BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS048C09

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006349668.1|  PREDICTED: uncharacterized protein LOC102584...    206   4e-58   Solanum tuberosum [potatoes]
ref|XP_006349669.1|  PREDICTED: uncharacterized protein LOC102584...    206   4e-58   
ref|XP_009796269.1|  PREDICTED: uncharacterized protein LOC104242...    202   7e-57   Nicotiana sylvestris
ref|XP_004247163.1|  PREDICTED: uncharacterized protein LOC101255...    202   9e-57   Solanum lycopersicum
ref|XP_009796267.1|  PREDICTED: uncharacterized protein LOC104242...    202   1e-56   Nicotiana sylvestris
ref|XP_009796266.1|  PREDICTED: uncharacterized protein LOC104242...    202   2e-56   Nicotiana sylvestris
ref|XP_009597515.1|  PREDICTED: uncharacterized protein LOC104093468    200   4e-56   Nicotiana tomentosiformis
ref|XP_011079848.1|  PREDICTED: uncharacterized protein LOC105163...    185   7e-51   Sesamum indicum [beniseed]
ref|XP_011079847.1|  PREDICTED: uncharacterized protein LOC105163...    185   7e-51   Sesamum indicum [beniseed]
gb|EYU46587.1|  hypothetical protein MIMGU_mgv1a0012281mg               185   1e-50   Erythranthe guttata [common monkey flower]
ref|XP_011079846.1|  PREDICTED: uncharacterized protein LOC105163...    186   1e-50   Sesamum indicum [beniseed]
gb|KDP21464.1|  hypothetical protein JCGZ_21935                         185   2e-50   Jatropha curcas
ref|XP_002275196.1|  PREDICTED: uncharacterized protein LOC100256371    178   8e-48   Vitis vinifera
emb|CDP03626.1|  unnamed protein product                                174   3e-46   Coffea canephora [robusta coffee]
ref|XP_006575072.1|  PREDICTED: uncharacterized protein LOC100785...    171   1e-45   Glycine max [soybeans]
ref|XP_003520208.1|  PREDICTED: uncharacterized protein LOC100785...    171   2e-45   Glycine max [soybeans]
ref|XP_007201215.1|  hypothetical protein PRUPE_ppa001060mg             169   9e-45   Prunus persica
ref|XP_010070220.1|  PREDICTED: uncharacterized protein LOC104457...    167   6e-44   Eucalyptus grandis [rose gum]
ref|XP_008235280.1|  PREDICTED: uncharacterized protein LOC103334119    167   8e-44   Prunus mume [ume]
ref|XP_010070219.1|  PREDICTED: uncharacterized protein LOC104457...    167   9e-44   Eucalyptus grandis [rose gum]
ref|XP_010090399.1|  Uncharacterized protein in xynA 3'region           166   1e-43   Morus notabilis
ref|XP_010684259.1|  PREDICTED: uncharacterized protein LOC104898847    166   1e-43   
ref|XP_002307580.2|  hypothetical protein POPTR_0005s23080g             166   1e-43   Populus trichocarpa [western balsam poplar]
ref|XP_010255949.1|  PREDICTED: uncharacterized protein LOC104596...    166   2e-43   Nelumbo nucifera [Indian lotus]
ref|XP_006444079.1|  hypothetical protein CICLE_v10023868mg             166   2e-43   Citrus clementina [clementine]
ref|XP_010255948.1|  PREDICTED: uncharacterized protein LOC104596...    166   2e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010255947.1|  PREDICTED: uncharacterized protein LOC104596...    166   2e-43   Nelumbo nucifera [Indian lotus]
ref|XP_008350069.1|  PREDICTED: uncharacterized protein LOC103413382    163   3e-43   
gb|KDO68745.1|  hypothetical protein CISIN_1g002437mg                   164   5e-43   Citrus sinensis [apfelsine]
ref|XP_008368936.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    163   5e-43   
ref|XP_008386504.1|  PREDICTED: uncharacterized protein LOC103449010    164   6e-43   
ref|XP_007144634.1|  hypothetical protein PHAVU_007G172000g             164   1e-42   Phaseolus vulgaris [French bean]
ref|XP_003590651.1|  GTP-binding protein engA                           161   6e-42   Medicago truncatula
ref|XP_002520749.1|  conserved hypothetical protein                     161   8e-42   Ricinus communis
ref|XP_011032720.1|  PREDICTED: uncharacterized protein LOC105131442    160   1e-41   Populus euphratica
gb|KHG12136.1|  hypothetical protein F383_07635                         160   2e-41   Gossypium arboreum [tree cotton]
ref|XP_007050625.1|  FZO-like                                           159   3e-41   
ref|XP_004495204.1|  PREDICTED: uncharacterized protein LOC101505...    159   3e-41   
ref|XP_004495203.1|  PREDICTED: uncharacterized protein LOC101505...    159   3e-41   Cicer arietinum [garbanzo]
ref|XP_008449445.1|  PREDICTED: uncharacterized protein LOC103491330    159   5e-41   Cucumis melo [Oriental melon]
ref|XP_003536908.1|  PREDICTED: uncharacterized protein LOC100808213    158   9e-41   Glycine max [soybeans]
