   1e-65    
ref|XP_006843268.1|  hypothetical protein AMTR_s00080p00131040          227   2e-65    
ref|XP_006374449.1|  hypothetical protein POPTR_0015s07280g             224   2e-65    
gb|KHN09306.1|  Putative receptor-like protein kinase                   226   2e-65    
ref|XP_009364589.1|  PREDICTED: receptor-like protein kinase ANXUR2     227   2e-65    
ref|XP_006650625.1|  PREDICTED: probable receptor-like protein ki...    227   2e-65    
emb|CDP08976.1|  unnamed protein product                                226   2e-65    
gb|KEH43006.1|  malectin/receptor-like kinase family protein            226   2e-65    
ref|XP_008371230.1|  PREDICTED: receptor-like protein kinase THES...    226   2e-65    
ref|XP_006849439.1|  hypothetical protein AMTR_s00024p00049240          226   2e-65    
ref|XP_006606937.1|  PREDICTED: receptor-like protein kinase ANXU...    226   2e-65    
ref|XP_006400927.1|  hypothetical protein EUTSA_v10012688mg             226   2e-65    
ref|XP_001760779.1|  predicted protein                                  216   3e-65    
ref|XP_004981691.1|  PREDICTED: probable receptor-like protein ki...    226   3e-65    
gb|EMS60533.1|  Receptor-like protein kinase FERONIA                    226   3e-65    
ref|XP_010483613.1|  PREDICTED: probable receptor-like protein ki...    226   3e-65    
ref|XP_010541754.1|  PREDICTED: probable receptor-like protein ki...    226   4e-65    
ref|NP_001170347.1|  uncharacterized protein LOC100384323               213   4e-65    
emb|CDP18314.1|  unnamed protein product                                224   4e-65    
ref|XP_009761793.1|  PREDICTED: receptor-like protein kinase THES...    226   4e-65    
ref|XP_009120484.1|  PREDICTED: probable receptor-like protein ki...    225   5e-65    
gb|AAK82715.1|AF288565_1  putative Pto-like serine/threonine kinase     210   5e-65    
ref|XP_007209852.1|  hypothetical protein PRUPE_ppa014805mg             225   7e-65    
gb|KHN03673.1|  Putative receptor-like protein kinase                   225   8e-65    
ref|XP_010253388.1|  PREDICTED: receptor-like protein kinase HERK 1     224   8e-65    
ref|XP_007144836.1|  hypothetical protein PHAVU_007G188300g             225   8e-65    
ref|XP_010455405.1|  PREDICTED: probable receptor-like protein ki...    224   9e-65    
ref|XP_010230703.1|  PREDICTED: receptor-like protein kinase ANXUR1     228   9e-65    
ref|XP_006346012.1|  PREDICTED: receptor-like protein kinase THES...    224   9e-65    
ref|XP_009607769.1|  PREDICTED: probable receptor-like protein ki...    224   1e-64    
ref|XP_011470689.1|  PREDICTED: probable receptor-like protein ki...    224   1e-64    
ref|XP_010247824.1|  PREDICTED: probable LRR receptor-like serine...    228   1e-64    
ref|XP_004495609.1|  PREDICTED: receptor-like protein kinase ANXU...    224   1e-64    
gb|EPS63395.1|  hypothetical protein M569_11389                         224   1e-64    
ref|XP_010443741.1|  PREDICTED: probable receptor-like protein ki...    224   1e-64    
ref|XP_010089888.1|  putative receptor-like protein kinase              224   1e-64    
gb|AHZ44754.1|  CrRLK1L-like protein                                    224   1e-64    
ref|XP_002463853.1|  hypothetical protein SORBIDRAFT_01g007450          224   1e-64    
ref|XP_011043865.1|  PREDICTED: probable receptor-like protein ki...    224   1e-64    
tpg|DAA51500.1|  TPA: putative receptor-like protein kinase famil...    224   1e-64    
ref|XP_010096654.1|  Receptor-like protein kinase THESEUS 1             224   1e-64    
ref|XP_010537000.1|  PREDICTED: receptor-like protein kinase THES...    224   1e-64    
ref|XP_008439289.1|  PREDICTED: probable receptor-like protein ki...    224   1e-64    
ref|XP_008665441.1|  PREDICTED: probable receptor-like protein ki...    224   2e-64    
ref|XP_004496832.1|  PREDICTED: probable receptor-like protein ki...    224   2e-64    
ref|XP_007219342.1|  hypothetical protein PRUPE_ppa019355mg             223   2e-64    
ref|XP_009766353.1|  PREDICTED: receptor-like protein kinase HERK 1     224   2e-64    
ref|XP_003633771.1|  PREDICTED: receptor-like protein kinase FERONIA    224   2e-64    
ref|XP_002272986.1|  PREDICTED: probable receptor-like protein ki...    224   2e-64    
ref|XP_010660596.1|  PREDICTED: receptor-like protein kinase FERONIA    224   2e-64    
gb|EPS72507.1|  hypothetical protein M569_02249                         223   2e-64    
ref|XP_004140755.1|  PREDICTED: probable receptor-like protein ki...    224   2e-64    
gb|KDP46096.1|  hypothetical protein JCGZ_06607                         223   2e-64    
ref|XP_006342301.1|  PREDICTED: probable receptor-like protein ki...    223   2e-64    
gb|KHN18064.1|  Receptor-like protein kinase ANXUR2                     224   3e-64    
ref|XP_003535370.1|  PREDICTED: receptor-like protein kinase ANXU...    224   3e-64    
emb|CBI21198.3|  unnamed protein product                                224   3e-64    
ref|XP_006373376.1|  hypothetical protein POPTR_0017s13200g             213   3e-64    
ref|XP_004157220.1|  PREDICTED: probable receptor-like protein ki...    223   3e-64    
ref|XP_002275845.3|  PREDICTED: probable receptor-like protein ki...    223   3e-64    
ref|XP_008794322.1|  PREDICTED: probable receptor-like protein ki...    223   3e-64    
ref|XP_009615839.1|  PREDICTED: probable receptor-like protein ki...    223   3e-64    
ref|XP_004234787.1|  PREDICTED: probable receptor-like protein ki...    223   3e-64    
emb|CDX80402.1|  BnaC07g30420D                                          223   3e-64    
ref|XP_009766613.1|  PREDICTED: probable receptor-like protein ki...    223   3e-64    
ref|XP_011006280.1|  PREDICTED: probable receptor-like protein ki...    223   3e-64    
ref|XP_008393353.1|  PREDICTED: probable receptor-like protein ki...    226   4e-64    
ref|XP_003606802.1|  Kinase-like protein                                223   4e-64    
ref|XP_011047185.1|  PREDICTED: probable receptor-like protein ki...    223   5e-64    
ref|XP_009617176.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    226   5e-64    
ref|XP_004510997.1|  PREDICTED: probable receptor-like protein ki...    223   5e-64    
ref|XP_010519470.1|  PREDICTED: probable receptor-like protein ki...    223   5e-64    
emb|CDX88063.1|  BnaA06g26540D                                          222   6e-64    
gb|KHN12941.1|  Putative receptor-like protein kinase                   221   6e-64    
ref|XP_009588433.1|  PREDICTED: receptor-like protein kinase FERONIA    223   6e-64    
gb|KJB42937.1|  hypothetical protein B456_007G175500                    223   6e-64    
ref|XP_010454691.1|  PREDICTED: probable receptor-like protein ki...    223   6e-64    
ref|XP_010035173.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    222   7e-64    
ref|XP_009150929.1|  PREDICTED: probable receptor-like protein ki...    222   7e-64    
ref|NP_197789.1|  putative receptor-like protein kinase                 222   7e-64    
ref|XP_007147183.1|  hypothetical protein PHAVU_006G102700g             222   7e-64    
ref|XP_002984374.1|  hypothetical protein SELMODRAFT_120216             222   8e-64    
ref|XP_006360634.1|  PREDICTED: probable receptor-like protein ki...    222   8e-64    
gb|AET02217.2|  malectin/receptor-like kinase family protein            222   9e-64    
ref|XP_010493531.1|  PREDICTED: probable receptor-like protein ki...    222   9e-64    
ref|XP_009784130.1|  PREDICTED: probable receptor-like protein ki...    222   9e-64    
ref|XP_002457574.1|  hypothetical protein SORBIDRAFT_03g009660          222   9e-64    
ref|XP_004967845.1|  PREDICTED: receptor-like protein kinase FERO...    222   9e-64    
ref|XP_004248695.2|  PREDICTED: probable receptor-like protein ki...    222   1e-63    



>gb|ABY40731.1| FERONIA receptor-like kinase [Citrus trifoliata]
Length=447

 Score =   346 bits (888),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 192/206 (93%), Gaps = 1/206 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  229  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  288

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGIL+QI DPYLKGKIAPECFKKFAETA+KCV+D G +
Sbjct  289  ALNPTLPKEQVSLAEWAAHCHKKGILEQIMDPYLKGKIAPECFKKFAETAMKCVSDQGIE  348

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEG-FDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESGK   GG+DIEEG FDV CK KKDP A  GF+ ++T
Sbjct  349  RPSMGDVLWNLEFALQLQESAEESGKVPGGGMDIEEGAFDVDCKGKKDPNACSGFNGNIT  408

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++S+G+SMSIGGRSLASEDSDGLTP
Sbjct  409  DSRSTGMSMSIGGRSLASEDSDGLTP  434



>ref|XP_007033491.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY04417.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
Length=892

 Score =   358 bits (920),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 197/206 (96%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFEILCARP
Sbjct  675  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARP  734

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGILDQI DPYLKGKIAPECFKKFAETA+KCVAD G D
Sbjct  735  ALNPTLPKEQVSLAEWAAHCHKKGILDQIMDPYLKGKIAPECFKKFAETAMKCVADQGID  794

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEG-FDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESGK G+GG+DIEEG +DVTCK KKDP AS GFDA++T
Sbjct  795  RPSMGDVLWNLEFALQLQESAEESGK-GIGGMDIEEGAYDVTCKGKKDPNASLGFDANVT  853

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++SSG+SMS+GGRSLASEDSDGLTP
Sbjct  854  DSRSSGMSMSLGGRSLASEDSDGLTP  879



>ref|XP_011095158.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=883

 Score =   350 bits (898),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 196/205 (96%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP+LDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYS+GVVLFEILCARP
Sbjct  668  VSDFGLSKTGPSLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSYGVVLFEILCARP  727

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGILDQI DPYLKGKIAPECFKKFAETAVKCV+DVGTD
Sbjct  728  ALNPTLPKEQVSLAEWAQHCHKKGILDQIIDPYLKGKIAPECFKKFAETAVKCVSDVGTD  787

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESG+ GLGG+DIE  +D+T + KKDP++S GFD +MTD
Sbjct  788  RPSMGDVLWNLEFALQLQESAEESGE-GLGGMDIES-YDITGEGKKDPDSSSGFDGNMTD  845

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSG+SMS+GGRSLASEDSDGLTP
Sbjct  846  SKSSGLSMSLGGRSLASEDSDGLTP  870



>ref|XP_009617447.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana tomentosiformis]
Length=888

 Score =   350 bits (897),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 190/205 (93%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE+LCARP
Sbjct  672  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFELLCARP  731

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWAFHC+KKG  DQI DPYLKGKIAPEC KKF ETAVKCV+DVG D
Sbjct  732  ALNPTLPKEQVSLAEWAFHCYKKGTFDQIIDPYLKGKIAPECLKKFTETAVKCVSDVGVD  791

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEE GK G G +DIEEGFDVTCK KKD   S GFDASMTD
Sbjct  792  RPSMGDVLWNLEFALQLQESAEECGK-GFGKMDIEEGFDVTCKGKKDLNESAGFDASMTD  850

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSGISMSIGGRSLAS+DSDGLTP
Sbjct  851  SRSSGISMSIGGRSLASDDSDGLTP  875



>ref|XP_009791682.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana sylvestris]
Length=888

 Score =   350 bits (897),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 190/205 (93%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE+LCARP
Sbjct  672  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFELLCARP  731

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWAFHC+KKG  DQI DPYLKGKIAPEC KKF ETAVKCV+DVG D
Sbjct  732  ALNPTLPKEQVSLAEWAFHCYKKGTFDQIIDPYLKGKIAPECLKKFTETAVKCVSDVGVD  791

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEE GK G G +DIEEGFDVTCK KKD   S GFDASMTD
Sbjct  792  RPSMGDVLWNLEFALQLQESAEECGK-GFGKMDIEEGFDVTCKGKKDLNESAGFDASMTD  850

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSGISMSIGGRSLAS+DSDGLTP
Sbjct  851  SRSSGISMSIGGRSLASDDSDGLTP  875



>ref|XP_006341293.1| PREDICTED: receptor-like protein kinase FERONIA-like [Solanum 
tuberosum]
Length=889

 Score =   348 bits (894),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 191/206 (93%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFEILCARP
Sbjct  672  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARP  731

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWAFHC+KKG  DQI DPYLKGK+APEC KKF ETAVKCV+DVG D
Sbjct  732  ALNPTLPKEQVSLAEWAFHCYKKGTFDQIIDPYLKGKLAPECLKKFTETAVKCVSDVGVD  791

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGF-DVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEE GK G G +DIEEGF DVTCK KKD   SPG+DASMT
Sbjct  792  RPSMGDVLWNLEFALQLQESAEECGK-GFGKMDIEEGFDDVTCKGKKDLNESPGYDASMT  850

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++SSGISMSIGGRSLASEDSDGLTP
Sbjct  851  DSRSSGISMSIGGRSLASEDSDGLTP  876



>ref|XP_004246282.1| PREDICTED: receptor-like protein kinase FERONIA [Solanum lycopersicum]
Length=889

 Score =   348 bits (892),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 191/206 (93%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFEILCARP
Sbjct  672  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARP  731

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWAFHC+KKG  DQI DPYLKGK+APEC KKF ETAVKCV+DVG D
Sbjct  732  ALNPTLPKEQVSLAEWAFHCYKKGTFDQIIDPYLKGKLAPECLKKFTETAVKCVSDVGVD  791

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFD-VTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEE GK G G +DIEEGFD VTCK KKD   SPG+DASMT
Sbjct  792  RPSMGDVLWNLEFALQLQESAEECGK-GFGKMDIEEGFDNVTCKGKKDLNESPGYDASMT  850

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++SSGISMSIGGRSLASEDSDGLTP
Sbjct  851  DSRSSGISMSIGGRSLASEDSDGLTP  876



>gb|KJB29840.1| hypothetical protein B456_005G120700 [Gossypium raimondii]
Length=889

 Score =   348 bits (892),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 194/206 (94%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLD+THVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFEILCARP
Sbjct  672  VSDFGLSKTGPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARP  731

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGILDQI DPYLKGKIAPECFKKFAETA+KCVAD G D
Sbjct  732  ALNPTLPKEQVSLAEWAAHCHKKGILDQIMDPYLKGKIAPECFKKFAETAMKCVADQGID  791

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEG-FDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESGK G+  +++EEG +DVTCK KKDP ASPGFD ++ 
Sbjct  792  RPSMGDVLWNLEFALQLQESAEESGK-GISELEVEEGTYDVTCKGKKDPNASPGFDINVA  850

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++SSG+SMSIGGRSLASEDSDGLTP
Sbjct  851  DSRSSGMSMSIGGRSLASEDSDGLTP  876



>gb|KDO64141.1| hypothetical protein CISIN_1g036624mg [Citrus sinensis]
Length=893

 Score =   347 bits (890),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 192/206 (93%), Gaps = 1/206 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  675  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  734

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGIL+QI DPYLKGKIAPECFKKFAETA+KCV+D G +
Sbjct  735  ALNPTLPKEQVSLAEWAAHCHKKGILEQIMDPYLKGKIAPECFKKFAETAMKCVSDQGIE  794

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEG-FDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESGK   GG+DIEEG FDV CK KKDP A  GF+ ++T
Sbjct  795  RPSMGDVLWNLEFALQLQESAEESGKVLGGGMDIEEGAFDVDCKGKKDPNACSGFNGNIT  854

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++S+G+SMSIGGRSLASEDSDGLTP
Sbjct  855  DSRSTGMSMSIGGRSLASEDSDGLTP  880



>gb|AAL40864.1| receptor protein kinase-like protein [Capsicum annuum]
Length=648

 Score =   341 bits (874),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 186/205 (91%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFEILCARP
Sbjct  432  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARP  491

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWAFHC+KKG  DQI DPYL GK+APEC KKF ETAVKCV+DVG D
Sbjct  492  ALNPTLPKEQVSLAEWAFHCYKKGTFDQIIDPYLNGKLAPECLKKFTETAVKCVSDVGAD  551

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQES EE  K G G +DIEEGFDVTCK KKD  A PG+D SMTD
Sbjct  552  RPSMGDVLWNLEFALQLQESVEECCK-GFGKMDIEEGFDVTCKGKKDLNAFPGYDESMTD  610

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSGISMSIGG SLASE+SDGLTP
Sbjct  611  SRSSGISMSIGGHSLASENSDGLTP  635



>ref|XP_006429617.1| hypothetical protein CICLE_v10011034mg [Citrus clementina]
 ref|XP_006481221.1| PREDICTED: receptor-like protein kinase FERONIA-like [Citrus 
sinensis]
 gb|ESR42857.1| hypothetical protein CICLE_v10011034mg [Citrus clementina]
Length=895

 Score =   347 bits (890),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 192/206 (93%), Gaps = 1/206 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  677  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  736

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGIL+QI DPYLKGKIAPECFKKFAETA+KCV+D G +
Sbjct  737  ALNPTLPKEQVSLAEWAAHCHKKGILEQIMDPYLKGKIAPECFKKFAETAMKCVSDQGIE  796

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEG-FDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESGK   GG+DIEEG FDV CK KKDP A  GF+ ++T
Sbjct  797  RPSMGDVLWNLEFALQLQESAEESGKVLGGGMDIEEGAFDVDCKGKKDPNACSGFNGNIT  856

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++S+G+SMSIGGRSLASEDSDGLTP
Sbjct  857  DSRSTGMSMSIGGRSLASEDSDGLTP  882



>gb|KJB71481.1| hypothetical protein B456_011G124900 [Gossypium raimondii]
Length=742

 Score =   341 bits (875),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 193/206 (94%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFEILCARP
Sbjct  525  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARP  584

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGILDQI DPYLKGKI PECFKKFAETA+KCVAD G +
Sbjct  585  ALNPTLPKEQVSLAEWAAHCHKKGILDQIMDPYLKGKITPECFKKFAETAMKCVADEGIE  644

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEG-FDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESGK G+G +D+EEG ++ TCK KKDP AS G+D ++T
Sbjct  645  RPSMGDVLWNLEFALQLQESAEESGK-GIGEMDMEEGSYEGTCKGKKDPNASLGYDGNIT  703

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++SSG+SMSIGGRSLASEDS+GLTP
Sbjct  704  DSRSSGMSMSIGGRSLASEDSEGLTP  729



>gb|KDP21852.1| hypothetical protein JCGZ_00639 [Jatropha curcas]
Length=652

 Score =   338 bits (868),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 190/206 (92%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  435  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  494

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA HCHKKGILDQI DPYLKGKIAPECFKKFAETA+KCV+D G +
Sbjct  495  ALNPTLAKEQVSLAEWAAHCHKKGILDQILDPYLKGKIAPECFKKFAETAMKCVSDQGIE  554

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEE-GFDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESGK G+GG D EE  F+   K KKDP+AS GFD ++T
Sbjct  555  RPSMGDVLWNLEFALQLQESAEESGK-GIGGADGEEVAFNAASKGKKDPDASSGFDGNIT  613

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++S+G+SMSIGGRSLASEDSDGLTP
Sbjct  614  DSRSTGMSMSIGGRSLASEDSDGLTP  639



>ref|XP_002279218.3| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=893

 Score =   343 bits (881),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 190/206 (92%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP LDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  676  VSDFGLSKTGPALDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  735

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HC KKGILDQI DPYLKGKIAPECFKK AETAVKCV+D G D
Sbjct  736  ALNPTLPKEQVSLAEWALHCQKKGILDQIIDPYLKGKIAPECFKKIAETAVKCVSDQGID  795

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEG-FDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEE+G   +GG++IE+G FD+ C  KKDP +SPGFD ++T
Sbjct  796  RPSMGDVLWNLEFALQLQESAEEAGT-AMGGMEIEDGSFDIACGGKKDPNSSPGFDGNVT  854

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++SSG++MSIGGRSLASEDSDGLTP
Sbjct  855  DSRSSGMTMSIGGRSLASEDSDGLTP  880



>ref|XP_011018979.1| PREDICTED: receptor-like protein kinase FERONIA, partial [Populus 
euphratica]
Length=297

 Score =   325 bits (834),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 184/205 (90%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  81   VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  140

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGILDQI DPYLKGKIAPECFKKFAETA+KCV+D   D
Sbjct  141  ALNPTLPKEQVSLAEWAAHCHKKGILDQILDPYLKGKIAPECFKKFAETAMKCVSDQSID  200

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAE+  KG +G  D E  F    K KKDP+AS G+D ++ D
Sbjct  201  RPSMGDVLWNLEFALQLQESAEDGAKGIVGA-DEEVPFKAAYKGKKDPDASLGYDGNVID  259

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSGISMSIGGRSLASEDSDGLTP
Sbjct  260  SRSSGISMSIGGRSLASEDSDGLTP  284



>gb|EYU42039.1| hypothetical protein MIMGU_mgv1a001343mg [Erythranthe guttata]
Length=837

 Score =   341 bits (875),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 194/206 (94%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP LDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYS+GVVLFEI+CARP
Sbjct  620  VSDFGLSKTGPALDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSYGVVLFEIICARP  679

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGIL+Q+ DPYLKGKIAPECFKKFAETAVKCV+DVGTD
Sbjct  680  ALNPTLPKEQVSLAEWAQHCHKKGILEQMMDPYLKGKIAPECFKKFAETAVKCVSDVGTD  739

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCK-DKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESGKG LG +DIE  +++T K  KKDP++S GFD ++T
Sbjct  740  RPSMGDVLWNLEFALQLQESAEESGKGVLGEMDIES-YEITSKGGKKDPDSSLGFDGNIT  798

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++SSG+SMSIGGRSLASEDSDGLTP
Sbjct  799  DSKSSGMSMSIGGRSLASEDSDGLTP  824



>gb|KJB71482.1| hypothetical protein B456_011G124900 [Gossypium raimondii]
Length=893

 Score =   342 bits (876),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 193/206 (94%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFEILCARP
Sbjct  676  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARP  735

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGILDQI DPYLKGKI PECFKKFAETA+KCVAD G +
Sbjct  736  ALNPTLPKEQVSLAEWAAHCHKKGILDQIMDPYLKGKITPECFKKFAETAMKCVADEGIE  795

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEG-FDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESGK G+G +D+EEG ++ TCK KKDP AS G+D ++T
Sbjct  796  RPSMGDVLWNLEFALQLQESAEESGK-GIGEMDMEEGSYEGTCKGKKDPNASLGYDGNIT  854

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++SSG+SMSIGGRSLASEDS+GLTP
Sbjct  855  DSRSSGMSMSIGGRSLASEDSEGLTP  880



>ref|XP_002528705.1| kinase, putative [Ricinus communis]
 gb|EEF33694.1| kinase, putative [Ricinus communis]
Length=891

 Score =   342 bits (876),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 191/206 (93%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEI+CARP
Sbjct  674  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEIICARP  733

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LPKEQVSLAEWA HCHKKGILDQI DPYLKGKIAPECFKKFAETA+KCV+DVG D
Sbjct  734  ALNPALPKEQVSLAEWAAHCHKKGILDQIVDPYLKGKIAPECFKKFAETAMKCVSDVGID  793

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEG-FDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESGK G+G +D EE  F+   K KKD +ASPGFD ++T
Sbjct  794  RPSMGDVLWNLEFALQLQESAEESGK-GIGRLDEEEMPFNTASKGKKDLDASPGFDGNIT  852

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++SSG+SMSIGGRSLASEDSDGLTP
Sbjct  853  DSRSSGMSMSIGGRSLASEDSDGLTP  878



>ref|XP_002308259.1| kinase family protein [Populus trichocarpa]
 gb|EEE91782.1| kinase family protein [Populus trichocarpa]
Length=893

 Score =   338 bits (868),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 189/205 (92%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  677  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  736

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGILDQI DPYLKGKIAPECFKKFAETA+KCV+D   D
Sbjct  737  ALNPTLPKEQVSLAEWAAHCHKKGILDQILDPYLKGKIAPECFKKFAETAMKCVSDESID  796

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAE+  K G+ G+D E  F+V  K KKDP+ASPG+D ++TD
Sbjct  797  RPSMGDVLWNLEFALQLQESAEDGAK-GIVGVDEEVPFNVAYKGKKDPDASPGYDGNVTD  855

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSGISMSIGGRSLASEDSDGLTP
Sbjct  856  SRSSGISMSIGGRSLASEDSDGLTP  880



>gb|KJB38065.1| hypothetical protein B456_006G235700 [Gossypium raimondii]
Length=895

 Score =   337 bits (865),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 190/210 (90%), Gaps = 8/210 (4%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFEILCARP
Sbjct  676  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARP  735

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGILDQI DPYLKGKIAPECFKKFAETA+KCVAD G +
Sbjct  736  ALNPTLPKEQVSLAEWAAHCHKKGILDQIMDPYLKGKIAPECFKKFAETAMKCVADQGIE  795

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEG-FDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESGK G+  IDIEEG +D+TCK KKD   SPGFD ++T
Sbjct  796  RPSMGDVLWNLEFALQLQESAEESGK-GIDAIDIEEGTYDITCKGKKD--VSPGFDGTVT  852

Query  538  DTQssgismsigg----rsLASEDSDGLTP  615
            D++SSG+S S+      RSLASEDSDGLTP
Sbjct  853  DSRSSGMSTSMSMSIGGRSLASEDSDGLTP  882



>ref|XP_010043538.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 ref|XP_010043545.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW88392.1| hypothetical protein EUGRSUZ_A00782 [Eucalyptus grandis]
Length=897

 Score =   335 bits (860),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 192/207 (93%), Gaps = 3/207 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFEILCARP
Sbjct  679  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARP  738

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGIL+ I DP+LKGKI+PECFKKFAETA+KCV D G +
Sbjct  739  ALNPTLPKEQVSLAEWAAHCHKKGILEHIMDPHLKGKISPECFKKFAETAMKCVNDQGIE  798

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEG-FD-VTCKDKKDPEASPGFDASM  534
            RPSMGDVLWNLEFALQLQESAEESGK G GG+ +++G FD   CK KKDP+ SPGFD+++
Sbjct  799  RPSMGDVLWNLEFALQLQESAEESGK-GFGGVGMDDGAFDAAACKGKKDPDVSPGFDSNV  857

Query  535  TDTQssgismsiggrsLASEDSDGLTP  615
            +D++SSG+SMSIGGRSLASEDSDGLTP
Sbjct  858  SDSRSSGMSMSIGGRSLASEDSDGLTP  884



>ref|XP_010098025.1| Receptor-like protein kinase FERONIA [Morus notabilis]
 gb|EXB74408.1| Receptor-like protein kinase FERONIA [Morus notabilis]
Length=888

 Score =   334 bits (856),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 190/205 (93%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  675  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  734

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGILDQI DPYLKGKIAPECFKKFAETA+KCV+D G +
Sbjct  735  ALNPTLPKEQVSLAEWAAHCHKKGILDQILDPYLKGKIAPECFKKFAETAMKCVSDQGIE  794

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESG+ G G I+ EE F + CK  KDP ASPGFD ++TD
Sbjct  795  RPSMGDVLWNLEFALQLQESAEESGE-GFGNIE-EEPF-MPCKG-KDPNASPGFDGNVTD  850

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSG+SMSIGGRSLASEDSDGLTP
Sbjct  851  SRSSGMSMSIGGRSLASEDSDGLTP  875



>ref|XP_002323088.2| kinase family protein [Populus trichocarpa]
 gb|EEF04849.2| kinase family protein [Populus trichocarpa]
Length=894

 Score =   332 bits (851),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 186/205 (91%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  678  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  737

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGILDQI DPYLKGKI PECFKKFAETA+KCV+D   D
Sbjct  738  ALNPTLPKEQVSLAEWAAHCHKKGILDQILDPYLKGKITPECFKKFAETAMKCVSDQSID  797

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAE+ GKG +G  D E  F+VT K K  P+ASPG+D  +TD
Sbjct  798  RPSMGDVLWNLEFALQLQESAEDGGKGIVGADDEEVPFNVTYKGKA-PDASPGYDGIVTD  856

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSGISMSIGGRSLASEDSDGLTP
Sbjct  857  SRSSGISMSIGGRSLASEDSDGLTP  881



>ref|XP_008463270.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
 ref|XP_008463271.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
 ref|XP_008463272.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
Length=897

 Score =   331 bits (849),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 187/206 (91%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE+LCARP
Sbjct  680  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARP  739

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HC+ KGILDQI D +LKGKIA EC KKFAETA+KCV+D G D
Sbjct  740  ALNPTLPKEQVSLAEWAAHCYNKGILDQIIDTFLKGKIASECLKKFAETAMKCVSDQGID  799

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEG-FDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESGK G  G+D+EEG  DV  K KKDP+ASPG D ++T
Sbjct  800  RPSMGDVLWNLEFALQLQESAEESGKVG-SGMDVEEGQLDVVYKGKKDPDASPGIDGNIT  858

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++S+GISMSIG RSLASEDSDGLTP
Sbjct  859  DSRSTGISMSIGSRSLASEDSDGLTP  884



>ref|XP_004142677.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cucumis 
sativus]
 ref|XP_004161706.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cucumis 
sativus]
 gb|KGN54458.1| hypothetical protein Csa_4G334690 [Cucumis sativus]
Length=897

 Score =   331 bits (848),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 187/206 (91%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE+LCARP
Sbjct  680  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARP  739

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HC+ KGILDQI D +LKGKIA EC KKFAETA+KCV+D G D
Sbjct  740  ALNPTLPKEQVSLAEWAAHCYNKGILDQIIDTFLKGKIASECLKKFAETAMKCVSDQGID  799

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEG-FDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESGK G  G+D+EEG  DV  K KKDP+ASPG D ++T
Sbjct  800  RPSMGDVLWNLEFALQLQESAEESGKVG-SGMDVEEGQLDVVYKGKKDPDASPGIDGNIT  858

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++S+GISMSIG RSLASEDSDGLTP
Sbjct  859  DSRSTGISMSIGSRSLASEDSDGLTP  884



>ref|XP_004302537.1| PREDICTED: receptor-like protein kinase FERONIA [Fragaria vesca 
subsp. vesca]
Length=883

 Score =   330 bits (846),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 188/205 (92%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLD+THVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFEILCARP
Sbjct  668  VSDFGLSKTGPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARP  727

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKG+LDQI DPYLKGKI PECF+KFAETA+KCV+D   D
Sbjct  728  ALNPTLPKEQVSLAEWAAHCHKKGMLDQILDPYLKGKITPECFRKFAETAMKCVSDQSID  787

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESGKG   G+DIEE   + CK KKD +ASPGFD + TD
Sbjct  788  RPSMGDVLWNLEFALQLQESAEESGKG--IGMDIEEEPFMACKGKKDLDASPGFDGNGTD  845

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSGISMS+GGRSLAS+DSDGLTP
Sbjct  846  SRSSGISMSMGGRSLASDDSDGLTP  870



>ref|XP_008244701.1| PREDICTED: receptor-like protein kinase FERONIA [Prunus mume]
Length=891

 Score =   330 bits (845),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 187/205 (91%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLD+THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  675  VSDFGLSKTGPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  734

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLAEWA HCHKKG LD I DPYLKGKI PECFKKFAETA+KCV+D   D
Sbjct  735  ALNPSLPKEQVSLAEWAAHCHKKGSLDHILDPYLKGKITPECFKKFAETAMKCVSDQSID  794

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESGK G+G +++EE   + CK KKDP+A P FD ++TD
Sbjct  795  RPSMGDVLWNLEFALQLQESAEESGK-GIGAMELEEEPFMACKGKKDPDAVPAFDGNVTD  853

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSG+SMSIGGRSLAS+DSDGLTP
Sbjct  854  SRSSGMSMSIGGRSLASDDSDGLTP  878



>ref|XP_009337788.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=893

 Score =   328 bits (841),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 187/206 (91%), Gaps = 1/206 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLD+THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  675  VSDFGLSKTGPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  734

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGIL+ I DP+LKGKI PECFKKFAETA+KCV+D   D
Sbjct  735  ALNPTLPKEQVSLAEWAAHCHKKGILEHILDPHLKGKITPECFKKFAETAMKCVSDQSID  794

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFD-VTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESGKG  GG+DIEE    V  K KKDP+A PG+D ++T
Sbjct  795  RPSMGDVLWNLEFALQLQESAEESGKGIGGGMDIEEEEPLVDYKGKKDPDAMPGYDGNVT  854

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++S+G+SMSIGGRSLAS DSDGLTP
Sbjct  855  DSRSTGMSMSIGGRSLASVDSDGLTP  880



>ref|XP_011016728.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=893

 Score =   327 bits (839),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 184/205 (90%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  677  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  736

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGILDQI DPYLKGKIAPECFKKFAETA+KCV+D   D
Sbjct  737  ALNPTLPKEQVSLAEWAAHCHKKGILDQILDPYLKGKIAPECFKKFAETAMKCVSDQSID  796

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAE+  K G+ G D E  F    K KKDP+AS G+D ++ D
Sbjct  797  RPSMGDVLWNLEFALQLQESAEDGAK-GIVGADEEVPFKAAYKGKKDPDASLGYDGNVID  855

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSGISMSIGGRSLASEDSDGLTP
Sbjct  856  SRSSGISMSIGGRSLASEDSDGLTP  880



>emb|CDP06378.1| unnamed protein product [Coffea canephora]
Length=889

 Score =   327 bits (837),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 188/212 (89%), Gaps = 11/212 (5%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  669  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  728

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LPKEQVSLAEWA HC+KKGILDQ+ DPYLKGKIA ECFKK AETAVKCVADVGTD
Sbjct  729  ALNPALPKEQVSLAEWALHCYKKGILDQVMDPYLKGKIAAECFKKIAETAVKCVADVGTD  788

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGG---LGGIDIEEG-FD---VTCKDKKDPEASPG  519
            RPSMGDVLWNLEFALQLQESAEESG  G   +GG+D++EG FD   VT K +KDP    G
Sbjct  789  RPSMGDVLWNLEFALQLQESAEESGTEGVGLVGGVDLQEGTFDGEEVTGKGRKDPNGGGG  848

Query  520  FDASMTDTQssgismsiggrsLASEDSDGLTP  615
            F+    D++SSG++MSIGGRSLASEDSDGLTP
Sbjct  849  FE----DSRSSGMTMSIGGRSLASEDSDGLTP  876



>ref|XP_007208402.1| hypothetical protein PRUPE_ppa001164mg [Prunus persica]
 gb|EMJ09601.1| hypothetical protein PRUPE_ppa001164mg [Prunus persica]
Length=891

 Score =   326 bits (836),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 186/205 (91%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLD+THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  675  VSDFGLSKTGPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  734

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLAEWA HCHKKG LD I DPYLKGKI PECFKKFAETA+KCV+D   D
Sbjct  735  ALNPSLPKEQVSLAEWAAHCHKKGSLDHILDPYLKGKITPECFKKFAETAMKCVSDQSID  794

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESGK G+G +++EE   + CK KK P+A P FD ++TD
Sbjct  795  RPSMGDVLWNLEFALQLQESAEESGK-GIGAMELEEEPFMACKGKKYPDAVPAFDGNVTD  853

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSG+SMSIGGRSLAS+DSDGLTP
Sbjct  854  SRSSGMSMSIGGRSLASDDSDGLTP  878



>ref|XP_011001679.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=894

 Score =   325 bits (832),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/205 (84%), Positives = 182/205 (89%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  678  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  737

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGILDQI DPYLKGKI PECFKKFAETA+KCV+D   D
Sbjct  738  ALNPTLPKEQVSLAEWAAHCHKKGILDQILDPYLKGKITPECFKKFAETAMKCVSDQSID  797

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAE+  K  +G  D E  F+V  K K  P+ASPG+D   TD
Sbjct  798  RPSMGDVLWNLEFALQLQESAEDGSKDIVGADDEEVPFNVAYKGKA-PDASPGYDGIATD  856

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSGISMSIGGRSLASEDSDGLTP
Sbjct  857  SRSSGISMSIGGRSLASEDSDGLTP  881



>ref|XP_010683454.1| PREDICTED: receptor-like protein kinase FERONIA [Beta vulgaris 
subsp. vulgaris]
Length=881

 Score =   323 bits (828),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 186/206 (90%), Gaps = 6/206 (3%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP+LDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFEILCARP
Sbjct  668  VSDFGLSKTGPSLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARP  727

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLAEWA +C+KKGIL+QI DPYLKGKIAPECFKKFAETA+KCV+D   D
Sbjct  728  ALNPSLPKEQVSLAEWAVYCYKKGILEQIMDPYLKGKIAPECFKKFAETAMKCVSDQSID  787

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEG-FDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESGK GLGG+D  EG +D+ C  KKDP+ S  FD ++T
Sbjct  788  RPSMGDVLWNLEFALQLQESAEESGK-GLGGMDFVEGKYDIDC-GKKDPDDSRAFDGNVT  845

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++    +MSIGGRSLASEDSDGLTP
Sbjct  846  DSR---STMSIGGRSLASEDSDGLTP  868



>ref|XP_010244547.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=890

 Score =   320 bits (821),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 183/208 (88%), Gaps = 5/208 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  672  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  731

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA HC KKGILDQI DPYLKGKIAPECFKKFAE A KCVAD G D
Sbjct  732  ALNPTLAKEQVSLAEWALHCQKKGILDQIIDPYLKGKIAPECFKKFAEIAEKCVADQGID  791

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDI---EEGFDVTCKDKKDPEASPGFDAS  531
            RP+MGDVLW+LEFALQLQESAEE+  GGL   D+   E  F+  C  KKDP+AS GF+ +
Sbjct  792  RPAMGDVLWHLEFALQLQESAEEN--GGLATCDMDAYETPFNGKCGGKKDPDASSGFEGN  849

Query  532  MTDTQssgismsiggrsLASEDSDGLTP  615
            +TD++SSG++MSIGGRSL SEDSDGLTP
Sbjct  850  VTDSRSSGMTMSIGGRSLGSEDSDGLTP  877



>ref|XP_004492579.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=896

 Score =   317 bits (813),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 185/206 (90%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLD+THVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFEILCARP
Sbjct  679  VSDFGLSKTGPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARP  738

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA HC+KKGILDQI+DPYLKGKIAPECFKKFAETA+KCVAD   +
Sbjct  739  ALNPTLAKEQVSLAEWAAHCYKKGILDQISDPYLKGKIAPECFKKFAETAMKCVADQSIE  798

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIE-EGFDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESG  G GGI  E E      K KK+ +A PG+D ++T
Sbjct  799  RPSMGDVLWNLEFALQLQESAEESGN-GFGGIHGEDEPLFTDLKGKKELDALPGYDGNVT  857

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++SSG+SMSIGGRSLASEDSDGLTP
Sbjct  858  DSKSSGLSMSIGGRSLASEDSDGLTP  883



>ref|XP_010252026.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=886

 Score =   317 bits (812),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 180/205 (88%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  672  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  731

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HC KKGILDQI DPYLKGKIAPECFKKFAETA KCV+D G D
Sbjct  732  ALNPTLPKEQVSLAEWALHCQKKGILDQIIDPYLKGKIAPECFKKFAETAEKCVSDQGID  791

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RP+MGDVLWNLEFALQLQESAE SG     G + E  F   C  KKDP+A  GF+ S T+
Sbjct  792  RPAMGDVLWNLEFALQLQESAESSGFSSDLGTE-ETTFTGKC--KKDPDAYSGFEGSTTE  848

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSG++MSIGG+SLASEDSDGLTP
Sbjct  849  SKSSGMTMSIGGQSLASEDSDGLTP  873



>ref|NP_001237656.1| FERONIA receptor-like kinase precursor [Glycine max]
 gb|ACM89524.1| FERONIA receptor-like kinase [Glycine max]
Length=892

 Score =   316 bits (810),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 182/205 (89%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLD+THVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE+LCARP
Sbjct  678  VSDFGLSKTGPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARP  737

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA HC++KGILD I DPYLKGKIAPECFKKFAETA+KCVAD G D
Sbjct  738  ALNPTLAKEQVSLAEWAAHCYQKGILDSIIDPYLKGKIAPECFKKFAETAMKCVADQGID  797

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESG  G G I  EE      K KKD  + PG+D ++TD
Sbjct  798  RPSMGDVLWNLEFALQLQESAEESGN-GFGDIHCEEPLYTDSKGKKD--SDPGYDGNVTD  854

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSGISMSIGGRSLASEDSDGLTP
Sbjct  855  SRSSGISMSIGGRSLASEDSDGLTP  879



>gb|KHN29489.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=896

 Score =   316 bits (810),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 182/205 (89%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLD+THVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE+LCARP
Sbjct  682  VSDFGLSKTGPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARP  741

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA HC++KGILD I DPYLKGKIAPECFKKFAETA+KCVAD G D
Sbjct  742  ALNPTLAKEQVSLAEWAAHCYQKGILDSIIDPYLKGKIAPECFKKFAETAMKCVADQGID  801

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESG  G G I  EE      K KKD  + PG+D ++TD
Sbjct  802  RPSMGDVLWNLEFALQLQESAEESGN-GFGDIHCEEPLYTDSKGKKD--SDPGYDGNVTD  858

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSGISMSIGGRSLASEDSDGLTP
Sbjct  859  SRSSGISMSIGGRSLASEDSDGLTP  883



>ref|XP_003609098.1| FERONIA receptor-like kinase [Medicago truncatula]
Length=893

 Score =   314 bits (805),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 183/206 (89%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLD+THVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE+LCARP
Sbjct  676  VSDFGLSKTGPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARP  735

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA HC+KKGILDQITDPYLKGKIAPECFKKFAETA+KCV D G +
Sbjct  736  ALNPTLAKEQVSLAEWAAHCYKKGILDQITDPYLKGKIAPECFKKFAETAMKCVNDQGIE  795

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIE-EGFDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESG  G GGI  E E      K KK  +  PG+D ++T
Sbjct  796  RPSMGDVLWNLEFALQLQESAEESGN-GFGGICGEDEPLFADSKGKKGVDVLPGYDGNVT  854

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++SSG+SMSIGGRSLASEDSDGLTP
Sbjct  855  DSKSSGMSMSIGGRSLASEDSDGLTP  880



>gb|KEH23293.1| feronia receptor-like kinase [Medicago truncatula]
Length=899

 Score =   314 bits (805),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 183/206 (89%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLD+THVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE+LCARP
Sbjct  682  VSDFGLSKTGPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARP  741

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA HC+KKGILDQITDPYLKGKIAPECFKKFAETA+KCV D G +
Sbjct  742  ALNPTLAKEQVSLAEWAAHCYKKGILDQITDPYLKGKIAPECFKKFAETAMKCVNDQGIE  801

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIE-EGFDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESG  G GGI  E E      K KK  +  PG+D ++T
Sbjct  802  RPSMGDVLWNLEFALQLQESAEESGN-GFGGICGEDEPLFADSKGKKGVDVLPGYDGNVT  860

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++SSG+SMSIGGRSLASEDSDGLTP
Sbjct  861  DSKSSGMSMSIGGRSLASEDSDGLTP  886



>ref|XP_010529939.1| PREDICTED: receptor-like protein kinase FERONIA [Tarenaya hassleriana]
Length=892

 Score =   312 bits (800),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 184/210 (88%), Gaps = 8/210 (4%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFEILCARP
Sbjct  673  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARP  732

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HC+KKG+LDQI DP+LKGKI PECFKKFAETA+KCV+D G +
Sbjct  733  ALNPTLPKEQVSLAEWAPHCYKKGMLDQIVDPFLKGKITPECFKKFAETAMKCVSDQGIE  792

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGF--DVTCKDKKDPE---ASPGFD  525
            RPSMGDVLWNLEFA+QLQES EESGK   GGID++E    D  CK KK  E    + GF+
Sbjct  793  RPSMGDVLWNLEFAMQLQESVEESGK---GGIDMDEVKYDDADCKGKKGAENENNANGFE  849

Query  526  ASMTDTQssgismsiggrsLASEDSDGLTP  615
             ++ D++SSGI +SIGGRSLASEDSDGLTP
Sbjct  850  GNVMDSRSSGIDISIGGRSLASEDSDGLTP  879



>ref|XP_008364006.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Malus domestica]
Length=747

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 187/205 (91%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLD+THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  531  VSDFGLSKTGPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  590

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGIL+ I DP+LKGKI PECFKKFAETA+KCV+D   D
Sbjct  591  ALNPTLPKEQVSLAEWAAHCHKKGILEHILDPHLKGKITPECFKKFAETAMKCVSDQSID  650

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESG+G  GG+DIEE   +  K  KDP+A PG+D ++TD
Sbjct  651  RPSMGDVLWNLEFALQLQESAEESGEGIGGGMDIEEEPFMGSKG-KDPKAMPGYDGNVTD  709

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++S+G+SMSIGGRSLAS+DSDGLTP
Sbjct  710  SRSTGMSMSIGGRSLASDDSDGLTP  734



>ref|XP_007140079.1| hypothetical protein PHAVU_008G082400g [Phaseolus vulgaris]
 gb|ESW12073.1| hypothetical protein PHAVU_008G082400g [Phaseolus vulgaris]
Length=898

 Score =   311 bits (796),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 181/206 (88%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLD+THVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFEILCARP
Sbjct  681  VSDFGLSKTGPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARP  740

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP L KEQVSLAEWA HC+ KG LDQI DPYLKGKIAPECFKKFAETA+KCVAD G +
Sbjct  741  ALNPALAKEQVSLAEWAAHCYLKGTLDQIIDPYLKGKIAPECFKKFAETAMKCVADQGIE  800

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIE-EGFDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESG  G GGI  E E      K KKD +A  G+D ++T
Sbjct  801  RPSMGDVLWNLEFALQLQESAEESGN-GFGGIGNEVEPTYTDSKGKKDSDAMGGYDGNVT  859

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++SSGISMSIGGRSLASEDSDGLTP
Sbjct  860  DSRSSGISMSIGGRSLASEDSDGLTP  885



>ref|XP_002877809.1| hypothetical protein ARALYDRAFT_485507 [Arabidopsis lyrata subsp. 
lyrata]
 gb|ABT18096.1| FERONIA receptor-like kinase [Arabidopsis lyrata]
 gb|EFH54068.1| hypothetical protein ARALYDRAFT_485507 [Arabidopsis lyrata subsp. 
lyrata]
Length=891

 Score =   310 bits (793),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 183/207 (88%), Gaps = 3/207 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LCARP
Sbjct  673  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARP  732

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DPYLKGKI PECFKKFAETA+KCV D G +
Sbjct  733  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIE  792

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGF--DVTCKDKKDPEASPGFDASM  534
            RPSMGDVLWNLEFALQLQESAEESGKG  G +D++E    D  CK K D ++S  ++ ++
Sbjct  793  RPSMGDVLWNLEFALQLQESAEESGKGVCGDMDMDEIKYDDGNCKGKND-KSSDVYEGNV  851

Query  535  TDTQssgismsiggrsLASEDSDGLTP  615
            TD++SSGI MSIGGRSLASEDSDGLTP
Sbjct  852  TDSRSSGIDMSIGGRSLASEDSDGLTP  878



>ref|NP_001238686.1| receptor-like kinase [Glycine max]
 gb|ACM89482.1| receptor-like kinase [Glycine max]
Length=883

 Score =   309 bits (792),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 180/205 (88%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLD+THVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE+LCARP
Sbjct  669  VSDFGLSKTGPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARP  728

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA HC+KKGILD I DPYLKGKIA ECFKKFAETA+KCVAD G D
Sbjct  729  ALNPTLAKEQVSLAEWAAHCYKKGILDSIIDPYLKGKIASECFKKFAETAMKCVADQGID  788

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESG  G G I  E   +    D K  +++PG+D + TD
Sbjct  789  RPSMGDVLWNLEFALQLQESAEESGN-GFGDIHCE--VEPLYTDSKGKDSNPGYDGNATD  845

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSGISMSIGGRSLASEDSDGLTP
Sbjct  846  SRSSGISMSIGGRSLASEDSDGLTP  870



>ref|XP_007140062.1| hypothetical protein PHAVU_008G081000g [Phaseolus vulgaris]
 gb|ESW12056.1| hypothetical protein PHAVU_008G081000g [Phaseolus vulgaris]
Length=899

 Score =   310 bits (793),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 181/206 (88%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLD+THVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFEILCARP
Sbjct  682  VSDFGLSKTGPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEILCARP  741

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP L KEQVSLAEWA HC+ KG LDQ+ DPYLKGKIAPECFKKFAETA+KCVAD G +
Sbjct  742  ALNPALAKEQVSLAEWAAHCYLKGTLDQLIDPYLKGKIAPECFKKFAETAMKCVADQGIE  801

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIE-EGFDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEESG  G GGI  E E      K KKD +A  G+D ++T
Sbjct  802  RPSMGDVLWNLEFALQLQESAEESGN-GFGGIHNEVEPTYTDSKGKKDSDAMGGYDGNVT  860

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++SSGISMSIGGRSLASEDSDGLTP
Sbjct  861  DSRSSGISMSIGGRSLASEDSDGLTP  886



>gb|KHN40613.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=894

 Score =   310 bits (793),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 180/205 (88%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLD+THVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE+LCARP
Sbjct  680  VSDFGLSKTGPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARP  739

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA HC+KKGILD I DPYLKGKIA ECFKKFAETA+KCVAD G D
Sbjct  740  ALNPTLAKEQVSLAEWAAHCYKKGILDSIIDPYLKGKIASECFKKFAETAMKCVADQGID  799

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESG  G G I  E   +    D K  +++PG+D + TD
Sbjct  800  RPSMGDVLWNLEFALQLQESAEESGN-GFGDIHCE--VEPLYTDSKGKDSNPGYDGNATD  856

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSGISMSIGGRSLASEDSDGLTP
Sbjct  857  SRSSGISMSIGGRSLASEDSDGLTP  881



>ref|NP_190723.1| receptor-like protein kinase FERONIA [Arabidopsis thaliana]
 sp|Q9SCZ4.1|FERON_ARATH RecName: Full=Receptor-like protein kinase FERONIA; AltName: 
Full=Protein SIRENE; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB63019.1| receptor-protein kinase-like protein [Arabidopsis thaliana]
 gb|AEE78805.1| receptor-like protein kinase FERONIA [Arabidopsis thaliana]
Length=895

 Score =   309 bits (791),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 183/207 (88%), Gaps = 3/207 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LCARP
Sbjct  677  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARP  736

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DPYLKGKI PECFKKFAETA+KCV D G +
Sbjct  737  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIE  796

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGF--DVTCKDKKDPEASPGFDASM  534
            RPSMGDVLWNLEFALQLQESAEE+GKG  G +D++E    D  CK K D ++S  ++ ++
Sbjct  797  RPSMGDVLWNLEFALQLQESAEENGKGVCGDMDMDEIKYDDGNCKGKND-KSSDVYEGNV  855

Query  535  TDTQssgismsiggrsLASEDSDGLTP  615
            TD++SSGI MSIGGRSLASEDSDGLTP
Sbjct  856  TDSRSSGIDMSIGGRSLASEDSDGLTP  882



>gb|AAK59558.1| putative receptor-protein kinase [Arabidopsis thaliana]
Length=895

 Score =   309 bits (791),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 183/207 (88%), Gaps = 3/207 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LCARP
Sbjct  677  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARP  736

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DPYLKGKI PECFKKFAETA+KCV D G +
Sbjct  737  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIE  796

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGF--DVTCKDKKDPEASPGFDASM  534
            RPSMGDVLWNLEFALQLQESAEE+GKG  G +D++E    D  CK K D ++S  ++ ++
Sbjct  797  RPSMGDVLWNLEFALQLQESAEENGKGVCGDMDMDEIKYDDGNCKGKND-KSSDVYEGNV  855

Query  535  TDTQssgismsiggrsLASEDSDGLTP  615
            TD++SSGI MSIGGRSLASEDSDGLTP
Sbjct  856  TDSRSSGIDMSIGGRSLASEDSDGLTP  882



>gb|ABT18100.1| FERONIA receptor-like kinase [Arabidopsis thaliana]
Length=893

 Score =   308 bits (790),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 183/207 (88%), Gaps = 3/207 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LCARP
Sbjct  675  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARP  734

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DPYLKGKI PECFKKFAETA+KCV D G +
Sbjct  735  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIE  794

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGF--DVTCKDKKDPEASPGFDASM  534
            RPSMGDVLWNLEFALQLQESAEE+GKG  G +D++E    D  CK K D ++S  ++ ++
Sbjct  795  RPSMGDVLWNLEFALQLQESAEENGKGVCGDMDMDEIKYDDGNCKGKND-KSSDVYEGNV  853

Query  535  TDTQssgismsiggrsLASEDSDGLTP  615
            TD++SSGI MSIGGRSLASEDSDGLTP
Sbjct  854  TDSRSSGIDMSIGGRSLASEDSDGLTP  880



>ref|XP_008370279.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=891

 Score =   308 bits (790),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 187/205 (91%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLD+THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  675  VSDFGLSKTGPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  734

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGIL+ I DP+LKGKI PECFKKFAETA+KCV+D   D
Sbjct  735  ALNPTLPKEQVSLAEWAAHCHKKGILEHILDPHLKGKITPECFKKFAETAMKCVSDQSID  794

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESG+G  GG+DIEE   +  K  KDP+A PG+D ++TD
Sbjct  795  RPSMGDVLWNLEFALQLQESAEESGEGIGGGMDIEEEPFMGSKG-KDPKAMPGYDGNVTD  853

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++S+G+SMSIGGRSLAS+DSDGLTP
Sbjct  854  SRSTGMSMSIGGRSLASDDSDGLTP  878



>ref|XP_006290584.1| hypothetical protein CARUB_v10016673mg [Capsella rubella]
 gb|EOA23482.1| hypothetical protein CARUB_v10016673mg [Capsella rubella]
Length=892

 Score =   307 bits (787),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 183/207 (88%), Gaps = 3/207 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LCARP
Sbjct  674  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARP  733

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DPYLKGKI PECFKKFAETA+KCV D G +
Sbjct  734  ALNPTLEKEQVSLAEWAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIE  793

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGF--DVTCKDKKDPEASPGFDASM  534
            RPSMGDVLWNLEFALQLQESAEESGKG  G +D+++    D  CK K D ++S  ++ ++
Sbjct  794  RPSMGDVLWNLEFALQLQESAEESGKGICGDLDMDKIKYDDGNCKGKND-KSSDVYEGNV  852

Query  535  TDTQssgismsiggrsLASEDSDGLTP  615
            TD++SSGI MSIGGRSLASEDSDGLTP
Sbjct  853  TDSRSSGIDMSIGGRSLASEDSDGLTP  879



>ref|XP_010503851.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=895

 Score =   307 bits (786),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 182/207 (88%), Gaps = 3/207 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LCARP
Sbjct  677  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARP  736

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DPYLKGKI PECFKKFAETA+KCV D G +
Sbjct  737  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIE  796

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGF--DVTCKDKKDPEASPGFDASM  534
            RPSMGDVLWNLEFALQLQESAEESGKG    +D++E    D  CK K D ++S  ++ ++
Sbjct  797  RPSMGDVLWNLEFALQLQESAEESGKGICSDMDMDEIKYDDGNCKGKND-KSSDVYEGNV  855

Query  535  TDTQssgismsiggrsLASEDSDGLTP  615
            TD++SSGI MSIGGRSLASEDSDGLTP
Sbjct  856  TDSRSSGIDMSIGGRSLASEDSDGLTP  882



>ref|XP_010515573.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=896

 Score =   307 bits (786),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 182/207 (88%), Gaps = 3/207 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LCARP
Sbjct  678  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARP  737

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DPYLKGKI PECFKKFAETA+KCV D G +
Sbjct  738  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIE  797

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGF--DVTCKDKKDPEASPGFDASM  534
            RPSMGDVLWNLEFALQLQESAEESGKG    +D++E    D  CK K D ++S  ++ ++
Sbjct  798  RPSMGDVLWNLEFALQLQESAEESGKGICSDMDMDEIKYDDGNCKGKND-KSSDVYEGNV  856

Query  535  TDTQssgismsiggrsLASEDSDGLTP  615
            TD++SSGI MSIGGRSLASEDSDGLTP
Sbjct  857  TDSRSSGIDMSIGGRSLASEDSDGLTP  883



>ref|XP_010426729.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=894

 Score =   307 bits (786),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 182/207 (88%), Gaps = 3/207 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LCARP
Sbjct  676  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARP  735

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DPYLKGKI PECFKKFAETA+KCV D G +
Sbjct  736  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIE  795

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGF--DVTCKDKKDPEASPGFDASM  534
            RPSMGDVLWNLEFALQLQESAEESGKG    +D++E    D  CK K D ++S  ++ ++
Sbjct  796  RPSMGDVLWNLEFALQLQESAEESGKGICSDMDMDEIKYDDGNCKGKND-KSSDVYEGNV  854

Query  535  TDTQssgismsiggrsLASEDSDGLTP  615
            TD++SSGI MSIGGRSLASEDSDGLTP
Sbjct  855  TDSRSSGIDMSIGGRSLASEDSDGLTP  881



>dbj|BAJ91215.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=402

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 170/205 (83%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP++DHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  190  VSDFGLSKTGPSMDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  249

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KE+VSLAEWA HC KKGILDQI DPYLKGKI P+CFKKFAETA KCVAD G +
Sbjct  250  ALNPTLAKEEVSLAEWALHCQKKGILDQIVDPYLKGKIVPQCFKKFAETAEKCVADNGIE  309

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQ+QESAEESG  G G  D  EG  +    KKDP   P  D+S T 
Sbjct  310  RPSMGDVLWNLEFALQMQESAEESGSIGCGMSD--EGTPLVMVGKKDPN-DPSIDSSTTT  366

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T     S+S+G +S+AS DSDGLTP
Sbjct  367  TT--TTSLSMGDQSVASIDSDGLTP  389



>ref|XP_009370899.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
 ref|XP_009370904.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=892

 Score =   305 bits (782),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLD+THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  675  VSDFGLSKTGPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  734

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HCHKKGIL+ I DP+LKGKI PECFKKFAETA+KCV+D   D
Sbjct  735  ALNPTLPKEQVSLAEWAAHCHKKGILEHILDPHLKGKITPECFKKFAETAMKCVSDQSID  794

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESG+G  GG+DI E   +  K KK+ EA P +D ++TD
Sbjct  795  RPSMGDVLWNLEFALQLQESAEESGEGIGGGMDIGEEPFMDNKGKKEREAMPRYDGNVTD  854

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++S+G+SMSIGGRSLAS+DSDGLTP
Sbjct  855  SRSTGMSMSIGGRSLASDDSDGLTP  879



>gb|ABT18099.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=898

 Score =   305 bits (781),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 181/207 (87%), Gaps = 3/207 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LCARP
Sbjct  680  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARP  739

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DPYLKGKI PECFKKF+ETA+KCV D G +
Sbjct  740  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPYLKGKITPECFKKFSETAMKCVLDQGIE  799

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGF--DVTCKDKKDPEASPGFDASM  534
            RPSMGDVLWNLEFALQLQESAEE+GKG  G +D+ E    D  CK K D  +S  ++ ++
Sbjct  800  RPSMGDVLWNLEFALQLQESAEENGKGVGGDMDMNEIKYDDGNCKGKND-MSSDVYEGNV  858

Query  535  TDTQssgismsiggrsLASEDSDGLTP  615
            TD++SSGI MSIGGRSLASEDS+GLTP
Sbjct  859  TDSRSSGIDMSIGGRSLASEDSEGLTP  885



>gb|ABT18098.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=892

 Score =   305 bits (780),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 182/207 (88%), Gaps = 3/207 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPT+DHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LCARP
Sbjct  674  VSDFGLSKTGPTVDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARP  733

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DPYLKGKI PECFKKF+ETA+KCV D G +
Sbjct  734  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPYLKGKITPECFKKFSETAMKCVLDQGIE  793

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGF--DVTCKDKKDPEASPGFDASM  534
            RPSMGDVLWNLEFALQLQESAEE+GKG  G +D++E    D  CK K D  +S  ++ ++
Sbjct  794  RPSMGDVLWNLEFALQLQESAEENGKGVGGDVDMDEIKYDDGNCKGKND-MSSDVYEGNV  852

Query  535  TDTQssgismsiggrsLASEDSDGLTP  615
            TD++SSGI MSIGGRSLASEDS+GLTP
Sbjct  853  TDSRSSGIDMSIGGRSLASEDSEGLTP  879



>ref|XP_009115840.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
 ref|XP_009115841.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=895

 Score =   304 bits (778),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 181/207 (87%), Gaps = 2/207 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE LCARP
Sbjct  676  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARP  735

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DP+LKGKI PECFKKFAETA+KCV D G +
Sbjct  736  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIE  795

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGF--DVTCKDKKDPEASPGFDASM  534
            RPSMGDVLWNLEFALQLQESAEESGKG    +D++E    D  CK K + + S  ++ ++
Sbjct  796  RPSMGDVLWNLEFALQLQESAEESGKGICSEMDMDEIKYDDDNCKGKNNDKGSDVYEGNV  855

Query  535  TDTQssgismsiggrsLASEDSDGLTP  615
            TD++SSGI MSIGGRSLAS+DSDGLTP
Sbjct  856  TDSRSSGIDMSIGGRSLASDDSDGLTP  882



>ref|NP_001141864.1| uncharacterized protein LOC100274007 [Zea mays]
 gb|ACF87195.1| unknown [Zea mays]
Length=216

 Score =   285 bits (728),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 164/202 (81%), Gaps = 6/202 (3%)
 Frame = +1

Query  10   FGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALN  189
            FGLSKTGP++DHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARPALN
Sbjct  8    FGLSKTGPSMDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALN  67

Query  190  PTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTDRPS  369
            PTLPKE+VSLAEWA HC KKGILDQI DPYLKGKIAP+CFKKFAETA KCV+D G DRPS
Sbjct  68   PTLPKEEVSLAEWALHCQKKGILDQIVDPYLKGKIAPQCFKKFAETAEKCVSDQGIDRPS  127

Query  370  MGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTDTQs  549
            MGDVLWNLEFALQ+QE AEESG  G G  D      V  KD  DP          + T +
Sbjct  128  MGDVLWNLEFALQMQEGAEESGSLGCGMSDEGAPLMVGKKDPNDPS------IESSTTTT  181

Query  550  sgismsiggrsLASEDSDGLTP  615
            +  S+S+G +S+AS DSDGLTP
Sbjct  182  TTTSISMGDQSVASIDSDGLTP  203



>gb|ABT18097.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=891

 Score =   301 bits (772),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE LCARP
Sbjct  673  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARP  732

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DPYLKGKI PECFKKFAETA+KCV D G +
Sbjct  733  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIE  792

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEE-GFDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEE+GKG  G +D++E  ++      K+  +S  ++ ++T
Sbjct  793  RPSMGDVLWNLEFALQLQESAEENGKGMSGDMDMDEIKYNDGNGKGKNEMSSDVYEGNVT  852

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++SSGI MSIGGRSLASEDS+GLTP
Sbjct  853  DSRSSGIDMSIGGRSLASEDSEGLTP  878



>gb|ABT18095.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=891

 Score =   301 bits (771),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE LCARP
Sbjct  673  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARP  732

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DPYLKGKI PECFKKFAETA+KCV D G +
Sbjct  733  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIE  792

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEE-GFDVTCKDKKDPEASPGFDASMT  537
            RPSMGDVLWNLEFALQLQESAEE+GKG  G +D++E  ++      K+  +S  ++ ++T
Sbjct  793  RPSMGDVLWNLEFALQLQESAEENGKGMSGDMDMDEIKYNDGNGKGKNEMSSDVYEGNVT  852

Query  538  DTQssgismsiggrsLASEDSDGLTP  615
            D++SSGI MSIGGRSLASEDS+GLTP
Sbjct  853  DSRSSGIDMSIGGRSLASEDSEGLTP  878



>gb|ABT18094.1| FERONIA receptor-like kinase [Brassica oleracea]
Length=895

 Score =   298 bits (763),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 179/208 (86%), Gaps = 3/208 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP LDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE LCARP
Sbjct  675  VSDFGLSKTGPALDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARP  734

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DP+LKGKI PECFKKFAETA+KCV D G +
Sbjct  735  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIE  794

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGF--DVTCKDKKDPE-ASPGFDAS  531
            RPSMGDVLWNLEFALQLQESAEESGKG    +D++E    D  CK K + E     ++ +
Sbjct  795  RPSMGDVLWNLEFALQLQESAEESGKGICSEMDMDEIKYDDDNCKGKNNSEKGCDVYEGN  854

Query  532  MTDTQssgismsiggrsLASEDSDGLTP  615
            +TD++SSGI MSIGGRSLASEDSDGLTP
Sbjct  855  VTDSRSSGIDMSIGGRSLASEDSDGLTP  882



>ref|XP_009416326.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416327.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=882

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 174/207 (84%), Gaps = 9/207 (4%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  670  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  729

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HC KKGILDQI DPYLKGKIAP+C KKFAETA KCVADVGT+
Sbjct  730  ALNPTLPKEQVSLAEWAAHCQKKGILDQIIDPYLKGKIAPQCLKKFAETAEKCVADVGTE  789

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASM--  534
            RPSMGDVLWNLEFALQLQESAEESG    G  D  E   +    KK P+     D SM  
Sbjct  790  RPSMGDVLWNLEFALQLQESAEESGSISTGISD--EAATLMIFGKKVPD-----DPSMES  842

Query  535  TDTQssgismsiggrsLASEDSDGLTP  615
            + T ++  S+SIGGRS+ASEDSDGLTP
Sbjct  843  STTTTTTTSISIGGRSVASEDSDGLTP  869



>ref|XP_006403905.1| hypothetical protein EUTSA_v10010114mg [Eutrema salsugineum]
 gb|ESQ45358.1| hypothetical protein EUTSA_v10010114mg [Eutrema salsugineum]
Length=891

 Score =   297 bits (760),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 173/210 (82%), Gaps = 12/210 (6%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LCARP
Sbjct  676  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARP  735

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DPYLKGKI PECFKKFAETA+KCV D G +
Sbjct  736  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIE  795

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEE----GFDVTCKDK-KDPEASPGFD  525
            RPSMGDVLWNLEFALQLQESAEESGKG    +D++E    G D  CK K  D ++   ++
Sbjct  796  RPSMGDVLWNLEFALQLQESAEESGKGICSDMDMDEIKYDGGD--CKGKNNDDKSCDVYE  853

Query  526  ASMTDTQssgismsiggrsLASEDSDGLTP  615
             ++TD++      S   RS+ SEDSDGLTP
Sbjct  854  GNVTDSR-----SSGLDRSMVSEDSDGLTP  878



>gb|EMT27425.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=841

 Score =   295 bits (755),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 171/205 (83%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP++DHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  628  VSDFGLSKTGPSMDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  687

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KE+VSLAEWA HC KKGILDQI DPYLKGKI P+CFKKFAETA KCVAD G +
Sbjct  688  ALNPTLAKEEVSLAEWALHCQKKGILDQIVDPYLKGKIVPQCFKKFAETAEKCVADNGIE  747

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQ+QESAEESG  G  GI  EEG  +    KKDP   P  D+S T 
Sbjct  748  RPSMGDVLWNLEFALQMQESAEESGSFGC-GISDEEGTPLVMAGKKDPN-DPSIDSSTTT  805

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T     S+S+G +S+AS DSDGLTP
Sbjct  806  TT--TTSLSMGDQSVASIDSDGLTP  828



>ref|XP_002467915.1| hypothetical protein SORBIDRAFT_01g036260 [Sorghum bicolor]
 gb|EER94913.1| hypothetical protein SORBIDRAFT_01g036260 [Sorghum bicolor]
Length=895

 Score =   296 bits (757),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 170/205 (83%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP++DHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  683  VSDFGLSKTGPSMDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  742

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKE+VSLAEWA HC KKGILDQI DPYLKGKIAP+CFKKFAETA KCV+D G D
Sbjct  743  ALNPTLPKEEVSLAEWALHCQKKGILDQIVDPYLKGKIAPQCFKKFAETAEKCVSDQGID  802

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQ+QESAEESG  G G  D  EG  +    KKDP          + 
Sbjct  803  RPSMGDVLWNLEFALQMQESAEESGSLGCGMSD--EGTPLVMVGKKDPNDP---SIESST  857

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T ++  S+S+G +S+AS DSDGLTP
Sbjct  858  TTTTTTSISMGDQSVASMDSDGLTP  882



>gb|EMS54122.1| Receptor-like protein kinase FERONIA [Triticum urartu]
Length=871

 Score =   295 bits (754),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 171/205 (83%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP++DHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  658  VSDFGLSKTGPSMDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  717

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KE+VSLAEWA HC KKGILDQI DPYLKGKI P+CFKKFAETA KCVAD G +
Sbjct  718  ALNPTLAKEEVSLAEWALHCQKKGILDQIVDPYLKGKIVPQCFKKFAETAEKCVADNGIE  777

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQ+QESAEESG  G G  D EEG  +    KKDP   P  D+S T 
Sbjct  778  RPSMGDVLWNLEFALQMQESAEESGSFGCGMSD-EEGAPLVMAGKKDPN-DPSIDSSTTT  835

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T     S+S+G +S+AS DSDGLTP
Sbjct  836  TT--TTSLSMGDQSVASIDSDGLTP  858



>ref|XP_010921184.1| PREDICTED: receptor-like protein kinase FERONIA [Elaeis guineensis]
Length=895

 Score =   295 bits (755),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 173/205 (84%), Gaps = 3/205 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  681  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  740

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             LN TLPKEQVSLAEWA HC KKGILDQI DPYL+G+IAP+CFKKFAETA KCVAD G +
Sbjct  741  PLNSTLPKEQVSLAEWALHCQKKGILDQIIDPYLRGRIAPQCFKKFAETAEKCVADQGIE  800

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESG   + G   EEG  +    KKDP + P  ++S T 
Sbjct  801  RPSMGDVLWNLEFALQLQESAEESG-CLIDGATSEEGTPLMILRKKDPSSDPLVESSTTT  859

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T     SMSIGGRSLAS+D+DGLTP
Sbjct  860  TT--TTSMSIGGRSLASDDTDGLTP  882



>ref|XP_008660180.1| PREDICTED: receptor-like protein kinase FERONIA [Zea mays]
 gb|AFW88468.1| putative receptor-like protein kinase family protein [Zea mays]
Length=888

 Score =   294 bits (752),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 171/205 (83%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP++DHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  676  VSDFGLSKTGPSMDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  735

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKE+VSLAEWA HC KKG+LDQI DPYLKGKIAP+CFKKFAETA KCV+D   D
Sbjct  736  ALNPTLPKEEVSLAEWALHCQKKGVLDQIVDPYLKGKIAPQCFKKFAETAEKCVSDQSID  795

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQ+QESAEESG  G G  D  EG  +    KKDP   P  ++S T 
Sbjct  796  RPSMGDVLWNLEFALQMQESAEESGSLGCGMSD--EGTPLVMVGKKDPN-DPSIESSTTT  852

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T     S+S+G +S+AS DSDGLTP
Sbjct  853  TT--TTSLSMGDQSVASMDSDGLTP  875



>ref|XP_008810848.1| PREDICTED: receptor-like protein kinase FERONIA [Phoenix dactylifera]
Length=891

 Score =   294 bits (752),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 170/205 (83%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE+LCARP
Sbjct  678  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARP  737

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HC KKGILDQI DPYLKGKIAP CFKKFAETA KCVAD G +
Sbjct  738  ALNPTLPKEQVSLAEWALHCQKKGILDQIIDPYLKGKIAPPCFKKFAETAEKCVADQGIE  797

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQE AEESG   +GG   + G  +    KKD          ++ 
Sbjct  798  RPSMGDVLWNLEFALQLQEGAEESGS-LIGGAVSDGGTPLMMVGKKDSNEP---SVELST  853

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T ++  ++SIGGRSLASEDSDGLTP
Sbjct  854  TTTTTTTVSIGGRSLASEDSDGLTP  878



>ref|XP_009136619.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=896

 Score =   293 bits (750),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 178/208 (86%), Gaps = 3/208 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE LCARP
Sbjct  676  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARP  735

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DP+LKGKI PECFKKFAETA+KCV D G +
Sbjct  736  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIE  795

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGF--DVTCKDKKDPE-ASPGFDAS  531
            RPSMGDVLWNLEFALQLQESAEESGK     +D+ E    D  CK K + +  S  ++ +
Sbjct  796  RPSMGDVLWNLEFALQLQESAEESGKEICSEMDMGEIKYDDDNCKGKSNNDKGSDVYEGN  855

Query  532  MTDTQssgismsiggrsLASEDSDGLTP  615
            ++D++SSGI MSIGGRSL SEDSDGLTP
Sbjct  856  VSDSRSSGIDMSIGGRSLVSEDSDGLTP  883



>ref|XP_009148931.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=899

 Score =   293 bits (750),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 177/209 (85%), Gaps = 4/209 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP LDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE LCARP
Sbjct  678  VSDFGLSKTGPALDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARP  737

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI D +LKGKI PECFKKFAETA+KCV D G +
Sbjct  738  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDRHLKGKITPECFKKFAETAMKCVLDQGIE  797

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEE---GFDVTCKDKKDPE-ASPGFDA  528
            RPSMGDVLWNLEFALQLQESAEESGKG    +D++E     D  CK K + E     ++ 
Sbjct  798  RPSMGDVLWNLEFALQLQESAEESGKGICSEMDMDEIKYDDDDICKGKNNSEKGCDVYEG  857

Query  529  SMTDTQssgismsiggrsLASEDSDGLTP  615
            ++TD +SSGI MSIGGRSLASEDSDGLTP
Sbjct  858  NVTDLRSSGIDMSIGGRSLASEDSDGLTP  886



>tpg|DAA45217.1| TPA: putative receptor-like protein kinase family protein [Zea 
mays]
Length=886

 Score =   293 bits (749),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 167/205 (81%), Gaps = 6/205 (3%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP++DHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  675  VSDFGLSKTGPSMDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  734

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKE+VSLAEWA HC KKGILDQI DPYLKGKIAP+CFKKFAETA KCV+D G D
Sbjct  735  ALNPTLPKEEVSLAEWALHCQKKGILDQIVDPYLKGKIAPQCFKKFAETAEKCVSDQGID  794

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQ+QE AEESG  G G  D      V  KD  DP          + 
Sbjct  795  RPSMGDVLWNLEFALQMQEGAEESGSLGCGMSDEGAPLMVGKKDPNDPS------IESST  848

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T ++  S+S+G +S+AS DSDGLTP
Sbjct  849  TTTTTTSISMGDQSVASIDSDGLTP  873



>ref|XP_010938035.1| PREDICTED: receptor-like protein kinase FERONIA [Elaeis guineensis]
Length=891

 Score =   293 bits (749),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 170/205 (83%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  678  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  737

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HC KKGILDQI DPYL+G IAP+CFKKFAETA KCVAD G +
Sbjct  738  ALNPTLPKEQVSLAEWALHCQKKGILDQIIDPYLRGNIAPQCFKKFAETAEKCVADQGIE  797

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQE AEE+G   +GG   ++G  +    KKD           + 
Sbjct  798  RPSMGDVLWNLEFALQLQEGAEENGS-LIGGAMSDDGTSLMMVGKKDSNDQL---VESST  853

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T ++  ++SIGG+SLASEDSDGLTP
Sbjct  854  TTTTTTTVSIGGQSLASEDSDGLTP  878



>gb|EMT17007.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=890

 Score =   292 bits (748),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 170/205 (83%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP++DHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  678  VSDFGLSKTGPSMDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  737

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KE+VSLAEWA HC KKGILDQI DPYLKGKI P+CFKKFAETA KCVAD G +
Sbjct  738  ALNPTLAKEEVSLAEWALHCQKKGILDQIVDPYLKGKIVPQCFKKFAETAEKCVADNGIE  797

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQ+QESAEESG  G G  D  EG  +    KKDP   P  D+S T 
Sbjct  798  RPSMGDVLWNLEFALQMQESAEESGSIGCGMSD--EGTPLVMVGKKDPN-DPSIDSSTTT  854

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T     S+S+G +S+AS DSDGLTP
Sbjct  855  TT--TTSLSMGDQSVASIDSDGLTP  877



>ref|XP_004984479.1| PREDICTED: receptor-like protein kinase FERONIA-like [Setaria 
italica]
Length=884

 Score =   292 bits (747),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 169/205 (82%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP++DHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  672  VSDFGLSKTGPSMDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  731

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KE+VSLAEWA HC KKGILDQI DPYLKGKIAP+CFKKFAETA KCV+D G D
Sbjct  732  ALNPTLAKEEVSLAEWALHCQKKGILDQIVDPYLKGKIAPQCFKKFAETAEKCVSDQGID  791

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQ+QESAEESG  G G  D  EG  +    KKDP          + 
Sbjct  792  RPSMGDVLWNLEFALQMQESAEESGSLGCGMSD--EGTPLVMVGKKDPNDP---SIESST  846

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T ++  S+S+G +S+AS DSDGLTP
Sbjct  847  TTTTTTSISMGDQSVASMDSDGLTP  871



>ref|XP_009412649.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412650.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=889

 Score =   292 bits (747),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 170/208 (82%), Gaps = 12/208 (6%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLD+THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  678  VSDFGLSKTGPTLDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  737

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLAEWA HC KKG LDQI DPYLKGKIA +CFKKFAETA KCVAD GT+
Sbjct  738  ALNPSLPKEQVSLAEWAVHCQKKGTLDQIMDPYLKGKIAAQCFKKFAETAKKCVADAGTE  797

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKK---DPEASPGFDAS  531
            RPSMGDVLWNLEFALQLQESAEE+G  G  GI  E    V    KK   DP + P     
Sbjct  798  RPSMGDVLWNLEFALQLQESAEENGSLG-DGISEETASSVVMDGKKVADDPSSEP-----  851

Query  532  MTDTQssgismsiggrsLASEDSDGLTP  615
               + ++  ++SIGGRS+ SEDSDGLTP
Sbjct  852  ---STTTTTTISIGGRSVGSEDSDGLTP  876



>ref|XP_006646366.1| PREDICTED: receptor-like protein kinase FERONIA-like, partial 
[Oryza brachyantha]
Length=824

 Score =   290 bits (742),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 169/205 (82%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP++DHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  612  VSDFGLSKTGPSMDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  671

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KE+VSLAEWA HC KKGILDQI DP+LKGKIAP+CFKKFAETA KCV+D G D
Sbjct  672  ALNPTLAKEEVSLAEWALHCQKKGILDQIVDPHLKGKIAPQCFKKFAETAEKCVSDEGID  731

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQ+QESAEESG  G G  D  EG  +    KKDP          + 
Sbjct  732  RPSMGDVLWNLEFALQMQESAEESGSIGCGMSD--EGTPLVMTGKKDPNDP---SIESST  786

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T ++  S+S+G +S+AS DSDGLTP
Sbjct  787  TTTTTTSISMGDQSVASIDSDGLTP  811



>gb|EPS73118.1| hypothetical protein M569_01631 [Genlisea aurea]
Length=873

 Score =   291 bits (744),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 162/212 (76%), Gaps = 24/212 (11%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP+LDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LCARP
Sbjct  666  VSDFGLSKTGPSLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEVLCARP  725

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLAEW  HCHKKG LDQI DPYL GKIA ECFKK+ ETAVKC++DVG D
Sbjct  726  ALNPSLPKEQVSLAEWGVHCHKKGTLDQIIDPYLYGKIASECFKKYTETAVKCLSDVGMD  785

Query  361  RPSMGDVLWNLEFALQLQESAEESG---KGGLGGIDIE----EGFDVTCKDKKDPEASPG  519
            RP+MGDVLWNLEFAL LQESAEESG   KGG G ++      +GFD T  D K   +S G
Sbjct  786  RPAMGDVLWNLEFALNLQESAEESGMVPKGGGGDMESSSFKGKGFDGTATDSK--SSSSG  843

Query  520  FDASMTDTQssgismsiggrsLASEDSDGLTP  615
               S+                  SEDSDGLTP
Sbjct  844  MTMSIGGR---------------SEDSDGLTP  860



>gb|EMS63765.1| Receptor-like protein kinase FERONIA [Triticum urartu]
Length=819

 Score =   290 bits (741),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 169/205 (82%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP++DHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  607  VSDFGLSKTGPSMDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  666

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KE+VSLAEWA HC KKGILDQI DPYLKGKI P+CFKKFAETA KCVAD G +
Sbjct  667  ALNPTLAKEEVSLAEWALHCQKKGILDQIVDPYLKGKIVPQCFKKFAETAEKCVADNGIE  726

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQ+QESAEESG  G G  D  EG  +    KKD    P  D+S T 
Sbjct  727  RPSMGDVLWNLEFALQMQESAEESGSIGCGMSD--EGTPLVMVGKKDAN-DPSIDSSTTT  783

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T     S+S+G +S+AS DSDGLTP
Sbjct  784  TT--TTSLSMGDQSVASIDSDGLTP  806



>emb|CDY33271.1| BnaA01g19380D [Brassica napus]
Length=856

 Score =   290 bits (742),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 174/205 (85%), Gaps = 12/205 (6%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP LDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE LCARP
Sbjct  651  VSDFGLSKTGPALDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARP  710

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DP+LKGKI PECFKKFAETA+KCV D G +
Sbjct  711  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIE  770

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESGKG    +D++E      K   D       + ++TD
Sbjct  771  RPSMGDVLWNLEFALQLQESAEESGKGICSEMDMDE-----IKYDDD-------NWNVTD  818

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSGI MSIGGRSLASEDSDGLTP
Sbjct  819  SRSSGIDMSIGGRSLASEDSDGLTP  843



>emb|CDY29022.1| BnaC07g32280D [Brassica napus]
Length=803

 Score =   289 bits (740),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 164/205 (80%), Gaps = 21/205 (10%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE LCARP
Sbjct  607  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARP  666

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DP+LKGKI PECFKKFAET +KCV D G +
Sbjct  667  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPHLKGKITPECFKKFAETGMKCVLDQGIE  726

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESGKG    +D++E  D           S G D S+  
Sbjct  727  RPSMGDVLWNLEFALQLQESAEESGKGICSEMDMDEIND---------SRSSGIDMSI--  775

Query  541  TQssgismsiggrsLASEDSDGLTP  615
                      GGRSLASEDSDGLTP
Sbjct  776  ----------GGRSLASEDSDGLTP  790



>emb|CDY16299.1| BnaC01g23340D [Brassica napus]
Length=866

 Score =   290 bits (742),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 174/205 (85%), Gaps = 12/205 (6%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP LDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE LCARP
Sbjct  660  VSDFGLSKTGPALDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARP  719

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DP+LKGKI PECFKKFAETA+KCV D G +
Sbjct  720  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIE  779

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESGKG    +D++E      K   D       + ++TD
Sbjct  780  RPSMGDVLWNLEFALQLQESAEESGKGICSEMDMDE-----IKYDDD-------NWNVTD  827

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSGI MSIGGRSLASEDSDGLTP
Sbjct  828  SRSSGIDMSIGGRSLASEDSDGLTP  852



>emb|CDX90645.1| BnaA03g41360D [Brassica napus]
Length=814

 Score =   289 bits (739),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 162/205 (79%), Gaps = 21/205 (10%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE LCARP
Sbjct  618  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARP  677

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DPYLKGKI PECFKKFAETA+KCV D G +
Sbjct  678  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIE  737

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESGKG    +D+    D           S G D S+  
Sbjct  738  RPSMGDVLWNLEFALQLQESAEESGKGICSEMDMGNVSD---------SRSSGIDMSI--  786

Query  541  TQssgismsiggrsLASEDSDGLTP  615
                      GGRSL SEDSDGLTP
Sbjct  787  ----------GGRSLVSEDSDGLTP  801



>emb|CDX78012.1| BnaA09g32070D [Brassica napus]
Length=851

 Score =   289 bits (740),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 172/205 (84%), Gaps = 20/205 (10%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE LCARP
Sbjct  654  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARP  713

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DP+LKGKI PECFKKFAETA+KCV D G +
Sbjct  714  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIE  773

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESGK G+   D+ EG                   ++TD
Sbjct  774  RPSMGDVLWNLEFALQLQESAEESGK-GICSSDVYEG-------------------NVTD  813

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            ++SSGI MSIGGRSLAS+DSDGLTP
Sbjct  814  SRSSGIDMSIGGRSLASDDSDGLTP  838



>ref|XP_010252025.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=886

 Score =   290 bits (741),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 172/205 (84%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRR QLTEKSDVYSFGVVLFEILCARP
Sbjct  673  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRLQLTEKSDVYSFGVVLFEILCARP  732

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            AL+PTLPKEQVSLAEWA HC KKGIL++  DPYLKGKIAPECFKKFAE A KCV+D G+D
Sbjct  733  ALSPTLPKEQVSLAEWAVHCQKKGILEEFIDPYLKGKIAPECFKKFAEIAEKCVSDQGSD  792

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RP+MGDVLWNLEFALQLQESAE  G     GI   E   +T K KKD +A  GF+ S T+
Sbjct  793  RPAMGDVLWNLEFALQLQESAESGGFSSDMGI---EETPLTGKWKKDSDAFSGFE-STTE  848

Query  541  TQssgismsiggrsLASEDSDGLTP  615
             +SSG+SMS+G +SL SEDS GL P
Sbjct  849  CRSSGMSMSVGCQSLTSEDSGGLRP  873



>ref|XP_003557976.1| PREDICTED: receptor-like protein kinase FERONIA [Brachypodium 
distachyon]
Length=898

 Score =   289 bits (740),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 168/205 (82%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP++DHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  686  VSDFGLSKTGPSMDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  745

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KE+VSLAEWA HC KKGILDQI DPYLKGKI P+CFKKFAETA KCVAD G +
Sbjct  746  ALNPTLAKEEVSLAEWALHCQKKGILDQIVDPYLKGKIVPQCFKKFAETAEKCVADNGIE  805

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQ+QESAEESG  G G  D  EG  +    KKDP          + 
Sbjct  806  RPSMGDVLWNLEFALQMQESAEESGSIGCGMSD--EGTPLVMVGKKDPNDP---SIDSST  860

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T ++  S+S+G +S+AS DSDGLTP
Sbjct  861  TTTTTTSISMGDQSVASIDSDGLTP  885



>ref|NP_001044372.1| Os01g0769700 [Oryza sativa Japonica Group]
 dbj|BAB56062.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAD53342.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF06286.1| Os01g0769700 [Oryza sativa Japonica Group]
 gb|EEE55446.1| hypothetical protein OsJ_03602 [Oryza sativa Japonica Group]
Length=896

 Score =   288 bits (737),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 169/205 (82%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP++DHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  684  VSDFGLSKTGPSMDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  743

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KE+VSLAEWA HC KKGILDQI DP+LKGKIAP+CFKKFAETA KCV+D G D
Sbjct  744  ALNPTLAKEEVSLAEWALHCQKKGILDQIVDPHLKGKIAPQCFKKFAETAEKCVSDEGID  803

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQ+QESAE+SG  G G  D  EG  +    KKDP          + 
Sbjct  804  RPSMGDVLWNLEFALQMQESAEDSGSIGCGMSD--EGTPLVMPGKKDPNDP---SIESST  858

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T ++  S+S+G +S+AS DSDGLTP
Sbjct  859  TTTTTTSISMGDQSVASIDSDGLTP  883



>gb|EEC75192.1| hypothetical protein OsI_11431 [Oryza sativa Indica Group]
Length=893

 Score =   288 bits (737),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 169/205 (82%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPT+DHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE+LCARP
Sbjct  681  VSDFGLSKTGPTMDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARP  740

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KE+VSLAEWA HC KKGILDQI DP+LKGKIAP+CFKKFAETA KCV+D G D
Sbjct  741  ALNPTLAKEEVSLAEWALHCQKKGILDQIVDPHLKGKIAPQCFKKFAETAEKCVSDEGID  800

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQ+QESAE+SG  G G  D  EG  +    KKDP          + 
Sbjct  801  RPSMGDVLWNLEFALQMQESAEDSGSIGCGMSD--EGTPLVMPGKKDPNDP---SIESST  855

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T ++  S+S+G +S+AS DSDGLTP
Sbjct  856  TTTTTTSISMGEQSVASIDSDGLTP  880



>ref|XP_009391670.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   288 bits (737),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 169/205 (82%), Gaps = 6/205 (3%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPT+D+THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  676  VSDFGLSKTGPTVDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  735

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLAEWA HC +KG+LDQI DPYLKGKIAP+CFKKFAETA KCVAD+GT+
Sbjct  736  ALNPSLPKEQVSLAEWALHCQRKGMLDQIIDPYLKGKIAPQCFKKFAETAEKCVADIGTE  795

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESG    G  D      +  K+  DP          + 
Sbjct  796  RPSMGDVLWNLEFALQLQESAEESGSIVDGISDEAIPLVIRKKEANDPLIES------ST  849

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T ++  + SIGGRS+ SEDS+GLTP
Sbjct  850  TTTTTTTASIGGRSINSEDSEGLTP  874



>emb|CDX73714.1| BnaC08g22890D [Brassica napus]
Length=1176

 Score =   289 bits (739),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 168/206 (82%), Gaps = 14/206 (7%)
 Frame = +1

Query  1     VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
             VSDFGLSKTGP LDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE LCARP
Sbjct  971   VSDFGLSKTGPALDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEALCARP  1030

Query  181   ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ALNPTL KEQVSLAEWA +C+KKG+LDQI DP+LKGKI PECFKKFAETA+KCV D G +
Sbjct  1031  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPHLKGKITPECFKKFAETAMKCVLDQGIE  1090

Query  361   RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEE-GFDVTCKDKKDPEASPGFDASMT  537
             RPSMGDVLWNLEFALQLQESAEESGKG    +D++E  +D    +  D  +S G D S+ 
Sbjct  1091  RPSMGDVLWNLEFALQLQESAEESGKGICSEMDMDEIKYDDGNWNVTDSRSS-GIDMSI-  1148

Query  538   DTQssgismsiggrsLASEDSDGLTP  615
                        GGRSLAS+DSDGLTP
Sbjct  1149  -----------GGRSLASDDSDGLTP  1163



>ref|NP_001050022.1| Os03g0333200 [Oryza sativa Japonica Group]
 gb|ABF95782.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11936.1| Os03g0333200 [Oryza sativa Japonica Group]
 gb|EEE59005.1| hypothetical protein OsJ_10725 [Oryza sativa Japonica Group]
Length=893

 Score =   286 bits (731),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 168/205 (82%), Gaps = 5/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPT+DHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE+LCARP
Sbjct  681  VSDFGLSKTGPTMDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARP  740

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KE+VSLAEWA HC KKGILDQI DP+LKGKIAP+CFKKFAETA KCV+D G D
Sbjct  741  ALNPTLAKEEVSLAEWALHCQKKGILDQIVDPHLKGKIAPQCFKKFAETAEKCVSDQGID  800

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQ+QESAEESG  G G  D  +   +    KKDP          + 
Sbjct  801  RPSMGDVLWNLEFALQMQESAEESGSLGCGMSD--DSTPLVIVGKKDPNDP---SIESST  855

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T ++  S+S+G +S+AS DSDGLTP
Sbjct  856  TTTTTTSISMGEQSVASIDSDGLTP  880



>ref|XP_008813242.1| PREDICTED: receptor-like protein kinase FERONIA [Phoenix dactylifera]
Length=894

 Score =   285 bits (730),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 169/205 (82%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  681  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  740

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             LN  LPKEQVSLAEWA HC KKG LDQI DPYL+G+IA +CFKKFAETA KCV+D G +
Sbjct  741  PLNSALPKEQVSLAEWALHCQKKGFLDQIIDPYLRGRIASQCFKKFAETAEKCVSDKGME  800

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAEESG   + G   EEG  +    K DP + P  +++ T 
Sbjct  801  RPSMGDVLWNLEFALQLQESAEESGS-LMDGATSEEGTPLMIVRKNDP-SDPLVESTTTT  858

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T     +MS+GGRS+ASEDSDGLTP
Sbjct  859  TT--TTTMSMGGRSIASEDSDGLTP  881



>ref|XP_006842554.1| hypothetical protein AMTR_s00077p00138840 [Amborella trichopoda]
 gb|ERN04229.1| hypothetical protein AMTR_s00077p00138840 [Amborella trichopoda]
Length=899

 Score =   280 bits (716),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 166/205 (81%), Gaps = 6/205 (3%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP +D THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  688  VSDFGLSKTGPAVDRTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  747

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HC KKG+L+QI DPYL+GKIAPECFKKFAETA KCV D G D
Sbjct  748  ALNPTLPKEQVSLAEWALHCQKKGVLEQIMDPYLRGKIAPECFKKFAETAEKCVGDQGID  807

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RP+MGDVLWNLEFALQLQES+EE        I+ +E   +T K K   +    FD + T 
Sbjct  808  RPAMGDVLWNLEFALQLQESSEEDIVADTTQIENDEEAPLTMKGK---DGQGVFDDTTTT  864

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T      +S+GGRSLAS+DSDGLTP
Sbjct  865  TS---TGISMGGRSLASDDSDGLTP  886



>ref|XP_009414253.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414254.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   280 bits (715),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 147/170 (86%), Gaps = 4/170 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPT+D+THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  676  VSDFGLSKTGPTVDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  735

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLAEWA HC KKGILDQ+ DP+L GKIAP+CFKKFAETA KCVAD G +
Sbjct  736  ALNPTLPKEQVSLAEWALHCQKKGILDQLVDPFLTGKIAPQCFKKFAETAEKCVADFGIE  795

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGI--DIEEGFDVTCKDKKDP  504
            RPSMGDVLW+LEFALQLQESAEESG   + GI  D      V  KD  DP
Sbjct  796  RPSMGDVLWSLEFALQLQESAEESGS--IIGISDDTTPFVLVGSKDPSDP  843



>ref|XP_006844774.1| hypothetical protein AMTR_s00016p00259140 [Amborella trichopoda]
 gb|ERN06449.1| hypothetical protein AMTR_s00016p00259140 [Amborella trichopoda]
Length=856

 Score =   263 bits (672),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP LDHTHVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE+LCARP
Sbjct  659  VSDFGLSKTGPGLDHTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARP  718

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HC KKG+L+ + DP+LKGKI PEC KKF+ETA KC++D G D
Sbjct  719  ALNPSLPKEQVSLADWALHCQKKGVLEDLIDPFLKGKINPECLKKFSETAEKCLSDSGVD  778

Query  361  RPSMGDVLWNLEFALQLQESAEE  429
            RP+MGDVLWNLEFALQLQE +EE
Sbjct  779  RPAMGDVLWNLEFALQLQEGSEE  801



>ref|XP_002447169.1| hypothetical protein SORBIDRAFT_06g029710 [Sorghum bicolor]
 gb|EES11497.1| hypothetical protein SORBIDRAFT_06g029710 [Sorghum bicolor]
Length=877

 Score =   262 bits (669),  Expect = 4e-78, Method: Composition-based stats.
 Identities = 137/205 (67%), Positives = 151/205 (74%), Gaps = 8/205 (4%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKT P +D+THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  668  VSDFGLSKTSPNVDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  727

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            AL+P+LPKEQVSLA+WA H  KKGIL QI DPYL+GKI+P+CF KFAETA KCVAD   D
Sbjct  728  ALSPSLPKEQVSLADWALHSQKKGILGQIIDPYLQGKISPQCFMKFAETAEKCVADHSID  787

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSM DVLWNLEFALQLQESAE+S     G         +      +P        S + 
Sbjct  788  RPSMADVLWNLEFALQLQESAEDSSSVTDGTSSNTSPLTILRLHSDEPTTDTTTTTSTSM  847

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            +          GRSLAS DSDGLTP
Sbjct  848  SM--------TGRSLASVDSDGLTP  864



>ref|XP_004962463.1| PREDICTED: receptor-like protein kinase FERONIA-like [Setaria 
italica]
Length=873

 Score =   261 bits (668),  Expect = 5e-78, Method: Composition-based stats.
 Identities = 121/144 (84%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP +D+THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  664  VSDFGLSKTGPNVDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  723

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            AL+P+LPKEQVSLA+WA HC KKGIL QI DPYL+GKI+ +CF KFAETA KCVAD   D
Sbjct  724  ALSPSLPKEQVSLADWALHCQKKGILGQIIDPYLQGKISLQCFMKFAETAEKCVADHSID  783

Query  361  RPSMGDVLWNLEFALQLQESAEES  432
            RPSM DVLWNLEFALQLQESAE++
Sbjct  784  RPSMADVLWNLEFALQLQESAEDN  807



>ref|XP_003568697.1| PREDICTED: receptor-like protein kinase FERONIA [Brachypodium 
distachyon]
Length=878

 Score =   261 bits (666),  Expect = 9e-78, Method: Composition-based stats.
 Identities = 121/156 (78%), Positives = 136/156 (87%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP +D+THVSTVVKGSFGYLDPEYFRRQQL+EKSDVYSFGVVLFE+LCARP
Sbjct  666  VSDFGLSKTGPNVDNTHVSTVVKGSFGYLDPEYFRRQQLSEKSDVYSFGVVLFEVLCARP  725

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            AL+P+LPKEQV+LA+WA HC KKGIL QI DP L+GKI+P+CF KFAETA KCVAD   D
Sbjct  726  ALSPSLPKEQVNLADWALHCQKKGILGQIIDPLLQGKISPQCFVKFAETAEKCVADHSID  785

Query  361  RPSMGDVLWNLEFALQLQESAEESGK--GGLGGIDI  462
            RPSM DVLWNLEF LQLQESAE++    GG+   D+
Sbjct  786  RPSMSDVLWNLEFVLQLQESAEDNSSLTGGMSSSDV  821



>ref|XP_010553161.1| PREDICTED: receptor-like protein kinase FERONIA [Tarenaya hassleriana]
Length=852

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 133/152 (88%), Gaps = 4/152 (3%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP LD THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYS+GVVLFE+LCARP
Sbjct  675  VSDFGLSKTGPALDDTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSYGVVLFEVLCARP  734

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             LNPTLPKEQVSLAEWA  C KKG L++I DPYLKGKIAPECF K+AETA+KCVAD G +
Sbjct  735  PLNPTLPKEQVSLAEWAARCFKKGELEEIIDPYLKGKIAPECFNKYAETAIKCVADQGIE  794

Query  361  RPSMGDVLWNLEFALQLQE----SAEESGKGG  444
            RP MGDVLWNLEFALQLQE    SA +S  GG
Sbjct  795  RPPMGDVLWNLEFALQLQENTTDSAMDSSVGG  826



>gb|EEE63237.1| hypothetical protein OsJ_18047 [Oryza sativa Japonica Group]
Length=859

 Score =   256 bits (654),  Expect = 4e-76, Method: Composition-based stats.
 Identities = 119/144 (83%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSK GP +D+THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCAR 
Sbjct  648  VSDFGLSKAGPNVDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARN  707

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            AL+P+LPKEQVSLA+WA  C KKG+L +I DP LKGKIAP+CF KFAETA KCVAD   D
Sbjct  708  ALSPSLPKEQVSLADWALRCQKKGVLGEIIDPLLKGKIAPQCFLKFAETAEKCVADRSVD  767

Query  361  RPSMGDVLWNLEFALQLQESAEES  432
            RPSMGDVLWNLEFALQLQES E+S
Sbjct  768  RPSMGDVLWNLEFALQLQESTEDS  791



>gb|EAY97521.1| hypothetical protein OsI_19449 [Oryza sativa Indica Group]
Length=859

 Score =   255 bits (652),  Expect = 7e-76, Method: Composition-based stats.
 Identities = 119/144 (83%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSK GP +D+THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCAR 
Sbjct  648  VSDFGLSKAGPNVDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARN  707

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            AL+P+LPKEQVSLA+WA  C KKG+L +I DP LKGKIAP+CF KFAETA KCVAD   D
Sbjct  708  ALSPSLPKEQVSLADWALRCQKKGVLGEIIDPLLKGKIAPQCFLKFAETAEKCVADRSVD  767

Query  361  RPSMGDVLWNLEFALQLQESAEES  432
            RPSMGDVLWNLEFALQLQES E+S
Sbjct  768  RPSMGDVLWNLEFALQLQESTEDS  791



>gb|EMT16871.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=883

 Score =   256 bits (653),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 158/205 (77%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP +D THVSTVVKGSFGYLDPEYFRRQQL+EKSDVYSFGVVLFE+LCARP
Sbjct  670  VSDFGLSKTGPNMDATHVSTVVKGSFGYLDPEYFRRQQLSEKSDVYSFGVVLFEVLCARP  729

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            AL+PTLPKEQ+SLA+WA  C K+G+L Q+ DP L+GKIAP+CF KF +TA KCVAD   D
Sbjct  730  ALSPTLPKEQISLADWALRCQKQGVLGQVIDPVLQGKIAPQCFLKFTDTAEKCVADRSVD  789

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQES E++G    G +       +     +  E  P  DAS T 
Sbjct  790  RPSMGDVLWNLEFALQLQESEEDTGSLTEGTLSSSGASPLVMTRLQSDE--PSTDASTTT  847

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T     +MS+ GRS+AS DSDGLTP
Sbjct  848  TS--TTTMSMTGRSIASMDSDGLTP  870



>ref|XP_006654257.1| PREDICTED: receptor-like protein kinase FERONIA-like [Oryza brachyantha]
Length=889

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 157/205 (77%), Gaps = 1/205 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSK GP +D+THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LCAR 
Sbjct  673  VSDFGLSKAGPNVDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEVLCART  732

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            AL+P+LP+EQVSLA+WA HC +KG+L  I DP L+GKIAP+CF KFAETA KCV D   D
Sbjct  733  ALSPSLPREQVSLADWALHCQRKGVLGDIVDPLLRGKIAPQCFMKFAETAEKCVVDRSAD  792

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQESAE+SG G   G        V  +   D  ++     + T 
Sbjct  793  RPSMGDVLWNLEFALQLQESAEDSG-GLTEGTSASTSPLVVTRLHSDEPSTDATTTTTTT  851

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T ++  ++SI  RS+AS +SDGLTP
Sbjct  852  TTNTASTVSIADRSIASVESDGLTP  876



>ref|XP_002271113.1| PREDICTED: receptor-like protein kinase ANXUR1 [Vitis vinifera]
Length=857

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  658  VSDFGLSKTGPDINQNHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  717

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HC KKGIL+ I DP+LKG I PEC KKFA+TA KC++D G D
Sbjct  718  ALNPSLPKEQVSLADWALHCQKKGILEDIIDPHLKGTINPECLKKFADTAEKCLSDHGLD  777

Query  361  RPSMGDVLWNLEFALQLQES  420
            RPSMGD+LWNLEFALQLQE+
Sbjct  778  RPSMGDILWNLEFALQLQEN  797



>ref|XP_010914574.1| PREDICTED: receptor-like protein kinase ANXUR2 [Elaeis guineensis]
Length=865

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 152/207 (73%), Gaps = 23/207 (11%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++ THVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE+LCARP
Sbjct  665  VSDFGLSKTGPMMNQTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARP  724

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LP++QVSLA+WA HC KKG L+ I DP LKGKI PEC KKFA+TA KC++D G D
Sbjct  725  ALNPSLPRDQVSLADWALHCKKKGFLEDIIDPVLKGKIDPECLKKFADTAEKCLSDQGVD  784

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCK---DKKDPEASPGFDAS  531
            RP+MGDVLWNLEFALQLQE  EE GK    GI ++    VT     D ++P  S G  + 
Sbjct  785  RPTMGDVLWNLEFALQLQEHNEE-GKPMSTGIVVDSN-SVTSGGSFDGRNPNESIGGRSG  842

Query  532  MTDTQssgismsiggrsLASEDSDGLT  612
                              AS+DSDGLT
Sbjct  843  ------------------ASDDSDGLT  851



>ref|XP_009388382.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
ANXUR2 [Musa acuminata subsp. malaccensis]
Length=402

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPT++ THVST+VKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE+LCAR 
Sbjct  208  VSDFGLSKTGPTMNQTHVSTMVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARA  267

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            AL+P LPKEQVSLA+WA HC KKG+L  I DP+L+GK +PEC KK AETA KC+ D G D
Sbjct  268  ALSPNLPKEQVSLADWALHCXKKGVLADIIDPHLEGKSSPECLKKSAETAEKCLLDHGVD  327

Query  361  RPSMGDVLWNLEFALQLQESAEESGK  438
            RPSMGDVLWNLEFALQLQ++  ESGK
Sbjct  328  RPSMGDVLWNLEFALQLQDNF-ESGK  352



>ref|XP_008668826.1| PREDICTED: receptor-like protein kinase FERONIA [Zea mays]
 tpg|DAA35839.1| TPA: putative receptor-like protein kinase family protein [Zea 
mays]
Length=897

 Score =   254 bits (648),  Expect = 4e-75, Method: Composition-based stats.
 Identities = 117/146 (80%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPT-LDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSKTGP  +D+THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LCAR
Sbjct  675  VSDFGLSKTGPNNVDNTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEVLCAR  734

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            PAL+P+LPKEQVSLA+WA HC +KG+L QI DP+L+G+++P+CF KFAETA KCVAD   
Sbjct  735  PALSPSLPKEQVSLADWALHCQRKGVLGQIIDPHLQGQVSPQCFLKFAETAEKCVADRSV  794

Query  358  DRPSMGDVLWNLEFALQLQESAEESG  435
            DRPSM DVLWNLEFALQLQ SAE+SG
Sbjct  795  DRPSMADVLWNLEFALQLQGSAEDSG  820



>ref|XP_009385155.1| PREDICTED: receptor-like protein kinase ANXUR2 [Musa acuminata 
subsp. malaccensis]
Length=852

 Score =   253 bits (646),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 128/146 (88%), Gaps = 1/146 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++ THVST+VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  665  VSDFGLSKTGPMVNQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  724

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQVSLA+WA HC KK +L  I DP L+GKI PEC KKFAETA KC+ D G D
Sbjct  725  ALNPNLPREQVSLADWALHCQKKAVLADIVDPLLEGKIGPECLKKFAETAEKCLLDHGVD  784

Query  361  RPSMGDVLWNLEFALQLQESAEESGK  438
            RPSMGDVLWNLEFALQLQES  ESGK
Sbjct  785  RPSMGDVLWNLEFALQLQESF-ESGK  809



>ref|XP_006424004.1| hypothetical protein CICLE_v10029897mg [Citrus clementina]
 gb|ESR37244.1| hypothetical protein CICLE_v10029897mg [Citrus clementina]
Length=869

 Score =   253 bits (645),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP +++ HVSTVVKGSFGYLDPEYF+RQQLTEKSD+YSFGVVLFE+LCARP
Sbjct  678  VSDFGLSKTGPNMENGHVSTVVKGSFGYLDPEYFKRQQLTEKSDIYSFGVVLFEVLCARP  737

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HC +KGILD I DP LK KI+PEC KKFA+TA KC+AD G D
Sbjct  738  ALNPSLPKEQVSLADWALHCKRKGILDDIIDPLLKDKISPECLKKFADTAEKCLADSGID  797

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLG  450
            RPSMGDVLWNLEF LQL ES E S     G
Sbjct  798  RPSMGDVLWNLEFVLQLVESTEASSNRSRG  827



>ref|NP_001159308.1| uncharacterized protein LOC100304400 [Zea mays]
 gb|ACN25746.1| unknown [Zea mays]
Length=357

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 129/147 (88%), Gaps = 1/147 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPT-LDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSKTGPT ++ THVST+VKGSFGYLDPEYFRRQQLTEKSDVYS+GVVLFE+LCAR
Sbjct  157  VSDFGLSKTGPTAMNQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSYGVVLFEVLCAR  216

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            PALNP+LP+EQVSLA+ A  C +KG L+ I DP LKGKIAP+C KK+AETA KC+ D G 
Sbjct  217  PALNPSLPREQVSLADHALSCQRKGTLEDIIDPVLKGKIAPDCLKKYAETAEKCLCDHGV  276

Query  358  DRPSMGDVLWNLEFALQLQESAEESGK  438
            DRPSMGDVLWNLEFALQ+Q++ E  GK
Sbjct  277  DRPSMGDVLWNLEFALQMQDTFENGGK  303



>ref|XP_002311383.2| hypothetical protein POPTR_0008s10500g [Populus trichocarpa]
 gb|EEE88750.2| hypothetical protein POPTR_0008s10500g [Populus trichocarpa]
Length=854

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP L+ THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  665  VSDFGLSKTGPNLNQTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  724

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HC KKG L  I DPY+KG I PEC+ KFAETA KC+AD G +
Sbjct  725  ALNPSLPKEQVSLADWALHCQKKGTLWDIVDPYIKGDINPECYNKFAETAEKCLADHGYN  784

Query  361  RPSMGDVLWNLEFALQLQESAEESG  435
            RPSMGDVLWNLE++LQLQ++   SG
Sbjct  785  RPSMGDVLWNLEYSLQLQDNPAGSG  809



>dbj|BAJ93584.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=885

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 157/205 (77%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP +D THVSTVVKGSFGYLDPEYFRRQQL+EKSDVYSFGVVLFE+LCARP
Sbjct  672  VSDFGLSKTGPNMDATHVSTVVKGSFGYLDPEYFRRQQLSEKSDVYSFGVVLFEVLCARP  731

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            AL+P+LPKEQ+SLA+WA  C K+G+L QI DP L+G+IAP+CF KF ETA KCVAD   D
Sbjct  732  ALSPSLPKEQISLADWALRCQKQGVLGQIIDPMLQGRIAPQCFVKFTETAEKCVADRSVD  791

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFDASMTD  540
            RPSMGDVLWNLEFALQLQES E++     G +       +     +  E  P  DAS T 
Sbjct  792  RPSMGDVLWNLEFALQLQESDEDTSSLTDGMLSSSGASPLVMTRLQSDE--PSTDASTTT  849

Query  541  TQssgismsiggrsLASEDSDGLTP  615
            T     +MS+ GRS+AS DSDGLTP
Sbjct  850  TS--TTTMSMTGRSIASVDSDGLTP  872



>gb|KDO54400.1| hypothetical protein CISIN_1g039107mg, partial [Citrus sinensis]
Length=817

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP +++ HVSTVVKGSFGYLDPEYF+RQQLTEKSD+YSFGVVLFE+LCARP
Sbjct  626  VSDFGLSKTGPNMENGHVSTVVKGSFGYLDPEYFKRQQLTEKSDIYSFGVVLFEVLCARP  685

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HC +KGILD I DP LK KI+PEC KKFA+TA KC++D G D
Sbjct  686  ALNPSLPKEQVSLADWALHCKRKGILDDIIDPLLKDKISPECLKKFADTAEKCLSDSGID  745

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLG  450
            RPSMGDVLWNLEF LQL ES E S     G
Sbjct  746  RPSMGDVLWNLEFVLQLVESTEASSNRSRG  775



>ref|XP_006487877.1| PREDICTED: receptor-like protein kinase ANXUR2-like [Citrus sinensis]
Length=868

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP +++ HVSTVVKGSFGYLDPEYF+RQQLTEKSD+YSFGVVLFE+LCARP
Sbjct  677  VSDFGLSKTGPNMENGHVSTVVKGSFGYLDPEYFKRQQLTEKSDIYSFGVVLFEVLCARP  736

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HC +KGILD I DP LK KI+PEC KKFA+TA KC++D G D
Sbjct  737  ALNPSLPKEQVSLADWALHCKRKGILDDIIDPLLKDKISPECLKKFADTAEKCLSDSGID  796

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLG  450
            RPSMGDVLWNLEF LQL ES E S     G
Sbjct  797  RPSMGDVLWNLEFVLQLVESTEASSNRSRG  826



>ref|XP_011019995.1| PREDICTED: receptor-like protein kinase ANXUR1 [Populus euphratica]
Length=855

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP L+ THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  666  VSDFGLSKTGPNLNQTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  725

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HC KKG L  I DPY+KG I PEC+ KFAETA KC+AD G +
Sbjct  726  ALNPSLPKEQVSLADWALHCQKKGTLWDIVDPYIKGDINPECYNKFAETAEKCLADHGYN  785

Query  361  RPSMGDVLWNLEFALQLQESAEESG  435
            RPSMGDVLWNLE++LQLQ++   +G
Sbjct  786  RPSMGDVLWNLEYSLQLQDNPAGAG  810



>gb|KJB80895.1| hypothetical protein B456_013G120400 [Gossypium raimondii]
Length=851

 Score =   251 bits (641),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LCARP
Sbjct  656  VSDFGLSKTGPDMNQGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARP  715

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA  CHKKG LD I DP+LK KI PEC KKFA TAVKC++D G D
Sbjct  716  ALNPSLPKEQVSLADWALSCHKKGTLDDIIDPHLKDKIDPECLKKFAGTAVKCLSDQGID  775

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RP MGDVLWNLEFALQLQE+A
Sbjct  776  RPHMGDVLWNLEFALQLQETA  796



>ref|XP_007030540.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY11042.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
Length=858

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LCARP
Sbjct  654  VSDFGLSKTGPDMNQGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARP  713

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HC KKG+L+ I DP+LKGKI PEC KKFA+TA KC++D G +
Sbjct  714  ALNPSLPKEQVSLADWALHCQKKGVLEDIIDPHLKGKIDPECLKKFADTAEKCLSDHGLE  773

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RP MGDVLWNLEFALQLQE+A+
Sbjct  774  RPHMGDVLWNLEFALQLQETAD  795



>ref|XP_008809255.1| PREDICTED: receptor-like protein kinase ANXUR1 [Phoenix dactylifera]
Length=865

 Score =   251 bits (640),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 132/163 (81%), Gaps = 7/163 (4%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPT+  THVSTVVKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE+LCARP
Sbjct  665  VSDFGLSKTGPTMSQTHVSTVVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARP  724

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LP+EQVSLA+WA HC KKG L+ I DP L+GKI PEC KKFA+TA KC++D G D
Sbjct  725  ALNPSLPREQVSLADWALHCKKKGFLEDIIDPVLEGKIDPECLKKFADTAEKCLSDQGVD  784

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVTCK  489
            RP+MGDVLWNLEFALQLQE  E       GG  +  G    C 
Sbjct  785  RPTMGDVLWNLEFALQLQEHYE-------GGKPMPTGIGADCN  820



>ref|XP_010242732.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nelumbo nucifera]
Length=858

 Score =   250 bits (639),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 127/142 (89%), Gaps = 2/142 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDH--THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCA  174
            VSDFGLSKTGP L+H  +HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCA
Sbjct  660  VSDFGLSKTGPNLNHNQSHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCA  719

Query  175  RPALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVG  354
            RPALNP+LPKEQVSLA+WA HC  +G L+ I DP LKGKI PEC KKFAETA KC++D G
Sbjct  720  RPALNPSLPKEQVSLADWALHCQARGTLEDIIDPELKGKITPECLKKFAETAEKCLSDHG  779

Query  355  TDRPSMGDVLWNLEFALQLQES  420
             DRPSMGDVLWNLEFALQLQE+
Sbjct  780  VDRPSMGDVLWNLEFALQLQEN  801



>ref|XP_002272797.2| PREDICTED: receptor-like protein kinase ANXUR1 [Vitis vinifera]
 emb|CBI22880.3| unnamed protein product [Vitis vinifera]
Length=857

 Score =   250 bits (639),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP L+ THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LCARP
Sbjct  665  VSDFGLSKTGPELNQTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARP  724

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA  C KKGIL++I DP+LKG I PEC  KFAETA KC++D G +
Sbjct  725  ALNPSLPKEQVSLADWALQCQKKGILEEIIDPHLKGNITPECLMKFAETAEKCLSDHGLE  784

Query  361  RPSMGDVLWNLEFALQLQE  417
            RPSMGDVLWNLEFALQLQE
Sbjct  785  RPSMGDVLWNLEFALQLQE  803



>ref|XP_010258502.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nelumbo nucifera]
Length=855

 Score =   250 bits (638),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 129/141 (91%), Gaps = 1/141 (1%)
 Frame = +1

Query  1    VSDFGLSKTGP-TLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSKTGP  ++ +HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCAR
Sbjct  662  VSDFGLSKTGPDMMNQSHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCAR  721

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            PALNP+LPKEQVSLA+WA HC KKG+L+ I DP+LKGKI PECFKKFAETA KC++D G 
Sbjct  722  PALNPSLPKEQVSLADWALHCQKKGVLEDIVDPHLKGKITPECFKKFAETAEKCLSDHGL  781

Query  358  DRPSMGDVLWNLEFALQLQES  420
            DRPSMGDVLWNLE+ LQ+QE+
Sbjct  782  DRPSMGDVLWNLEYCLQVQEN  802



>ref|XP_010494105.1| PREDICTED: receptor-like protein kinase ANXUR2 [Camelina sativa]
 ref|XP_010494106.1| PREDICTED: receptor-like protein kinase ANXUR2 [Camelina sativa]
Length=859

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 138/173 (80%), Gaps = 17/173 (10%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  662  VSDFGLSKTGPNMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  721

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSL +WA +C +KG L+ I DP LKGKI PEC KKFA+TA KC++D G D
Sbjct  722  ALNPSLPKEQVSLGDWAMNCKRKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLD  781

Query  361  RPSMGDVLWNLEFALQLQESA--------------EESGKGGLG---GIDIEE  468
            RP+MGDVLWNLEFALQLQE+A              E+ G+GG G    IDIEE
Sbjct  782  RPTMGDVLWNLEFALQLQETADGPRHRTPSHGGGSEDLGRGGGGVAVNIDIEE  834



>emb|CDP17056.1| unnamed protein product [Coffea canephora]
Length=881

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LCARP
Sbjct  673  VSDFGLSKTGPNMNQGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARP  732

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HCH+KG L+ I DP +KG+I+ EC KKFAETA KC+AD G D
Sbjct  733  ALNPSLPKEQVSLADWAMHCHRKGALEDIVDPQIKGEISAECLKKFAETAGKCLADHGVD  792

Query  361  RPSMGDVLWNLEFALQLQES  420
            RPSMGDVLWNLE+ALQLQE+
Sbjct  793  RPSMGDVLWNLEYALQLQEN  812



>ref|XP_010921463.1| PREDICTED: receptor-like protein kinase ANXUR2 [Elaeis guineensis]
Length=870

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++ THVST+VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  671  VSDFGLSKTGPMMNQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  730

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLP+EQVSLA+WA +C ++G L  I DP +KGKI PEC KKFAETA KC++D G D
Sbjct  731  ALNPTLPREQVSLADWALNCQRRGALGDIIDPNVKGKIGPECLKKFAETAEKCLSDQGVD  790

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RP MGDVLWNLEFALQLQE+ E
Sbjct  791  RPYMGDVLWNLEFALQLQENFE  812



>ref|XP_006382811.1| serine-threonine kinase family protein [Populus trichocarpa]
 gb|ERP60608.1| serine-threonine kinase family protein [Populus trichocarpa]
Length=870

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP +D  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LC RP
Sbjct  671  VSDFGLSKTGPDMDKGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCGRP  730

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HC KKGI++ I DP++KGKI PEC KKFAETA KC+A+ G +
Sbjct  731  ALNPSLPKEQVSLADWALHCQKKGIIEDIIDPHIKGKITPECLKKFAETADKCLAESGPE  790

Query  361  RPSMGDVLWNLEFALQLQESAEESG  435
            RP+MGDVLWNLEFALQLQ++ E S 
Sbjct  791  RPNMGDVLWNLEFALQLQDNPEGSN  815



>emb|CDX86206.1| BnaA06g29230D [Brassica napus]
Length=859

 Score =   248 bits (633),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  662  VSDFGLSKTGPNMNQGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  721

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSL +WA +C KKG L+ I DP LKGKI PEC KKFA+TA KC++D G D
Sbjct  722  ALNPSLPKEQVSLGDWATNCKKKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLD  781

Query  361  RPSMGDVLWNLEFALQLQESAEES  432
            RP+MGDVLWNLEFALQLQE+A+ S
Sbjct  782  RPTMGDVLWNLEFALQLQETADGS  805



>gb|KCW61585.1| hypothetical protein EUGRSUZ_H04319 [Eucalyptus grandis]
Length=794

 Score =   247 bits (630),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP +D  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  599  VSDFGLSKTGPNMDKGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  658

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA +C ++GIL++I D  LKGKI PEC KKFAETA KC+ + G +
Sbjct  659  ALNPSLPKEQVSLADWALNCQRRGILEEILDAQLKGKINPECLKKFAETAEKCLCEHGLE  718

Query  361  RPSMGDVLWNLEFALQLQESAEES  432
            RP+MGDVLWNLEFALQLQE+A+ S
Sbjct  719  RPTMGDVLWNLEFALQLQENADGS  742



>ref|XP_009151260.1| PREDICTED: receptor-like protein kinase ANXUR2 [Brassica rapa]
 ref|XP_009151261.1| PREDICTED: receptor-like protein kinase ANXUR2 [Brassica rapa]
Length=859

 Score =   248 bits (633),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  662  VSDFGLSKTGPNMNQGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  721

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSL +WA +C KKG L+ I DP LKGKI PEC KKFA+TA KC++D G D
Sbjct  722  ALNPSLPKEQVSLGDWATNCKKKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLD  781

Query  361  RPSMGDVLWNLEFALQLQESAEES  432
            RP+MGDVLWNLEFALQLQE+A+ S
Sbjct  782  RPTMGDVLWNLEFALQLQETADGS  805



>ref|XP_011032387.1| PREDICTED: receptor-like protein kinase ANXUR1 [Populus euphratica]
Length=870

 Score =   248 bits (633),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP +D  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LC RP
Sbjct  671  VSDFGLSKTGPDMDKGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCGRP  730

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HC KKGI++ I DP++KGKI PEC KKFAETA KC+A+ G +
Sbjct  731  ALNPSLPKEQVSLADWALHCQKKGIIEDIIDPHIKGKITPECLKKFAETADKCLAESGPE  790

Query  361  RPSMGDVLWNLEFALQLQESAEESG  435
            RP+MGDVLWNLEF+LQLQ++ E S 
Sbjct  791  RPNMGDVLWNLEFSLQLQDNPEGSN  815



>ref|XP_006395027.1| hypothetical protein EUTSA_v10003639mg [Eutrema salsugineum]
 gb|ESQ32313.1| hypothetical protein EUTSA_v10003639mg [Eutrema salsugineum]
Length=858

 Score =   248 bits (632),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  662  VSDFGLSKTGPNMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  721

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSL +WA +C +KG L++I DP LKGKI PEC KKFA+TA KC++D G D
Sbjct  722  ALNPSLPKEQVSLGDWAMNCKRKGTLEEIVDPNLKGKINPECLKKFADTAEKCLSDSGLD  781

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RP+MGDVLWNLEFALQLQE+A+
Sbjct  782  RPTMGDVLWNLEFALQLQETAD  803



>ref|XP_002531275.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF31088.1| ATP binding protein, putative [Ricinus communis]
Length=842

 Score =   248 bits (632),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP +++  V TVVKGSFGYLDPEYF+RQQLTEKSDVYSFGVVLFE+LC RP
Sbjct  665  VSDFGLSKTGPNMENGQVITVVKGSFGYLDPEYFKRQQLTEKSDVYSFGVVLFEVLCGRP  724

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HC KKGIL+ I DP +KGKI PEC KKFA+TA KC+++ G +
Sbjct  725  ALNPSLPKEQVSLADWALHCQKKGILEDIIDPLIKGKIKPECLKKFADTAEKCLSEAGIE  784

Query  361  RPSMGDVLWNLEFALQLQESAEESG  435
            RPSMGDVLWNLEFALQLQ+S++ SG
Sbjct  785  RPSMGDVLWNLEFALQLQQSSDSSG  809



>ref|XP_006355833.1| PREDICTED: receptor-like protein kinase ANXUR1-like [Solanum 
tuberosum]
Length=826

 Score =   247 bits (631),  Expect = 6e-73, Method: Composition-based stats.
 Identities = 112/142 (79%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYS+GVVLFE+LCARP
Sbjct  625  VSDFGLSKTGPNMNQGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSYGVVLFEVLCARP  684

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALN  LPKEQVSLA+WA  C +KG L+ I DP+LKGKI PEC KKFAETA KC+AD G +
Sbjct  685  ALNSNLPKEQVSLADWALACQRKGNLEDIIDPHLKGKINPECLKKFAETAEKCLADNGIN  744

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RPSMGDVLWNLE+ALQLQE+ +
Sbjct  745  RPSMGDVLWNLEYALQLQENPD  766



>ref|XP_010025009.1| PREDICTED: receptor-like protein kinase ANXUR1 [Eucalyptus grandis]
Length=860

 Score =   247 bits (631),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP +D  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  665  VSDFGLSKTGPNMDKGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  724

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA +C ++GIL++I D  LKGKI PEC KKFAETA KC+ + G +
Sbjct  725  ALNPSLPKEQVSLADWALNCQRRGILEEILDAQLKGKINPECLKKFAETAEKCLCEHGLE  784

Query  361  RPSMGDVLWNLEFALQLQESAEES  432
            RP+MGDVLWNLEFALQLQE+A+ S
Sbjct  785  RPTMGDVLWNLEFALQLQENADGS  808



>dbj|BAF01824.1| receptor protein kinase like protein [Arabidopsis thaliana]
Length=182

 Score =   230 bits (587),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 146/170 (86%), Gaps = 3/170 (2%)
 Frame = +1

Query  112  QLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGK  291
            QLTEKSDVYSFGVVLFE LCARPALNPTL KEQVSLAEWA +C+KKG+LDQI DPYLKGK
Sbjct  1    QLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEWAPYCYKKGVLDQIVDPYLKGK  60

Query  292  IAPECFKKFAETAVKCVADVGTDRPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEG  471
            I PECFKKFAETA+KCV D G +RPSMGDVLWNLEFALQLQESAEE+GKG  G +D++E 
Sbjct  61   ITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQLQESAEENGKGVCGDMDMDEI  120

Query  472  F--DVTCKDKKDPEASPGFDASMTDTQssgismsiggrsLASEDSDGLTP  615
               D  CK K D ++S  ++ ++TD++SSGI MSIGGRSLASEDSDGLTP
Sbjct  121  KYDDGNCKGKND-KSSDVYEGNVTDSRSSGIDMSIGGRSLASEDSDGLTP  169



>gb|KCW87969.1| hypothetical protein EUGRSUZ_A00377, partial [Eucalyptus grandis]
Length=831

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++ THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  641  VSDFGLSKTGPNINQTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  700

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HC +KG LD I DP +KG++ PEC+KKFAETA KC+AD G D
Sbjct  701  ALNPSLPKEQVSLADWARHCQRKGTLDDIIDPCIKGQVTPECYKKFAETAGKCLADQGLD  760

Query  361  RPSMGDVLWNLEFALQLQES  420
            RP MGDVLW+LE ALQLQE+
Sbjct  761  RPPMGDVLWSLELALQLQEN  780



>gb|EEE63235.1| hypothetical protein OsJ_18045 [Oryza sativa Japonica Group]
Length=191

 Score =   230 bits (586),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSK     D T+VSTVVKGSFGYLDPEYFRRQ+LT+KSDV+SFGV+LFE+LCARP
Sbjct  5    VSDFGLSKVSTDKDKTYVSTVVKGSFGYLDPEYFRRQKLTKKSDVFSFGVLLFEVLCARP  64

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             +NP LP+EQVSL +WA  C KKGIL +I DP+L+G+I P+CF+KF ETA +CVAD   +
Sbjct  65   VINPELPEEQVSLRDWALSCRKKGILSEIIDPHLQGEITPQCFRKFTETAEQCVADYSMN  124

Query  361  RPSMGDVLWNLEFALQLQESAEES  432
            RPSMGDVLWNLE ALQLQESAEE+
Sbjct  125  RPSMGDVLWNLEVALQLQESAEEN  148



>ref|XP_004240569.1| PREDICTED: receptor-like protein kinase ANXUR1 [Solanum lycopersicum]
Length=880

 Score =   247 bits (630),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 112/142 (79%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  679  VSDFGLSKTGPNMNQGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  738

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPT  KEQVSLA+WA  C +KG L+ I DP+LKGKI PEC KKFAETA KC+AD G D
Sbjct  739  ALNPTRSKEQVSLADWALACQRKGNLEDIIDPHLKGKINPECLKKFAETAEKCLADNGVD  798

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RPSMGDVLWNLE ALQL+++ +
Sbjct  799  RPSMGDVLWNLEHALQLEDNPD  820



>emb|CAB92960.1| putative serine threonine kinase [Arabidopsis thaliana]
Length=322

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LCARP
Sbjct  193  VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARP  252

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTL KEQVSLAEWA +C+KKG+LDQI DPYLKGKI PECFKKFAETA+KCV D G +
Sbjct  253  ALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIE  312

Query  361  RPSM  372
            RPSM
Sbjct  313  RPSM  316



>ref|XP_010065050.1| PREDICTED: receptor-like protein kinase ANXUR2 [Eucalyptus grandis]
Length=858

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++ THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  668  VSDFGLSKTGPNINQTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  727

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HC +KG LD I DP +KG++ PEC+KKFAETA KC+AD G D
Sbjct  728  ALNPSLPKEQVSLADWARHCQRKGTLDDIIDPCIKGQVTPECYKKFAETAGKCLADQGLD  787

Query  361  RPSMGDVLWNLEFALQLQES  420
            RP MGDVLW+LE ALQLQE+
Sbjct  788  RPPMGDVLWSLELALQLQEN  807



>gb|AAL83882.1|AF354500_1 PTH-2 [Cucumis melo]
Length=281

 Score =   233 bits (593),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP+LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  123  VADFGLSKTGPSLDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  182

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LD I DP L GK+ P   KKF ETA KC+A+ G D
Sbjct  183  ALNPVLPREQVNIAEWAMTWQKKGMLDHIMDPNLVGKVNPASLKKFGETAEKCLAEYGVD  242

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQL+E++
Sbjct  243  RPSMGDVLWNLEYALQLEETS  263



>ref|XP_004240568.1| PREDICTED: receptor-like protein kinase ANXUR1 [Solanum lycopersicum]
Length=887

 Score =   246 bits (629),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 112/142 (79%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYS+GVVLFE+LCARP
Sbjct  688  VSDFGLSKTGPNMNQGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSYGVVLFEVLCARP  747

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALN  LPKEQVSLA+WA  C +KG L+ I DP+LKGKI PEC KKFAETA KC+AD G +
Sbjct  748  ALNSNLPKEQVSLADWALACQRKGNLEDIIDPHLKGKINPECLKKFAETAEKCLADNGIN  807

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RPSMGDVLWNLE+ALQLQE+ +
Sbjct  808  RPSMGDVLWNLEYALQLQENPD  829



>gb|KCW45810.1| hypothetical protein EUGRSUZ_L00361 [Eucalyptus grandis]
Length=270

 Score =   232 bits (592),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP +D THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LCARP
Sbjct  72   VADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEVLCARP  131

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++P+LP+E+V+LAEWA    KKG LDQI DP L GKI P+  +KF ETA KC+AD G D
Sbjct  132  VIDPSLPREKVNLAEWAMKWQKKGQLDQIIDPTLVGKIRPDSLRKFGETAEKCLADYGVD  191

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQLQE+ 
Sbjct  192  RPSMGDVLWNLEYALQLQEAV  212



>ref|XP_006654205.1| PREDICTED: receptor-like protein kinase FERONIA-like [Oryza brachyantha]
Length=868

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 133/162 (82%), Gaps = 8/162 (5%)
 Frame = +1

Query  1    VSDFGLSKTGPT-LDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSKTGPT ++ THVST+VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCAR
Sbjct  668  VSDFGLSKTGPTAMNQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCAR  727

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            PALNP+LP+EQVSLA+ A  C +KG L  I DP L GKIAP+C KKFAETA KC+AD G 
Sbjct  728  PALNPSLPREQVSLADHAMSCQRKGTLHDIIDPLLNGKIAPDCLKKFAETAEKCLADHGV  787

Query  358  DRPSMGDVLWNLEFALQLQESAEESGKGGLGGIDIEEGFDVT  483
            DRPSMGDVLWNLEFALQ+QE+ E  GK        EEG D T
Sbjct  788  DRPSMGDVLWNLEFALQMQETFENGGKP-------EEGADST  822



>ref|XP_010455191.1| PREDICTED: receptor-like protein kinase ANXUR2 [Camelina sativa]
Length=858

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  661  VSDFGLSKTGPNMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  720

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSL +WA +C +KG L+ I DP LKGKI PEC KKFA+TA KC++D G D
Sbjct  721  ALNPSLPKEQVSLGDWAMNCKRKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLD  780

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RP+MGDVLWNLEFALQLQE+A+
Sbjct  781  RPTMGDVLWNLEFALQLQETAD  802



>ref|NP_001055089.1| Os05g0280700 [Oryza sativa Japonica Group]
 gb|AAS98512.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF17003.1| Os05g0280700 [Oryza sativa Japonica Group]
 gb|EAY97366.1| hypothetical protein OsI_19288 [Oryza sativa Indica Group]
 gb|EEE63092.1| hypothetical protein OsJ_17900 [Oryza sativa Japonica Group]
Length=869

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPT-LDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSKTGPT ++ THVST+VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCAR
Sbjct  670  VSDFGLSKTGPTAMNQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCAR  729

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            PALNP+LP+EQVSLA+ A  C +KG L  I DP L GKIAP+C KKFAETA KC+AD G 
Sbjct  730  PALNPSLPREQVSLADHAMSCQRKGTLHDIIDPLLNGKIAPDCLKKFAETAEKCLADHGV  789

Query  358  DRPSMGDVLWNLEFALQLQESAEESGK  438
            DRPSMGDVLWNLEFALQ+QE+ E  GK
Sbjct  790  DRPSMGDVLWNLEFALQMQETFENGGK  816



>ref|XP_010421701.1| PREDICTED: receptor-like protein kinase ANXUR2 [Camelina sativa]
Length=858

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  661  VSDFGLSKTGPNMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  720

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSL +WA +C +KG L+ I DP LKGKI PEC KKFA+TA KC++D G D
Sbjct  721  ALNPSLPKEQVSLGDWAMNCKRKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLD  780

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RP+MGDVLWNLEFALQLQE+A+
Sbjct  781  RPTMGDVLWNLEFALQLQETAD  802



>emb|CDY48659.1| BnaC07g27500D [Brassica napus]
Length=186

 Score =   229 bits (583),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  37   LDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPTLPKEQVS  216
            ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNP+LPKEQVS
Sbjct  1    MNQGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVS  60

Query  217  LAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTDRPSMGDVLWNLE  396
            L +WA +C KKG L+ I DP LKGKI PEC KKFA+TA KC++D G DRP+MGDVLWNLE
Sbjct  61   LGDWAMNCKKKGTLEDIVDPNLKGKINPECLKKFADTAEKCLSDSGLDRPTMGDVLWNLE  120

Query  397  FALQLQESAEES  432
            FALQLQE+AE S
Sbjct  121  FALQLQETAEGS  132



>ref|XP_010039671.1| PREDICTED: receptor-like protein kinase HERK 1, partial [Eucalyptus 
grandis]
Length=282

 Score =   232 bits (591),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP +D THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LCARP
Sbjct  84   VADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEVLCARP  143

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++P+LP+E+V+LAEWA    KKG LDQI DP L GKI P+  +KF ETA KC+AD G D
Sbjct  144  VIDPSLPREKVNLAEWAMKWQKKGQLDQIIDPTLVGKIRPDSLRKFGETAEKCLADYGVD  203

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQLQE+ 
Sbjct  204  RPSMGDVLWNLEYALQLQEAV  224



>ref|XP_004156494.1| PREDICTED: receptor-like protein kinase ANXUR2-like [Cucumis 
sativus]
Length=856

 Score =   244 bits (623),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP + + HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  658  VSDFGLSKTGPNMANGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  717

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HC +KG L+ + DP+LKGKI P+  KKFA+ A KC+ D G +
Sbjct  718  ALNPSLPKEQVSLADWALHCKRKGFLEDLIDPHLKGKITPDSLKKFADAAEKCLDDHGAE  777

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RPSMGDVLWNLEFALQLQESA+
Sbjct  778  RPSMGDVLWNLEFALQLQESAD  799



>ref|XP_008456162.1| PREDICTED: receptor-like protein kinase ANXUR1 isoform X2 [Cucumis 
melo]
Length=791

 Score =   243 bits (621),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP + + HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  594  VSDFGLSKTGPNMANGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  653

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LPKEQVSLA+WA HC +KG L+ + DP+LKGKI P+  KKFA+ A KC+ D G +
Sbjct  654  ALNPNLPKEQVSLADWALHCKRKGFLEDLIDPHLKGKITPDSLKKFADAAEKCLDDHGAE  713

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RPSMGDVLWNLEFALQLQESA+
Sbjct  714  RPSMGDVLWNLEFALQLQESAD  735



>ref|XP_004139382.1| PREDICTED: receptor-like protein kinase ANXUR2-like [Cucumis 
sativus]
Length=856

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP + + HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  658  VSDFGLSKTGPNMANGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  717

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HC +KG L+ + DP+LKGKI P+  KKFA+ A KC+ D G +
Sbjct  718  ALNPSLPKEQVSLADWALHCKRKGFLEDLIDPHLKGKITPDSLKKFADAAEKCLDDHGAE  777

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RPSMGDVLWNLEFALQLQESA+
Sbjct  778  RPSMGDVLWNLEFALQLQESAD  799



>ref|XP_008456155.1| PREDICTED: receptor-like protein kinase ANXUR2 isoform X1 [Cucumis 
melo]
Length=855

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP + + HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  658  VSDFGLSKTGPNMANGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  717

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LPKEQVSLA+WA HC +KG L+ + DP+LKGKI P+  KKFA+ A KC+ D G +
Sbjct  718  ALNPNLPKEQVSLADWALHCKRKGFLEDLIDPHLKGKITPDSLKKFADAAEKCLDDHGAE  777

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RPSMGDVLWNLEFALQLQESA+
Sbjct  778  RPSMGDVLWNLEFALQLQESAD  799



>gb|KDP27915.1| hypothetical protein JCGZ_18995 [Jatropha curcas]
Length=860

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP L+  HVSTVVKGSFGYLDPEYF+RQQLTEKSDVYSFGVVLFE LCARP
Sbjct  672  VSDFGLSKTGPNLNENHVSTVVKGSFGYLDPEYFKRQQLTEKSDVYSFGVVLFEALCARP  731

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPTLPKEQVSLA+WA HC KKGI++ I DP++K +I PEC KKFAETA KC++D G  
Sbjct  732  ALNPTLPKEQVSLADWALHCQKKGIIEDIVDPHIKSEILPECLKKFAETAEKCLSDHGIY  791

Query  361  RPSMGDVLWNLEFALQLQES  420
            RPSMGDVLWNLEF LQLQ++
Sbjct  792  RPSMGDVLWNLEFCLQLQDN  811



>ref|XP_002439522.1| hypothetical protein SORBIDRAFT_09g009320 [Sorghum bicolor]
 gb|EES17952.1| hypothetical protein SORBIDRAFT_09g009320 [Sorghum bicolor]
Length=870

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 129/147 (88%), Gaps = 1/147 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPT-LDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSKTGPT ++ THVST+VKGSFGYLDPEYFRRQQLTEKSDVYS+GVVLFE+LCAR
Sbjct  671  VSDFGLSKTGPTAMNQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSYGVVLFEVLCAR  730

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            PALNP+LP+EQVSLA+ A  C +KG L  I DP LKGKIAP+C KK+AETA KC+AD G 
Sbjct  731  PALNPSLPREQVSLADHALSCQRKGTLQDIIDPVLKGKIAPDCLKKYAETAEKCLADHGV  790

Query  358  DRPSMGDVLWNLEFALQLQESAEESGK  438
            DRPSMGDVLWNLEFALQ+Q++ E  GK
Sbjct  791  DRPSMGDVLWNLEFALQMQDTFENGGK  817



>ref|XP_006408164.1| hypothetical protein EUTSA_v10020050mg [Eutrema salsugineum]
 gb|ESQ49617.1| hypothetical protein EUTSA_v10020050mg [Eutrema salsugineum]
Length=854

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  657  VSDFGLSKTGPNMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  716

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSL +WA +C +KG L+ I DP LKGKI  EC KKFA+TA KC++D G D
Sbjct  717  ALNPSLPKEQVSLGDWAMNCKRKGTLEDIIDPNLKGKINSECLKKFADTAEKCLSDSGLD  776

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RP+MGDVLWNLEFALQLQE+A+
Sbjct  777  RPTMGDVLWNLEFALQLQETAD  798



>ref|XP_008218280.1| PREDICTED: receptor-like protein kinase ANXUR1 [Prunus mume]
Length=875

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP +D+ HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LCARP
Sbjct  665  VSDFGLSKTGPNMDNGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARP  724

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HC +KG L+ I DPYLKGK+  E  KKFA+TA KC++D GTD
Sbjct  725  ALNPSLPKEQVSLADWALHCQRKGTLEDIIDPYLKGKVNMESIKKFADTAEKCLSDAGTD  784

Query  361  RPSMGDVLWNLEFALQLQE  417
            RP++ D+LWNLEFALQLQ+
Sbjct  785  RPTLNDILWNLEFALQLQD  803



>ref|XP_002874434.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50693.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=857

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  661  VSDFGLSKTGPNMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  720

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+L KEQVSL +WA +C +KG L+ I DP LKGKI PEC KKFA+TA KC++D G D
Sbjct  721  ALNPSLSKEQVSLGDWAMNCKRKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLD  780

Query  361  RPSMGDVLWNLEFALQLQESAEES  432
            RP+MGDVLWNLEFALQLQE+A+ S
Sbjct  781  RPTMGDVLWNLEFALQLQETADGS  804



>ref|XP_010463957.1| PREDICTED: receptor-like protein kinase ANXUR1 [Camelina sativa]
Length=853

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  657  VSDFGLSKTGPNMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  716

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LPKEQVSL +WA +C +KG LD I DP LKGKI  EC KKFA+TA KC++D G +
Sbjct  717  ALNPNLPKEQVSLGDWAMNCKRKGTLDDIIDPNLKGKINSECLKKFADTAEKCLSDSGLE  776

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RP+MGDVLWNLEFALQLQE+A+
Sbjct  777  RPTMGDVLWNLEFALQLQETAD  798



>ref|XP_003568703.1| PREDICTED: receptor-like protein kinase ANXUR1 [Brachypodium 
distachyon]
Length=871

 Score =   243 bits (620),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTL-DHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSKTGPT  + +HVST+VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCAR
Sbjct  668  VSDFGLSKTGPTAQNQSHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCAR  727

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            PALNP+LP+EQVSLA+ A  C +KG L  I DP LKGKIAP+C KKFAETA KC+AD G 
Sbjct  728  PALNPSLPREQVSLADHALSCQRKGTLQDIVDPLLKGKIAPDCMKKFAETAEKCLADHGV  787

Query  358  DRPSMGDVLWNLEFALQLQESAEESGK  438
            DRPSMGDVLWNLEFALQ+QE+ E  GK
Sbjct  788  DRPSMGDVLWNLEFALQMQETFENGGK  814



>ref|NP_001174345.1| Os05g0318600 [Oryza sativa Japonica Group]
 dbj|BAH93073.1| Os05g0318600, partial [Oryza sativa Japonica Group]
Length=253

 Score =   229 bits (583),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSK     D T+VSTVVKGSFGYLDPEYFRRQ+LT+KSDV+SFGV+LFE+LCARP
Sbjct  67   VSDFGLSKVSTDKDKTYVSTVVKGSFGYLDPEYFRRQKLTKKSDVFSFGVLLFEVLCARP  126

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             +NP LP+EQVSL +WA  C KKGIL +I DP+L+G+I P+CF+KF ETA +CVAD   +
Sbjct  127  VINPELPEEQVSLRDWALSCRKKGILSEIIDPHLQGEITPQCFRKFTETAEQCVADYSMN  186

Query  361  RPSMGDVLWNLEFALQLQESAEES  432
            RPSMGDVLWNLE ALQLQESAEE+
Sbjct  187  RPSMGDVLWNLEVALQLQESAEEN  210



>ref|XP_010485852.1| PREDICTED: receptor-like protein kinase ANXUR1 [Camelina sativa]
Length=851

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  657  VSDFGLSKTGPNMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  716

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LPKEQVSL +WA +C ++G LD I DP LKGKI  EC KKFA+TA KC++D G +
Sbjct  717  ALNPNLPKEQVSLGDWAMNCKRRGTLDDIIDPNLKGKINSECLKKFADTAEKCLSDSGLE  776

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RP+MGDVLWNLEFALQLQE+A+
Sbjct  777  RPTMGDVLWNLEFALQLQETAD  798



>ref|XP_006289663.1| hypothetical protein CARUB_v10003221mg [Capsella rubella]
 gb|EOA22561.1| hypothetical protein CARUB_v10003221mg [Capsella rubella]
Length=859

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  661  VSDFGLSKTGPNMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  720

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+L KEQVSL +WA +C +KG L+ I DP LKGKI PEC KKFA+TA KC++D G D
Sbjct  721  ALNPSLSKEQVSLGDWAMNCKRKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLD  780

Query  361  RPSMGDVLWNLEFALQLQESAEES  432
            RP+MGDVLWNLEFALQLQE+A+ S
Sbjct  781  RPTMGDVLWNLEFALQLQETADGS  804



>ref|XP_007035799.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY06725.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=886

 Score =   243 bits (619),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP L+  HVST+VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+L ARP
Sbjct  696  VSDFGLSKTGPNLNEGHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLGARP  755

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALN  LPKEQVSLA+WA HC +KG L +I DP+LKGKI PEC KKFAETA KC++D G D
Sbjct  756  ALNANLPKEQVSLADWALHCQRKGTLHEIIDPHLKGKINPECLKKFAETAEKCLSDHGID  815

Query  361  RPSMGDVLWNLEFALQLQES  420
            RPSMGDVLWNLEF+LQL+E+
Sbjct  816  RPSMGDVLWNLEFSLQLEEN  835



>ref|XP_002319081.1| kinase family protein [Populus trichocarpa]
 gb|EEE95004.1| kinase family protein [Populus trichocarpa]
Length=861

 Score =   243 bits (619),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP +D  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LC RP
Sbjct  662  VSDFGLSKTGPDMDKGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCGRP  721

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LPKEQVSLA+WA HC +KGI++ I DP++KGKI  EC KKFA+TA KC+A+ G +
Sbjct  722  ALNPNLPKEQVSLADWALHCQRKGIIEDIIDPHVKGKITTECLKKFADTAEKCLAESGPE  781

Query  361  RPSMGDVLWNLEFALQLQESAEESGKGGLG  450
            RP+MGDVLWNLE ALQLQ++ E S +   G
Sbjct  782  RPNMGDVLWNLELALQLQDNPEGSKRSSKG  811



>ref|NP_198220.1| receptor-like protein kinase ANXUR2 [Arabidopsis thaliana]
 sp|Q3E8W4.1|ANX2_ARATH RecName: Full=Receptor-like protein kinase ANXUR2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED93826.1| receptor-like protein kinase ANXUR2 [Arabidopsis thaliana]
Length=858

 Score =   243 bits (619),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  661  VSDFGLSKTGPNMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  720

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+L KEQVSL +WA +C +KG L+ I DP LKGKI PEC KKFA+TA KC++D G D
Sbjct  721  ALNPSLSKEQVSLGDWAMNCKRKGTLEDIIDPNLKGKINPECLKKFADTAEKCLSDSGLD  780

Query  361  RPSMGDVLWNLEFALQLQESAEES  432
            RP+MGDVLWNLEFALQLQE+A+ S
Sbjct  781  RPTMGDVLWNLEFALQLQETADGS  804



>ref|XP_010519979.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
ANXUR2 [Tarenaya hassleriana]
Length=860

 Score =   242 bits (618),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  660  VSDFGLSKTGPDMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  719

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP L KEQVSLA+WA +C KKG L+ I DP LKGKI PEC +KFA+TA KC++D G +
Sbjct  720  ALNPNLSKEQVSLADWALNCKKKGTLEDIIDPNLKGKINPECLRKFADTAEKCLSDSGVE  779

Query  361  RPSMGDVLWNLEFALQLQESAEES  432
            RP+MGDVLWNLEFALQLQE+++ S
Sbjct  780  RPTMGDVLWNLEFALQLQETSDGS  803



>ref|XP_009785956.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nicotiana sylvestris]
Length=878

 Score =   242 bits (617),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  680  VSDFGLSKTGPNMNQGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  739

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP L KEQVSLA+WA  C +KG L+ I DP LKGKI PEC KKFA+TA KC+AD G D
Sbjct  740  ALNPNLSKEQVSLADWALACQRKGNLEDIIDPQLKGKINPECLKKFAQTAEKCLADNGID  799

Query  361  RPSMGDVLWNLEFALQLQES  420
            RPSMGDVLWNLE+ALQL+E+
Sbjct  800  RPSMGDVLWNLEYALQLEEN  819



>gb|AFW77551.1| putative receptor-like protein kinase family protein [Zea mays]
Length=870

 Score =   242 bits (617),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 129/147 (88%), Gaps = 1/147 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPT-LDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSKTGPT ++ THVST+VKGSFGYLDPEYFRRQQLTEKSDVYS+GVVLFE+LCAR
Sbjct  670  VSDFGLSKTGPTAMNQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSYGVVLFEVLCAR  729

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            PALNP+LP+EQVSLA+ A  C +KG L+ I DP LKGKIAP+C KK+AETA KC+ D G 
Sbjct  730  PALNPSLPREQVSLADHALSCQRKGTLEDIIDPVLKGKIAPDCLKKYAETAEKCLCDHGV  789

Query  358  DRPSMGDVLWNLEFALQLQESAEESGK  438
            DRPSMGDVLWNLEFALQ+Q++ E  GK
Sbjct  790  DRPSMGDVLWNLEFALQMQDTFENGGK  816



>ref|XP_006595442.1| PREDICTED: receptor-like protein kinase THESEUS 1-like, partial 
[Glycine max]
Length=419

 Score =   233 bits (593),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  217  VADFGLSKTGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  276

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LDQI D  L GK+ P   KKF ETA KC+A+ G D
Sbjct  277  ALNPVLPREQVNIAEWAMSWQKKGMLDQIMDQNLVGKVNPASLKKFGETAEKCLAEYGVD  336

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQLQE++
Sbjct  337  RPSMGDVLWNLEYALQLQETS  357



>ref|XP_010417830.1| PREDICTED: receptor-like protein kinase ANXUR1 [Camelina sativa]
Length=852

 Score =   241 bits (616),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  657  VSDFGLSKTGPNMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  716

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LPKEQVSL +WA +C ++G LD I DP LKGKI  EC KKFA+TA KC++D G +
Sbjct  717  ALNPNLPKEQVSLGDWAMNCKRRGTLDDIIDPNLKGKINSECLKKFADTAEKCLSDSGLE  776

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RP+MGDVLWNLEFALQLQE+A+
Sbjct  777  RPTMGDVLWNLEFALQLQETAD  798



>ref|XP_004514615.1| PREDICTED: uncharacterized protein LOC101497599, partial [Cicer 
arietinum]
Length=1088

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 137/177 (77%), Gaps = 11/177 (6%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSK  P+LD+THV+T VKGSF YLDPEY+RRQQLT+KSDVYSFGVVLFEILCARP
Sbjct  493  VSDFGLSKIYPSLDNTHVTTEVKGSFWYLDPEYYRRQQLTDKSDVYSFGVVLFEILCARP  552

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALN  L  E+++L +WA HC+K GILDQI+DPYLKGKIA +CFKKFAETA+KCVAD G +
Sbjct  553  ALNVKLADEEMNLGKWAAHCYKTGILDQISDPYLKGKIALKCFKKFAETAMKCVADQGIE  612

Query  361  RPSMGDVLWNLEFALQLQESAE-----------ESGKGGLGGIDIEEGFDVTCKDKK  498
            RPSMGDVLWNLE ALQLQ+S E           E  +  LGGI  EE      K KK
Sbjct  613  RPSMGDVLWNLELALQLQKSLEDTANPEDNANLEDSENSLGGIHCEEPLFTDVKGKK  669



>gb|AAQ82660.1| Pto-like serine/threonine kinase [Capsicum chinense]
Length=359

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  158  VADFGLSKTGPELDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  217

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++P+LP+E V+LAEWA    KKG L+QI DP L GKI P+  +KF ETA KC+AD G D
Sbjct  218  VIDPSLPREMVNLAEWAMKWQKKGQLEQIIDPTLVGKIRPDSLRKFGETAEKCLADFGVD  277

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWN E+ALQLQE+ 
Sbjct  278  RPSMGDVLWNXEYALQLQEAV  298



>ref|XP_010102280.1| Receptor-like protein kinase [Morus notabilis]
 gb|EXB93223.1| Receptor-like protein kinase [Morus notabilis]
Length=855

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP L   HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  649  VSDFGLSKTGPDLSTGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  708

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HC +KG L+ I DP+LKGKI PE  KKFA+TA KC++D G  
Sbjct  709  ALNPSLPKEQVSLADWALHCQRKGTLEDIIDPHLKGKIDPESLKKFADTAEKCLSDHGIH  768

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RP++ D+LWNLEFALQLQE+ E
Sbjct  769  RPTLNDILWNLEFALQLQENME  790



>ref|XP_004962493.1| PREDICTED: receptor-like protein kinase ANXUR1-like [Setaria 
italica]
Length=869

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLD-HTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSKTGPT    THVST+VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCAR
Sbjct  670  VSDFGLSKTGPTTAMQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCAR  729

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            PALNP+LP+EQVSLA+ A  C +KG L  I DP LKGKIAP+C KK+AETA KC+AD G 
Sbjct  730  PALNPSLPREQVSLADHAMSCQRKGTLQDIMDPLLKGKIAPDCLKKYAETAEKCLADHGV  789

Query  358  DRPSMGDVLWNLEFALQLQESAEESGK  438
            DRPSMGDVLWNLEFALQ+Q++ E  GK
Sbjct  790  DRPSMGDVLWNLEFALQMQDTFENGGK  816



>ref|XP_008390536.1| PREDICTED: receptor-like protein kinase ANXUR1 [Malus domestica]
Length=860

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP L  THVST+VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  665  VSDFGLSKTGPNLHQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  724

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKG--KIAPECFKKFAETAVKCVADVG  354
            ALN +LPKEQVSLA+WA HC KKGIL +I DP+LK    I PEC KKFAETA KC+AD G
Sbjct  725  ALNASLPKEQVSLADWAIHCLKKGILFEIIDPHLKSGPPINPECLKKFAETAEKCLADHG  784

Query  355  TDRPSMGDVLWNLEFALQLQES  420
             +RPSMGDVLWNLEFALQL E+
Sbjct  785  LERPSMGDVLWNLEFALQLHEN  806



>ref|XP_009372137.1| PREDICTED: receptor-like protein kinase ANXUR1 [Pyrus x bretschneideri]
Length=879

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP L  THVST+VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  684  VSDFGLSKTGPNLHQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  743

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKG--KIAPECFKKFAETAVKCVADVG  354
            ALN +LPKEQVSLA+WA HC KKGIL +I DP+LK    I PEC KKFAETA KC+AD G
Sbjct  744  ALNASLPKEQVSLADWAIHCLKKGILFEIIDPHLKSGPPINPECLKKFAETAEKCLADHG  803

Query  355  TDRPSMGDVLWNLEFALQLQES  420
             +RPSMGDVLWNLEFALQL E+
Sbjct  804  LERPSMGDVLWNLEFALQLHEN  825



>gb|EMS48200.1| Receptor-like protein kinase HERK 1 [Triticum urartu]
Length=807

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTL-DHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSKTGPT+ + THVST+VKGSFGYLDPEYFRRQ+LTEKSDVYSFGVVLFE+LC R
Sbjct  605  VSDFGLSKTGPTVQNQTHVSTMVKGSFGYLDPEYFRRQKLTEKSDVYSFGVVLFEVLCGR  664

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            PALNP+LP+EQVSLA+ A  C +KG L++I DP L+GKIAP+C KKFAETA KC+AD G 
Sbjct  665  PALNPSLPREQVSLADHALSCQRKGTLEEIVDPVLEGKIAPDCLKKFAETAEKCLADQGV  724

Query  358  DRPSMGDVLWNLEFALQLQESAEESGK  438
            DRPSMGDVLWNLEFALQ+Q++ +  GK
Sbjct  725  DRPSMGDVLWNLEFALQMQDTFDNGGK  751



>ref|XP_004304753.1| PREDICTED: receptor-like protein kinase ANXUR1 [Fragaria vesca 
subsp. vesca]
Length=878

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP L+  HVSTVVKGSFGYLDPEYF+RQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  665  VSDFGLSKTGPDLNKGHVSTVVKGSFGYLDPEYFKRQQLTEKSDVYSFGVVLFEVLCARP  724

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LPKEQVSLA+WA HC +KGIL+ I DP+LKGK+  E  KKFA+TA KC+++ G D
Sbjct  725  ALNPNLPKEQVSLADWALHCQRKGILEDIIDPHLKGKVNMESIKKFADTAEKCLSECGVD  784

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RPS+ D+LWNLEFALQLQE  E
Sbjct  785  RPSLNDILWNLEFALQLQEGIE  806



>ref|XP_011079535.1| PREDICTED: receptor-like protein kinase ANXUR1 [Sesamum indicum]
Length=894

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  688  VSDFGLSKTGPNMNKGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  747

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA  C +   L+ I DP LKGKI PEC KKFAETA KC+AD G D
Sbjct  748  ALNPSLPKEQVSLADWALRCARNKTLEDIIDPQLKGKINPECLKKFAETAEKCLADHGVD  807

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RP+MGDVLW+LE ALQLQ++ E
Sbjct  808  RPTMGDVLWSLELALQLQDNHE  829



>emb|CDO98765.1| unnamed protein product [Coffea canephora]
Length=859

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPTL  THVST+VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LC RP
Sbjct  667  VSDFGLSKTGPTLHQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCGRP  726

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            AL+P LPKEQVSLA+WA  CH +G+LD I DP +KG++APEC K FAETA KC++D G D
Sbjct  727  ALDPNLPKEQVSLADWALRCHSRGVLDDIIDPCIKGEMAPECLKHFAETAAKCLSDQGID  786

Query  361  RPSMGDVLWNLEFALQLQES  420
            RPSMG VLWNLE+ LQLQ +
Sbjct  787  RPSMGAVLWNLEYCLQLQNN  806



>ref|NP_187120.1| receptor-like protein kinase ANXUR1 [Arabidopsis thaliana]
 sp|Q9SR05.1|ANX1_ARATH RecName: Full=Receptor-like protein kinase ANXUR1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF04910.1|AC011437_25 putative protein kinase [Arabidopsis thaliana]
 gb|AEE74120.1| receptor-like protein kinase ANXUR1 [Arabidopsis thaliana]
Length=850

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  657  VSDFGLSKTGPNMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  716

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSL +WA +C +KG L+ I DP LKGKI  EC KKFA+TA KC+ D G +
Sbjct  717  ALNPSLPKEQVSLGDWAMNCKRKGNLEDIIDPNLKGKINAECLKKFADTAEKCLNDSGLE  776

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RP+MGDVLWNLEFALQLQE+A+
Sbjct  777  RPTMGDVLWNLEFALQLQETAD  798



>ref|XP_007208221.1| hypothetical protein PRUPE_ppa018611mg [Prunus persica]
 gb|EMJ09420.1| hypothetical protein PRUPE_ppa018611mg [Prunus persica]
Length=876

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP +D  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LCARP
Sbjct  666  VSDFGLSKTGPNMDTGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARP  725

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HC +KG L+ I DP+LKGK+  E  KKFA+TA KC++D GTD
Sbjct  726  ALNPSLPKEQVSLADWALHCQRKGTLEDIIDPHLKGKVNMESIKKFADTAEKCLSDAGTD  785

Query  361  RPSMGDVLWNLEFALQLQESAEESG  435
            RP++ D+LWNLEFALQLQ+  + S 
Sbjct  786  RPTLNDILWNLEFALQLQDDTDGSN  810



>ref|XP_007227151.1| hypothetical protein PRUPE_ppa026453mg [Prunus persica]
 gb|EMJ28350.1| hypothetical protein PRUPE_ppa026453mg [Prunus persica]
Length=860

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 125/144 (87%), Gaps = 4/144 (3%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDH--THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCA  174
            VSDFGLSKTGP ++   THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCA
Sbjct  663  VSDFGLSKTGPNINQNQTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCA  722

Query  175  RPALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKG--KIAPECFKKFAETAVKCVAD  348
            RPALN TLPKEQVSLA+WA HC KKGIL +I DP+LK    I PEC KKF+ETA KC+AD
Sbjct  723  RPALNATLPKEQVSLADWAIHCRKKGILSEIIDPHLKAGPHINPECLKKFSETAEKCLAD  782

Query  349  VGTDRPSMGDVLWNLEFALQLQES  420
             G +RPSMGDVLWNLEFALQL E+
Sbjct  783  HGLERPSMGDVLWNLEFALQLHEN  806



>ref|XP_008223394.1| PREDICTED: receptor-like protein kinase ANXUR1 [Prunus mume]
Length=860

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 125/144 (87%), Gaps = 4/144 (3%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDH--THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCA  174
            VSDFGLSKTGP ++   THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCA
Sbjct  663  VSDFGLSKTGPNINQNQTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCA  722

Query  175  RPALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKG--KIAPECFKKFAETAVKCVAD  348
            RPALN TLPKEQVSLA+WA HC KKGIL +I DP+LK    I PEC KKF+ETA KC+AD
Sbjct  723  RPALNATLPKEQVSLADWAIHCRKKGILSEIVDPHLKAGPPINPECLKKFSETAEKCLAD  782

Query  349  VGTDRPSMGDVLWNLEFALQLQES  420
             G +RPSMGDVLWNLEFALQL E+
Sbjct  783  HGLERPSMGDVLWNLEFALQLHEN  806



>ref|XP_002884459.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60718.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=850

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  657  VSDFGLSKTGPNMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  716

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSL +WA +C +KG L+ I DP LKGKI  EC KKFA+TA KC+ D G +
Sbjct  717  ALNPSLPKEQVSLGDWAMNCKRKGNLEDIIDPNLKGKINSECLKKFADTAEKCLNDSGLE  776

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RP+MGDVLWNLEFALQLQE+A+
Sbjct  777  RPTMGDVLWNLEFALQLQETAD  798



>ref|XP_004487672.1| PREDICTED: receptor-like protein kinase THESEUS 1-like [Cicer 
arietinum]
Length=845

 Score =   240 bits (612),  Expect = 3e-70, Method: Composition-based stats.
 Identities = 113/167 (68%), Positives = 131/167 (78%), Gaps = 8/167 (5%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  644  VADFGLSKTGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  703

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA +  KKG+LDQI D +L GK+ P   KKF ETA KC+A+ G D
Sbjct  704  ALNPVLPREQVNIAEWAMNWQKKGMLDQIMDQHLVGKVNPASLKKFGETAEKCLAEYGVD  763

Query  361  RPSMGDVLWNLEFALQLQESA------EESGKGGLGGIDIE--EGFD  477
            RPSMGDVLWNLE+ALQLQE++      E++    + GI +   E FD
Sbjct  764  RPSMGDVLWNLEYALQLQETSSALMEPEDNSTNHITGIQLTRLENFD  810



>ref|XP_009129817.1| PREDICTED: receptor-like protein kinase ANXUR2 [Brassica rapa]
Length=854

 Score =   240 bits (612),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHT-HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSKTGP ++   HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR
Sbjct  655  VSDFGLSKTGPDMNAGGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  714

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            PALNP+LPKEQVSL +WA +C +KG LD I DP LKGKI  EC KKFA+TA KC++D G 
Sbjct  715  PALNPSLPKEQVSLGDWALNCKRKGNLDDIIDPNLKGKINAECLKKFADTAEKCLSDSGL  774

Query  358  DRPSMGDVLWNLEFALQLQESAE  426
            DRPSMGDVLWNLEFALQ+QE+A+
Sbjct  775  DRPSMGDVLWNLEFALQVQETAD  797



>emb|CDY05602.1| BnaC02g39350D [Brassica napus]
Length=854

 Score =   239 bits (611),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHT-HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSKTGP ++   HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR
Sbjct  655  VSDFGLSKTGPDMNAGGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  714

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            PALNP+LPKEQVSL +WA +C +KG LD I DP LKGKI  EC KKFA+TA KC++D G 
Sbjct  715  PALNPSLPKEQVSLGDWALNCKRKGNLDDIIDPNLKGKINAECLKKFADTAEKCLSDSGL  774

Query  358  DRPSMGDVLWNLEFALQLQESAE  426
            DRPSMGDVLWNLEFALQ+QE+A+
Sbjct  775  DRPSMGDVLWNLEFALQVQETAD  797



>ref|XP_002534744.1| kinase, putative [Ricinus communis]
 gb|EEF27639.1| kinase, putative [Ricinus communis]
Length=453

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP +D THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  250  VADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  309

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++PTLP+E V+LAEWA    KKG L+QI D  L GKI P+  +KF ETA KC+AD G D
Sbjct  310  VIDPTLPREMVNLAEWAMKWQKKGQLEQIIDSTLAGKIRPDSLRKFGETAEKCLADFGVD  369

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQLQE+ 
Sbjct  370  RPSMGDVLWNLEYALQLQEAV  390



>emb|CDY33885.1| BnaA02g31020D [Brassica napus]
Length=841

 Score =   239 bits (611),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHT-HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSKTGP ++   HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR
Sbjct  642  VSDFGLSKTGPDMNAGGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  701

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            PALNP+LPKEQVSL +WA +C +KG LD I DP LKGKI  EC KKFA+TA KC++D G 
Sbjct  702  PALNPSLPKEQVSLGDWALNCKRKGNLDDIIDPNLKGKINAECLKKFADTAEKCLSDSGL  761

Query  358  DRPSMGDVLWNLEFALQLQESAE  426
            DRPSMGDVLWNLEFALQ+QE+A+
Sbjct  762  DRPSMGDVLWNLEFALQVQETAD  784



>gb|EMT04378.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=833

 Score =   239 bits (610),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 129/147 (88%), Gaps = 1/147 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTL-DHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSKTGPT+ + THVST+VKGSFGYLDPEYFRRQ+LTEKSDVYSFGVVLFE+LC R
Sbjct  631  VSDFGLSKTGPTVQNQTHVSTMVKGSFGYLDPEYFRRQKLTEKSDVYSFGVVLFEVLCGR  690

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            PALNP+LP+EQVSLA+ A  C +KG L++I DP L+GKIAP+C KKFAETA KC+AD G 
Sbjct  691  PALNPSLPREQVSLADHALSCQRKGTLEEIIDPVLEGKIAPDCLKKFAETAEKCLADQGV  750

Query  358  DRPSMGDVLWNLEFALQLQESAEESGK  438
            DRPSMGDVLWNLEFALQ Q++ E  GK
Sbjct  751  DRPSMGDVLWNLEFALQQQDTFENGGK  777



>ref|XP_009385224.1| PREDICTED: receptor-like protein kinase ANXUR1 [Musa acuminata 
subsp. malaccensis]
Length=863

 Score =   239 bits (611),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGPT++ +HVST+VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCAR 
Sbjct  672  VSDFGLSKTGPTMNQSHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARA  731

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LP+EQVSLA+WA  C K+G+L  I DP L+GKI  EC  KFAETA  C+ D G D
Sbjct  732  ALNPSLPREQVSLADWALQCQKRGVLADIIDPQLEGKIGRECLHKFAETAETCLLDHGVD  791

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RPSMG+VLWNLEFALQLQES E
Sbjct  792  RPSMGNVLWNLEFALQLQESFE  813



>ref|XP_010685859.1| PREDICTED: receptor-like protein kinase HERK 1 [Beta vulgaris 
subsp. vulgaris]
Length=828

 Score =   239 bits (609),  Expect = 6e-70, Method: Composition-based stats.
 Identities = 111/157 (71%), Positives = 124/157 (79%), Gaps = 5/157 (3%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  626  VADFGLSKTGPELDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  685

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++PTLP+E V+LAEWA    KKG LDQI D  L+G + PE  +KF ETA KC+AD G D
Sbjct  686  VIDPTLPREMVNLAEWALKWQKKGQLDQIVDSSLQGNLKPESLRKFGETAEKCLADYGVD  745

Query  361  RPSMGDVLWNLEFALQLQESA-----EESGKGGLGGI  456
            RPSMGDVLWNLE+ALQLQE+      EE     +G I
Sbjct  746  RPSMGDVLWNLEYALQLQEATIPDDPEEHSTNAIGDI  782



>ref|XP_011038554.1| PREDICTED: receptor-like protein kinase ANXUR1 [Populus euphratica]
Length=861

 Score =   239 bits (610),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 129/150 (86%), Gaps = 3/150 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP +D  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE LC RP
Sbjct  662  VSDFGLSKTGPDMDKGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCGRP  721

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LPKEQVSLA+WA HC +KGI++ ITDP++KG+I  EC KKFA+TA KC+A+ G +
Sbjct  722  ALNPNLPKEQVSLADWALHCQRKGIIEDITDPHVKGEITTECLKKFADTAEKCLAESGPE  781

Query  361  RPSMGDVLWNLEFALQLQES---AEESGKG  441
            RP+MGDVLWNLE +LQLQ++   ++ S KG
Sbjct  782  RPNMGDVLWNLELSLQLQDNPDGSKHSSKG  811



>dbj|BAK06468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=891

 Score =   239 bits (611),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTL-DHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSKTGPT+ + THVST+VKGSFGYLDPEYFRRQ+LTEKSDVYSFGVVLFE+LCAR
Sbjct  689  VSDFGLSKTGPTVQNQTHVSTMVKGSFGYLDPEYFRRQKLTEKSDVYSFGVVLFEVLCAR  748

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            PALNP+LP+EQVSLA+ A  C ++G L++I DP L+GK+AP+C KKFAETA KC++D G 
Sbjct  749  PALNPSLPREQVSLADHALSCQRRGTLEEIIDPVLEGKVAPDCLKKFAETAEKCLSDQGV  808

Query  358  DRPSMGDVLWNLEFALQLQESAEESGK  438
            DRPSMGDVLWNLEFALQ+Q++ +  GK
Sbjct  809  DRPSMGDVLWNLEFALQMQDTFDNGGK  835



>ref|XP_008226684.1| PREDICTED: receptor-like protein kinase THESEUS 1 [Prunus mume]
Length=840

 Score =   239 bits (609),  Expect = 8e-70, Method: Composition-based stats.
 Identities = 107/141 (76%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  639  VADFGLSKTGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  698

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LDQI DP L GK+ P   KKF ETA KC+A+ G D
Sbjct  699  ALNPVLPREQVNIAEWAMTWQKKGMLDQIMDPNLVGKVNPSSLKKFGETAEKCLAEYGVD  758

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQL+E++
Sbjct  759  RPSMGDVLWNLEYALQLEETS  779



>ref|XP_006488842.1| PREDICTED: receptor-like protein kinase ANXUR1-like [Citrus sinensis]
Length=862

 Score =   239 bits (609),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP L+ THVST+VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  668  VSDFGLSKTGPNLNQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  727

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALN  LPKEQVSLA+WA HC + G ++ I DP LKG I  +C +KF ETA KC++D G D
Sbjct  728  ALNVNLPKEQVSLADWALHCQRMGTIEDIIDPNLKGNITDQCLRKFTETAEKCLSDQGID  787

Query  361  RPSMGDVLWNLEFALQLQES  420
            RPSMGDVLWNLEFALQLQ++
Sbjct  788  RPSMGDVLWNLEFALQLQDN  807



>ref|XP_002316044.1| Pto-like kinase OGw family protein [Populus trichocarpa]
 gb|EEF02215.1| Pto-like kinase OGw family protein [Populus trichocarpa]
Length=858

 Score =   239 bits (609),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP L  THVSTV+KGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LC RP
Sbjct  667  VSDFGLSKTGPDLKQTHVSTVIKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCGRP  726

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+ PKEQVSLA+WA HC +KG L  I DP++K  I PEC+ KFAETAVKC+AD G +
Sbjct  727  ALNPSSPKEQVSLADWALHCQRKGTLWDIIDPHIKEDIDPECYNKFAETAVKCLADHGCN  786

Query  361  RPSMGDVLWNLEFALQLQES  420
            RPSMGDVLWNL+F+LQ+Q++
Sbjct  787  RPSMGDVLWNLDFSLQMQDN  806



>ref|XP_006419383.1| hypothetical protein CICLE_v10004295mg [Citrus clementina]
 gb|ESR32623.1| hypothetical protein CICLE_v10004295mg [Citrus clementina]
Length=862

 Score =   239 bits (609),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP L+ THVST+VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  668  VSDFGLSKTGPNLNQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  727

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALN  LPKEQVSLA+WA HC + G ++ I DP LKG I  +C +KF ETA KC++D G D
Sbjct  728  ALNVNLPKEQVSLADWALHCQRMGTIEDIIDPNLKGNITDQCLRKFTETAEKCLSDQGID  787

Query  361  RPSMGDVLWNLEFALQLQES  420
            RPSMGDVLWNLEFALQLQ++
Sbjct  788  RPSMGDVLWNLEFALQLQDN  807



>gb|KDO71938.1| hypothetical protein CISIN_1g041565mg [Citrus sinensis]
Length=862

 Score =   239 bits (609),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP L+ THVST+VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  668  VSDFGLSKTGPNLNQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  727

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALN  LPKEQVSLA+WA HC + G ++ I DP LKG I  +C +KF ETA KC++D G D
Sbjct  728  ALNVNLPKEQVSLADWALHCQRMGTIEDIIDPNLKGNITDQCLRKFTETAEKCLSDQGID  787

Query  361  RPSMGDVLWNLEFALQLQES  420
            RPSMGDVLWNLEFALQLQ++
Sbjct  788  RPSMGDVLWNLEFALQLQDN  807



>gb|KDO73010.1| hypothetical protein CISIN_1g003341mg [Citrus sinensis]
 gb|KDO73011.1| hypothetical protein CISIN_1g003341mg [Citrus sinensis]
 gb|KDO73012.1| hypothetical protein CISIN_1g003341mg [Citrus sinensis]
Length=828

 Score =   238 bits (608),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 107/140 (76%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP +D THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  626  VADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  685

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++PTLP+E V+LAEWA     KG LDQI DP L GKI P+  +KF ETA KC+AD G D
Sbjct  686  VIDPTLPREMVNLAEWAMKWQNKGQLDQIIDPTLAGKIRPDSLRKFGETAEKCLADFGVD  745

Query  361  RPSMGDVLWNLEFALQLQES  420
            RPSMGDVLWNLE+ALQLQE+
Sbjct  746  RPSMGDVLWNLEYALQLQEA  765



>ref|XP_009799586.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nicotiana sylvestris]
Length=860

 Score =   238 bits (608),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 103/142 (73%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP L  THVST+VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL+E+LC RP
Sbjct  668  VSDFGLSKTGPNLHQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLYEVLCGRP  727

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HCH++    +I DP++KG+I  EC K+F +TAV C++D GTD
Sbjct  728  ALNPSLPKEQVSLADWALHCHRRHTTKEIVDPHIKGEITQECLKQFVDTAVSCLSDHGTD  787

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RPSMG VLWNLE+ LQ+Q + +
Sbjct  788  RPSMGSVLWNLEYCLQMQNNPD  809



>gb|KDO73009.1| hypothetical protein CISIN_1g003341mg [Citrus sinensis]
Length=805

 Score =   238 bits (607),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 107/140 (76%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP +D THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  603  VADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  662

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++PTLP+E V+LAEWA     KG LDQI DP L GKI P+  +KF ETA KC+AD G D
Sbjct  663  VIDPTLPREMVNLAEWAMKWQNKGQLDQIIDPTLAGKIRPDSLRKFGETAEKCLADFGVD  722

Query  361  RPSMGDVLWNLEFALQLQES  420
            RPSMGDVLWNLE+ALQLQE+
Sbjct  723  RPSMGDVLWNLEYALQLQEA  742



>emb|CAB62020.1| receptor-like protein kinase homolog [Arabidopsis thaliana]
Length=512

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLT+KSDVYSFGVVLFE+LCARP
Sbjct  307  VADFGLSKTGPELDQTHVSTAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARP  366

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++PTLP+E V+LAEWA    KKG LDQI D  L+G I P+  +KFAET  KC+AD G D
Sbjct  367  VIDPTLPREMVNLAEWAMKWQKKGQLDQIIDQSLRGNIRPDSLRKFAETGEKCLADYGVD  426

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQLQE+ 
Sbjct  427  RPSMGDVLWNLEYALQLQEAV  447



>ref|XP_006424719.1| hypothetical protein CICLE_v10027823mg [Citrus clementina]
 ref|XP_006424720.1| hypothetical protein CICLE_v10027823mg [Citrus clementina]
 ref|XP_006488232.1| PREDICTED: receptor-like protein kinase HERK 1-like [Citrus sinensis]
 gb|ESR37959.1| hypothetical protein CICLE_v10027823mg [Citrus clementina]
 gb|ESR37960.1| hypothetical protein CICLE_v10027823mg [Citrus clementina]
Length=828

 Score =   238 bits (607),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 107/140 (76%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP +D THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  626  VADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  685

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++PTLP+E V+LAEWA     KG LDQI DP L GKI P+  +KF ETA KC+AD G D
Sbjct  686  VIDPTLPREMVNLAEWAMKWQNKGQLDQIIDPTLAGKIRPDSLRKFGETAEKCLADFGVD  745

Query  361  RPSMGDVLWNLEFALQLQES  420
            RPSMGDVLWNLE+ALQLQE+
Sbjct  746  RPSMGDVLWNLEYALQLQEA  765



>ref|XP_009601576.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nicotiana tomentosiformis]
Length=878

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  680  VSDFGLSKTGPNMNQGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  739

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP L KEQVSLA+WA  C +KG L+ I DP LKGKI PEC K FA TA KC+AD G D
Sbjct  740  ALNPNLSKEQVSLADWALACQRKGNLEDIIDPQLKGKINPECLKIFARTAEKCLADNGID  799

Query  361  RPSMGDVLWNLEFALQLQES  420
            RPSMGDVLWNLE+ALQL+E+
Sbjct  800  RPSMGDVLWNLEYALQLEEN  819



>ref|XP_002519226.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43090.1| ATP binding protein, putative [Ricinus communis]
Length=854

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDH-THVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSKTGP L++ +HVSTVVKGSFGYLDPEYF+RQQLTEKSDVYSFGVVLFE+LCAR
Sbjct  661  VSDFGLSKTGPNLNNQSHVSTVVKGSFGYLDPEYFKRQQLTEKSDVYSFGVVLFEVLCAR  720

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            PALNP L KEQVSLA+WA HC KKGI++ + DP++K  I PEC +KFAETA KC++D G 
Sbjct  721  PALNPNLAKEQVSLADWALHCQKKGIIEDLIDPHIKADIQPECLRKFAETAEKCLSDHGI  780

Query  358  DRPSMGDVLWNLEFALQLQES  420
             RPSMGDVLWNLEFALQLQ++
Sbjct  781  HRPSMGDVLWNLEFALQLQDN  801



>gb|KDP44164.1| hypothetical protein JCGZ_05631 [Jatropha curcas]
Length=834

 Score =   238 bits (606),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 107/139 (77%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSK GP +D THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  633  VADFGLSKAGPEIDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  692

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++PTLP+E V+LAEWA    KKG LDQI DP L GKI P+  +KF ETA KC+AD+G D
Sbjct  693  VIDPTLPREMVNLAEWAMKWQKKGQLDQIIDPTLVGKIRPDSLRKFGETAEKCLADLGVD  752

Query  361  RPSMGDVLWNLEFALQLQE  417
            RPSMGDVLWNLE+ALQLQE
Sbjct  753  RPSMGDVLWNLEYALQLQE  771



>ref|XP_004294627.1| PREDICTED: receptor-like protein kinase HERK 1 [Fragaria vesca 
subsp. vesca]
Length=833

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 139/186 (75%), Gaps = 10/186 (5%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  632  VADFGLSKTGPELDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  691

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++P+LP+E V+LAEWA    KKG L+QI DP L GKI P+  +KFAETA KC+AD G D
Sbjct  692  VIDPSLPREMVNLAEWAMKWQKKGQLEQIIDPTLAGKIRPDSLRKFAETAEKCLADYGVD  751

Query  361  RPSMGDVLWNLEFALQLQESA-----EESGKGGLGGIDIEEGFDVTCKDKKDPEASPG-F  522
            RPSMGDVLWNLE+ALQLQE+      E++    +G +  +    V   +  D  ASPG F
Sbjct  752  RPSMGDVLWNLEYALQLQEAVVPGDPEDNSTNMIGELSPQ----VNNFNHIDTTASPGQF  807

Query  523  DASMTD  540
            + S  D
Sbjct  808  EVSSVD  813



>gb|KHN28027.1| Receptor-like protein kinase THESEUS 1 [Glycine soja]
Length=697

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 130/170 (76%), Gaps = 8/170 (5%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  496  VADFGLSKTGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  555

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LDQI D  L GK+ P   KKF ETA KC+A+ G D
Sbjct  556  ALNPVLPREQVNIAEWAMSWQKKGMLDQIMDQNLAGKVNPASLKKFGETAEKCLAEYGVD  615

Query  361  RPSMGDVLWNLEFALQLQESA------EESGKGGLGGIDIE--EGFDVTC  486
            RPSMGDVLWNLE+ALQLQE++      E++    + GI +   E FD T 
Sbjct  616  RPSMGDVLWNLEYALQLQETSSALMEPEDNSTNHITGIQLTRLEPFDNTV  665



>ref|XP_004499646.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=1333

 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +1

Query  1     VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
             VSDFGLSKT P+LD+THV+T VKGSFGYLDPEY+RRQQ+T+KSDVYSFGVV+FEILCARP
Sbjct  987   VSDFGLSKTYPSLDNTHVTTEVKGSFGYLDPEYYRRQQMTDKSDVYSFGVVIFEILCARP  1046

Query  181   ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ALN     E+++L +WA HC+K GILDQI+DPYLKGKI PECFKKFAETA+KCVAD G +
Sbjct  1047  ALNVKPADEEMNLGKWAAHCYKTGILDQISDPYLKGKIVPECFKKFAETAMKCVADQGIE  1106

Query  361   RPSMGDVLWNLEFALQLQESAEESGK  438
             RPSMGDVLWNLE AL+LQ+S+E++  
Sbjct  1107  RPSMGDVLWNLELALRLQKSSEDTAN  1132



>ref|XP_009602553.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nicotiana tomentosiformis]
Length=867

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP L  THVST+VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE++C RP
Sbjct  675  VSDFGLSKTGPNLHQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVVCGRP  734

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA HCH++    +I DP++KG+I PEC K+F +TAV C++D GTD
Sbjct  735  ALNPSLPKEQVSLADWALHCHRRHTTKEIVDPHIKGEITPECLKQFVDTAVSCLSDHGTD  794

Query  361  RPSMGDVLWNLEFALQLQES  420
            RPSMG VLWNLE+ LQ+Q +
Sbjct  795  RPSMGSVLWNLEYCLQMQNN  814



>gb|KDP38931.1| hypothetical protein JCGZ_00688 [Jatropha curcas]
Length=466

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  265  VADFGLSKTGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  324

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LDQI D  L GK+ P   KKF ETA KC+A+ G D
Sbjct  325  ALNPVLPREQVNIAEWAMTWQKKGMLDQIMDSNLVGKVNPASLKKFGETAEKCLAEHGVD  384

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQL+E++
Sbjct  385  RPSMGDVLWNLEYALQLEETS  405



>ref|XP_007213653.1| hypothetical protein PRUPE_ppa001400mg [Prunus persica]
 gb|EMJ14852.1| hypothetical protein PRUPE_ppa001400mg [Prunus persica]
Length=837

 Score =   237 bits (605),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 107/141 (76%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  636  VADFGLSKTGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  695

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LDQI DP L GK+ P   KKF ETA KC+A+ G D
Sbjct  696  ALNPVLPREQVNIAEWAMTWQKKGMLDQIMDPNLVGKVNPASLKKFGETAEKCLAEYGVD  755

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQL+E++
Sbjct  756  RPSMGDVLWNLEYALQLEETS  776



>ref|XP_011089398.1| PREDICTED: receptor-like protein kinase HERK 1 [Sesamum indicum]
Length=835

 Score =   237 bits (605),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 116/185 (63%), Positives = 137/185 (74%), Gaps = 8/185 (4%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP +D THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  634  VADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  693

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++P+LP+E V+LAEWA    KKG LDQI DP L GKI P+  +K+ ETA KC+AD G D
Sbjct  694  VIDPSLPREMVNLAEWAMKWQKKGQLDQIIDPNLAGKIKPDSLRKYGETAEKCLADFGVD  753

Query  361  RPSMGDVLWNLEFALQLQESA-----EESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFD  525
            RPSMGDVLWNLE+ALQLQE+      EE+    +G +  + G +    D  +  A  GF+
Sbjct  754  RPSMGDVLWNLEYALQLQEAVVHNDPEENSTNVIGQLSPQVG-EFNNVDTSNSVA--GFE  810

Query  526  ASMTD  540
             S  D
Sbjct  811  TSSVD  815



>ref|XP_009334606.1| PREDICTED: receptor-like protein kinase THESEUS 1 [Pyrus x bretschneideri]
 ref|XP_009347710.1| PREDICTED: receptor-like protein kinase THESEUS 1 [Pyrus x bretschneideri]
Length=838

 Score =   237 bits (605),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 109/163 (67%), Positives = 128/163 (79%), Gaps = 6/163 (4%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSK GP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  638  VADFGLSKAGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  697

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LDQI DP L GK+ P   KKF ETA KC+A+ G D
Sbjct  698  ALNPVLPREQVNIAEWAMTWQKKGMLDQIMDPNLAGKVNPASLKKFGETAEKCLAEYGVD  757

Query  361  RPSMGDVLWNLEFALQLQESA------EESGKGGLGGIDIEEG  471
            RPSMGDVLWNLE+ALQL+E++      +++    + GI + +G
Sbjct  758  RPSMGDVLWNLEYALQLEETSSALMEPDDNSTNHIPGIQLTQG  800



>ref|XP_003634651.1| PREDICTED: receptor-like protein kinase THESEUS 1 isoform X2 
[Vitis vinifera]
Length=843

 Score =   237 bits (605),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 110/160 (69%), Positives = 127/160 (79%), Gaps = 6/160 (4%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  642  VADFGLSKTGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  701

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LDQI DP L GK+ P   KKF ETA KC+A+ G D
Sbjct  702  ALNPVLPREQVNIAEWAMSWQKKGMLDQIMDPNLVGKVNPASLKKFGETAEKCLAEHGVD  761

Query  361  RPSMGDVLWNLEFALQLQESA------EESGKGGLGGIDI  462
            RPSMGDVLWNLE+ALQL+E++      E++    + GI +
Sbjct  762  RPSMGDVLWNLEYALQLEETSLALTEPEDNSTNHIAGIQL  801



>ref|XP_010644229.1| PREDICTED: receptor-like protein kinase THESEUS 1 isoform X1 
[Vitis vinifera]
 ref|XP_010644230.1| PREDICTED: receptor-like protein kinase THESEUS 1 isoform X1 
[Vitis vinifera]
 ref|XP_010644231.1| PREDICTED: receptor-like protein kinase THESEUS 1 isoform X1 
[Vitis vinifera]
Length=842

 Score =   237 bits (605),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 110/160 (69%), Positives = 127/160 (79%), Gaps = 6/160 (4%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  641  VADFGLSKTGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  700

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LDQI DP L GK+ P   KKF ETA KC+A+ G D
Sbjct  701  ALNPVLPREQVNIAEWAMSWQKKGMLDQIMDPNLVGKVNPASLKKFGETAEKCLAEHGVD  760

Query  361  RPSMGDVLWNLEFALQLQESA------EESGKGGLGGIDI  462
            RPSMGDVLWNLE+ALQL+E++      E++    + GI +
Sbjct  761  RPSMGDVLWNLEYALQLEETSLALTEPEDNSTNHIAGIQL  800



>emb|CDY49572.1| BnaA10g12680D [Brassica napus]
Length=293

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP +D THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVV+FE+LCARP
Sbjct  94   VADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVMFEVLCARP  153

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++PTLP+E V+LAEWA    KKG L+ + D  L+G+I P+  +KF ET  KC+AD G D
Sbjct  154  VIDPTLPREMVNLAEWAMKWQKKGQLEHVIDQSLRGEIVPDSLRKFGETGEKCLADYGVD  213

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQLQE+ 
Sbjct  214  RPSMGDVLWNLEYALQLQEAG  234



>gb|KEH38803.1| malectin/receptor-like kinase family protein [Medicago truncatula]
Length=843

 Score =   237 bits (605),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 107/141 (76%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  642  VADFGLSKTGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  701

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA +  KKG+LDQI D  L GK+ P   KKF ETA KC+A+ G D
Sbjct  702  ALNPVLPREQVNIAEWAMNWQKKGMLDQIMDQQLVGKVNPASLKKFGETAEKCLAEYGVD  761

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQLQE++
Sbjct  762  RPSMGDVLWNLEYALQLQETS  782



>emb|CBI16212.3| unnamed protein product [Vitis vinifera]
Length=798

 Score =   237 bits (604),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP +D THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  592  VADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  651

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++PTLP+E V+LAEWA    K+G L+QI DP L GKI P+  +KF ETA KC++D G D
Sbjct  652  VIDPTLPREMVNLAEWAMKWQKRGQLEQIIDPNLVGKIRPDSLRKFGETAEKCLSDFGVD  711

Query  361  RPSMGDVLWNLEFALQLQESAEE  429
            RPSMGD+LWNLE+ALQLQE+  E
Sbjct  712  RPSMGDILWNLEYALQLQEAVLE  734



>ref|XP_010426068.1| PREDICTED: receptor-like protein kinase HERK 1 [Camelina sativa]
Length=627

 Score =   234 bits (596),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  422  VADFGLSKTGPELDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  481

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++PTLP+E V+LAEWA    KKG LDQI D  L+G I P+  +KFAET  KC+AD G D
Sbjct  482  VIDPTLPREMVNLAEWAMKWQKKGQLDQIIDQSLRGNIRPDSLRKFAETGEKCLADYGVD  541

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQLQE+ 
Sbjct  542  RPSMGDVLWNLEYALQLQEAV  562



>ref|XP_011458098.1| PREDICTED: receptor-like protein kinase THESEUS 1 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458099.1| PREDICTED: receptor-like protein kinase THESEUS 1 [Fragaria vesca 
subsp. vesca]
Length=844

 Score =   237 bits (605),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 105/141 (74%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSK GP +D THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  643  VADFGLSKAGPAIDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  702

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LDQI DP L GK+ P   KKF ETA KC+A+ G D
Sbjct  703  ALNPVLPREQVNIAEWAMTWQKKGMLDQIMDPNLAGKVNPASLKKFGETAEKCLAEYGVD  762

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQL+E++
Sbjct  763  RPSMGDVLWNLEYALQLEETS  783



>gb|KJB20195.1| hypothetical protein B456_003G137700 [Gossypium raimondii]
Length=831

 Score =   237 bits (604),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 116/185 (63%), Positives = 134/185 (72%), Gaps = 9/185 (5%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  631  VADFGLSKTGPELDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  690

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++PTLP+E V+LAEWA    KKG L+QI D  LKG I     +KF ETA KC+AD G D
Sbjct  691  VIDPTLPREMVNLAEWAMKWQKKGQLEQIIDSSLKGNIRSNSLRKFGETAEKCLADFGVD  750

Query  361  RPSMGDVLWNLEFALQLQES-----AEESGKGGLGGIDIEEGFDVTCKDKKDPEASPGFD  525
            RPSMGDVLWNLE+ALQLQE+     AEE+    +G +  +    +    + DP  S  F+
Sbjct  751  RPSMGDVLWNLEYALQLQEAVVQGDAEENSTNMIGELSPQ----INNFSQLDPTGSAKFE  806

Query  526  ASMTD  540
             S  D
Sbjct  807  VSSVD  811



>gb|EYU38427.1| hypothetical protein MIMGU_mgv1a001092mg [Erythranthe guttata]
Length=892

 Score =   237 bits (605),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 110/158 (70%), Positives = 127/158 (80%), Gaps = 3/158 (2%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  683  VSDFGLSKTGPNMNQGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  742

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             LNP+LPKEQVSLA+WA  C +   L  I DP LK K++ EC  KF +TA KC+AD G D
Sbjct  743  VLNPSLPKEQVSLADWALRCARNKTLGDIIDPQLKDKVSQECLNKFIDTAEKCLADHGVD  802

Query  361  RPSMGDVLWNLEFALQLQESAEE---SGKGGLGGIDIE  465
            RPSMGDVLWNLEFALQL ++ E+   +G G  G +D++
Sbjct  803  RPSMGDVLWNLEFALQLHDNPEDKRAAGSGKTGSVDLD  840



>ref|XP_010672753.1| PREDICTED: receptor-like protein kinase HERK 1 [Beta vulgaris 
subsp. vulgaris]
Length=838

 Score =   237 bits (604),  Expect = 4e-69, Method: Composition-based stats.
 Identities = 104/140 (74%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP +D THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  640  VADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  699

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++PTLP+E V+LAEW    HKKG LD + DP L GKI PE  +KF ETA KC+AD G D
Sbjct  700  VIDPTLPREMVNLAEWVMKWHKKGQLDHVVDPSLAGKIKPESLRKFGETAEKCLADYGVD  759

Query  361  RPSMGDVLWNLEFALQLQES  420
            RP++GDVLWNLE+ LQLQE+
Sbjct  760  RPTIGDVLWNLEYTLQLQEA  779



>ref|XP_010550913.1| PREDICTED: receptor-like protein kinase ANXUR2 [Tarenaya hassleriana]
Length=867

 Score =   237 bits (604),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HV+TVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP
Sbjct  668  VSDFGLSKTGPDMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  727

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+L KEQVSL +WA +C +KG L+ I DP LKGKI PEC  KFA+TA KC+ + G +
Sbjct  728  ALNPSLSKEQVSLGDWALNCKRKGTLEDIIDPNLKGKINPECLTKFADTAEKCLYESGIE  787

Query  361  RPSMGDVLWNLEFALQLQESAEES  432
            RP+MGDVLWNLEFALQLQE+A+ S
Sbjct  788  RPTMGDVLWNLEFALQLQETADGS  811



>emb|CAN65310.1| hypothetical protein VITISV_043086 [Vitis vinifera]
Length=289

 Score =   224 bits (571),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPT-LDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSK GPT + + HVSTVVKGSFGYLDPEY+RRQQLTEKSDVYSFGVVLFE+LCAR
Sbjct  65   VSDFGLSKMGPTSMSNAHVSTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLFEVLCAR  124

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            P LN T+ KE+VSLA+WA  C++ G L+QI DP+LKGKIAP+C +KF E AV C+ D G 
Sbjct  125  PPLNQTVEKERVSLAQWAPACYRDGKLEQIVDPFLKGKIAPDCLQKFGEIAVSCLQDQGI  184

Query  358  DRPSMGDVLWNLEFALQLQESAEE  429
            +RPSM DV+W L+FA+QLQESAE+
Sbjct  185  ERPSMSDVVWGLQFAMQLQESAEQ  208



>ref|XP_006841758.1| hypothetical protein AMTR_s00003p00263880 [Amborella trichopoda]
 gb|ERN03433.1| hypothetical protein AMTR_s00003p00263880 [Amborella trichopoda]
Length=843

 Score =   236 bits (603),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC+RP
Sbjct  646  VADFGLSKTGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCSRP  705

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    +KG+LD I DP+L GKI P   KKF ETA KC+A+ G D
Sbjct  706  ALNPGLPREQVNIAEWAMGWQRKGMLDHIMDPFLAGKINPGSLKKFGETAEKCLAEYGVD  765

Query  361  RPSMGDVLWNLEFALQLQESAE  426
            RP+MGDVLWNLE+ALQLQE++E
Sbjct  766  RPTMGDVLWNLEYALQLQETSE  787



>ref|XP_009793250.1| PREDICTED: receptor-like protein kinase THESEUS 1 [Nicotiana 
sylvestris]
Length=837

 Score =   236 bits (603),  Expect = 5e-69, Method: Composition-based stats.
 Identities = 107/141 (76%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  636  VADFGLSKTGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  695

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LDQI DP L GK+     KKF ETA KC+AD G D
Sbjct  696  ALNPVLPREQVNIAEWAMTWQKKGMLDQIMDPNLAGKVTSASLKKFGETAEKCLADHGVD  755

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQL+E++
Sbjct  756  RPSMGDVLWNLEYALQLEETS  776



>emb|CAN68061.1| hypothetical protein VITISV_037438 [Vitis vinifera]
Length=289

 Score =   224 bits (571),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPT-LDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSK GPT + + HVSTVVKGSFGYLDPEY+RRQQLTEKSDVYSFGVVLFE+LCAR
Sbjct  65   VSDFGLSKMGPTSMSNAHVSTVVKGSFGYLDPEYYRRQQLTEKSDVYSFGVVLFEVLCAR  124

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            P LN T+ KE+VSLA+WA  C++ G L+QI DP+LKGKIAP+C +KF E AV C+ D G 
Sbjct  125  PPLNQTVEKERVSLAQWAPSCYRDGKLEQIVDPFLKGKIAPDCLQKFGEIAVSCLQDQGI  184

Query  358  DRPSMGDVLWNLEFALQLQESAEE  429
            +RPSM DV+W L+FA+QLQESAE+
Sbjct  185  ERPSMTDVVWGLQFAMQLQESAEQ  208



>ref|XP_010097778.1| Receptor-like protein kinase [Morus notabilis]
 gb|EXB71057.1| Receptor-like protein kinase [Morus notabilis]
Length=861

 Score =   236 bits (603),  Expect = 6e-69, Method: Composition-based stats.
 Identities = 108/145 (74%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPT-LDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCAR  177
            VSDFGLSK GP+ L+  HVST+VKGSFGYLDPEYFRRQ+LTEKSDVYSFGVVLFE+LCAR
Sbjct  667  VSDFGLSKQGPSGLNQGHVSTLVKGSFGYLDPEYFRRQKLTEKSDVYSFGVVLFEVLCAR  726

Query  178  PALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGT  357
            PAL  T PKEQV+LA+W  +C KKGIL++I DP+LKG I+PEC KKFAETA KC++D G 
Sbjct  727  PALEATSPKEQVNLADWVLYCQKKGILEEIIDPHLKGMISPECLKKFAETAEKCLSDHGV  786

Query  358  DRPSMGDVLWNLEFALQLQESAEES  432
            DRPSMGDVLWNLE+ALQL ++ E +
Sbjct  787  DRPSMGDVLWNLEYALQLHDNPEAA  811



>ref|XP_010327142.1| PREDICTED: receptor-like protein kinase THESEUS 1 [Solanum lycopersicum]
Length=840

 Score =   236 bits (603),  Expect = 6e-69, Method: Composition-based stats.
 Identities = 105/141 (74%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSK GP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  638  VADFGLSKAGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  697

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LD+I DP LKG++ P   KKF ETA KC+A+ G D
Sbjct  698  ALNPVLPREQVNIAEWAMIWQKKGMLDRIMDPNLKGQVNPASLKKFGETAEKCLAEYGVD  757

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQL+E++
Sbjct  758  RPSMGDVLWNLEYALQLEEAS  778



>gb|KHN36342.1| Receptor-like protein kinase THESEUS 1 [Glycine soja]
Length=784

 Score =   235 bits (600),  Expect = 8e-69, Method: Composition-based stats.
 Identities = 107/141 (76%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP+LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  583  VADFGLSKTGPSLDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  642

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LDQI D  L GK+ P   KKF ETA KC+A+ G D
Sbjct  643  ALNPVLPREQVNIAEWAMTWQKKGMLDQIMDQNLVGKVNPASLKKFGETAEKCLAEHGVD  702

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQLQE++
Sbjct  703  RPSMGDVLWNLEYALQLQETS  723



>ref|XP_009613068.1| PREDICTED: receptor-like protein kinase THESEUS 1 [Nicotiana 
tomentosiformis]
Length=837

 Score =   236 bits (601),  Expect = 8e-69, Method: Composition-based stats.
 Identities = 107/141 (76%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  636  VADFGLSKTGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  695

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LDQI DP L GK+     KKF ETA KC+AD G D
Sbjct  696  ALNPVLPREQVNIAEWAMIWQKKGMLDQIMDPNLAGKVTSASLKKFGETAEKCLADHGVD  755

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQL+E++
Sbjct  756  RPSMGDVLWNLEYALQLEETS  776



>gb|KHN24812.1| Receptor-like protein kinase THESEUS 1 [Glycine soja]
Length=629

 Score =   233 bits (593),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 127/160 (79%), Gaps = 6/160 (4%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP+LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  428  VADFGLSKTGPSLDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  487

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LDQI D  L GK+ P   KKF ETA KC+A+ G D
Sbjct  488  ALNPVLPREQVNIAEWAMTWQKKGMLDQIMDQNLVGKVNPASLKKFGETAEKCLAEHGVD  547

Query  361  RPSMGDVLWNLEFALQLQESA------EESGKGGLGGIDI  462
            RPSMGDVLWNLE+ALQLQE++      E++    + GI +
Sbjct  548  RPSMGDVLWNLEYALQLQETSSALMEPEDNSTNHITGIQL  587



>ref|XP_009342432.1| PREDICTED: receptor-like protein kinase THESEUS 1 [Pyrus x bretschneideri]
Length=842

 Score =   236 bits (601),  Expect = 8e-69, Method: Composition-based stats.
 Identities = 108/163 (66%), Positives = 127/163 (78%), Gaps = 6/163 (4%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSK GP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  641  VADFGLSKAGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  700

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LDQI DP L GK+ P   KKF ETA KC+A+ G D
Sbjct  701  ALNPVLPREQVNIAEWAMTWQKKGMLDQIMDPNLVGKVNPASLKKFGETAEKCLAEYGVD  760

Query  361  RPSMGDVLWNLEFALQLQESA------EESGKGGLGGIDIEEG  471
            RPSMGDVLWNLE+A QL+E++      +++    + GI + +G
Sbjct  761  RPSMGDVLWNLEYAFQLEETSSALMEPDDNSTNHIPGIQLTQG  803



>gb|EPS72234.1| hypothetical protein M569_02521, partial [Genlisea aurea]
Length=845

 Score =   236 bits (601),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 124/145 (86%), Gaps = 2/145 (1%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  649  VSDFGLSKTGPNMNKGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  708

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP+LPKEQVSLA+WA  C +   L++I DP LKGKIAPEC  KFA+TA KC+AD G D
Sbjct  709  ALNPSLPKEQVSLADWALRCARNKTLEEIIDPQLKGKIAPECLAKFADTAEKCLADHGAD  768

Query  361  RPSMGDVLWNLEFALQLQESAEESG  435
            RPSMGDVLW LE ALQ+Q   E+SG
Sbjct  769  RPSMGDVLWCLESALQIQ--VEKSG  791



>emb|CDP15747.1| unnamed protein product [Coffea canephora]
Length=839

 Score =   236 bits (601),  Expect = 9e-69, Method: Composition-based stats.
 Identities = 106/141 (75%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  638  VADFGLSKTGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  697

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LDQI D  L GK+ P   KKF ETA KC+A+ G D
Sbjct  698  ALNPVLPREQVNIAEWAMTWQKKGMLDQIMDSNLAGKVNPASLKKFGETAEKCLAEHGVD  757

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQL+E++
Sbjct  758  RPSMGDVLWNLEYALQLEETS  778



>ref|XP_009781981.1| PREDICTED: receptor-like protein kinase HERK 1 [Nicotiana sylvestris]
 ref|XP_009781988.1| PREDICTED: receptor-like protein kinase HERK 1 [Nicotiana sylvestris]
Length=838

 Score =   236 bits (601),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  637  VADFGLSKTGPELDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  696

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++P+LP+E V+LAEWA    KKG L+QI DP LKGKI P+  +KF ETA KC+AD G D
Sbjct  697  VIDPSLPREMVNLAEWAMKWQKKGQLEQIIDPNLKGKIRPDSLRKFGETAEKCLADFGVD  756

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQLQE+ 
Sbjct  757  RPSMGDVLWNLEYALQLQEAV  777



>emb|CAN77769.1| hypothetical protein VITISV_009237 [Vitis vinifera]
Length=802

 Score =   235 bits (600),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 104/140 (74%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP +D THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  601  VADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  660

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++PTLP+E V+LAEWA    K+G L+QI DP L GKI P+  +KF ETA KC++D G D
Sbjct  661  VIDPTLPREMVNLAEWAMKWQKRGQLEQIIDPNLVGKIRPDSLRKFGETAEKCLSDFGVD  720

Query  361  RPSMGDVLWNLEFALQLQES  420
            RPSMGD+LWNLE+ALQLQE+
Sbjct  721  RPSMGDILWNLEYALQLQEA  740



>ref|XP_006355856.1| PREDICTED: receptor-like protein kinase ANXUR1-like [Solanum 
tuberosum]
Length=931

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSKTGP ++  HVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  684  VSDFGLSKTGPNMNQGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  743

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNPT  KEQVSLA+WA  C +KG L+ I DP+LKGKI P C K FAETA KC+AD G D
Sbjct  744  ALNPTRSKEQVSLADWALACQRKGNLEDIIDPHLKGKINPACLKIFAETAEKCLADNGVD  803

Query  361  RPSMGDVLWNLEFALQLQES  420
            RPSMGDVLWNLE ALQL+++
Sbjct  804  RPSMGDVLWNLEHALQLEDN  823



>gb|KHN36785.1| Receptor-like protein kinase THESEUS 1 [Glycine soja]
Length=907

 Score =   236 bits (602),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 107/141 (76%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  641  VADFGLSKTGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  700

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LDQI D  L GK+ P   KKF ETA KC+A+ G D
Sbjct  701  ALNPVLPREQVNIAEWAMSWQKKGMLDQIMDQNLVGKVNPASLKKFGETAEKCLAEYGVD  760

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQLQE++
Sbjct  761  RPSMGDVLWNLEYALQLQETS  781



>ref|XP_009586639.1| PREDICTED: receptor-like protein kinase HERK 1 [Nicotiana tomentosiformis]
Length=838

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  637  VADFGLSKTGPELDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  696

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++P+LP+E V+LAEWA    KKG L+QI DP LKGKI P+  +KF ETA KC+AD G D
Sbjct  697  VIDPSLPREMVNLAEWAMKWQKKGQLEQIIDPNLKGKIRPDSLRKFGETAEKCLADFGVD  756

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQLQE+ 
Sbjct  757  RPSMGDVLWNLEYALQLQEAV  777



>ref|XP_010268798.1| PREDICTED: receptor-like protein kinase THESEUS 1 [Nelumbo nucifera]
 ref|XP_010268799.1| PREDICTED: receptor-like protein kinase THESEUS 1 [Nelumbo nucifera]
Length=846

 Score =   236 bits (601),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 106/141 (75%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E+LC RP
Sbjct  645  VADFGLSKTGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCTRP  704

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            ALNP LP+EQV++AEWA    KKG+LDQI DP L GK+ P   KKF ETA KC+A+ G D
Sbjct  705  ALNPVLPREQVNIAEWAMSWQKKGMLDQIMDPTLVGKVNPASLKKFGETAEKCLAEHGVD  764

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RP+MGDVLWNLE+ALQL+E++
Sbjct  765  RPTMGDVLWNLEYALQLEETS  785



>emb|CDX82981.1| BnaA01g19810D [Brassica napus]
Length=834

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            V+DFGLSKTGP LD THVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFE+LCARP
Sbjct  629  VADFGLSKTGPELDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARP  688

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
             ++PTLP+E V+LAEWA    KKG+LDQI D  L+G I P+  +KFAETA KC+AD G D
Sbjct  689  VIDPTLPREMVNLAEWAMKWQKKGLLDQIIDQSLRGNIRPDSLRKFAETAEKCLADYGVD  748

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPSMGDVLWNLE+ALQLQE+ 
Sbjct  749  RPSMGDVLWNLEYALQLQEAV  769



>ref|XP_002972798.1| hypothetical protein SELMODRAFT_15419, partial [Selaginella moellendorffii]
 gb|EFJ26019.1| hypothetical protein SELMODRAFT_15419, partial [Selaginella moellendorffii]
Length=262

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    VSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARP  180
            VSDFGLSK GP+LDHTHVST VKGSFGYLDPEYFRRQQLTEKSDVYSFGVVL E++CARP
Sbjct  122  VSDFGLSKVGPSLDHTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVVCARP  181

Query  181  ALNPTLPKEQVSLAEWAFHCHKKGILDQITDPYLKGKIAPECFKKFAETAVKCVADVGTD  360
            A+NP LP++QVS+AEWA H  K G L  I DP L G   PE  +KF E A +C+AD G++
Sbjct  182  AINPALPRDQVSIAEWALHWQKLGRLSNIMDPRLAGDCTPESLQKFGEIAERCLADRGSE  241

Query  361  RPSMGDVLWNLEFALQLQESA  423
            RPS+GDVLWNLE++LQL ++A
Sbjct  242  RPSIGDVLWNLEYSLQLHDAA  262



Lambda      K        H        a         alpha
   0.316    0.135    0.407    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090