ref|XP_004290657.1|  PREDICTED: uncharacterized protein LOC101291108    157   2e-40   Fragaria vesca subsp. vesca
ref|XP_009367692.1|  PREDICTED: uncharacterized protein LOC103957273    157   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_009355473.1|  PREDICTED: uncharacterized protein LOC103946491    157   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_004140223.1|  PREDICTED: uncharacterized protein LOC101213431    155   1e-39   Cucumis sativus [cucumbers]
ref|XP_004167583.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    155   1e-39   
gb|KJB23087.1|  hypothetical protein B456_004G080200                    154   2e-39   Gossypium raimondii
gb|KJB23088.1|  hypothetical protein B456_004G080200                    154   3e-39   Gossypium raimondii
ref|XP_008783174.1|  PREDICTED: uncharacterized protein LOC103702...    152   2e-38   Phoenix dactylifera
ref|XP_010927024.1|  PREDICTED: uncharacterized protein LOC105049...    147   5e-37   Elaeis guineensis
ref|XP_010927025.1|  PREDICTED: uncharacterized protein LOC105049...    147   7e-37   
ref|XP_010927023.1|  PREDICTED: uncharacterized protein LOC105049...    147   9e-37   Elaeis guineensis
gb|AAQ65198.1|  At1g03160                                               144   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001077452.1|  FZO-like protein                                   144   4e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AAD25810.1|AC006550_18  F10O3.1                                      144   5e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171815.3|  FZO-like protein                                      144   6e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006418260.1|  hypothetical protein EUTSA_v10006729mg             144   8e-36   Eutrema salsugineum [saltwater cress]
ref|XP_010474923.1|  PREDICTED: uncharacterized protein LOC104754...    143   1e-35   
ref|XP_010474922.1|  PREDICTED: uncharacterized protein LOC104754...    144   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006851107.1|  hypothetical protein AMTR_s00025p00248100          143   2e-35   
ref|XP_002889440.1|  hypothetical protein ARALYDRAFT_470295             142   3e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_009401044.1|  PREDICTED: uncharacterized protein LOC103985...    141   7e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010522727.1|  PREDICTED: uncharacterized protein LOC104801...    140   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_006306709.1|  hypothetical protein CARUB_v10008235mg             140   1e-34   Capsella rubella
ref|XP_009401043.1|  PREDICTED: uncharacterized protein LOC103985...    140   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010474935.1|  PREDICTED: uncharacterized protein LOC104754437    140   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_011026335.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    140   2e-34   Populus euphratica
ref|XP_010522715.1|  PREDICTED: uncharacterized protein LOC104801...    139   3e-34   Tarenaya hassleriana [spider flower]
ref|XP_010481655.1|  PREDICTED: uncharacterized protein LOC104760424    139   4e-34   Camelina sativa [gold-of-pleasure]
emb|CDX86689.1|  BnaC08g00140D                                          139   7e-34   
emb|CDY15452.1|  BnaA08g27360D                                          139   7e-34   Brassica napus [oilseed rape]
ref|XP_009111165.1|  PREDICTED: uncharacterized protein LOC103836629    138   8e-34   Brassica rapa
gb|EPS64568.1|  hypothetical protein M569_10214                         120   1e-30   Genlisea aurea
ref|XP_002300848.2|  hypothetical protein POPTR_0002s05420g             129   1e-30   
ref|XP_010233244.1|  PREDICTED: uncharacterized protein LOC100838168    126   2e-29   
gb|AFW77879.1|  hypothetical protein ZEAMMB73_997279                    124   7e-29   
ref|XP_008649599.1|  PREDICTED: uncharacterized protein LOC103630315    124   8e-29   Zea mays [maize]
ref|XP_004963794.1|  PREDICTED: uncharacterized protein LOC101755934    123   1e-28   
ref|XP_002439739.1|  hypothetical protein SORBIDRAFT_09g019290          122   3e-28   Sorghum bicolor [broomcorn]
gb|EAY97909.1|  hypothetical protein OsI_19825                          117   1e-26   Oryza sativa Indica Group [Indian rice]
gb|EEE63597.1|  hypothetical protein OsJ_18414                          117   2e-26   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK07723.1|  predicted protein                                      117   2e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002984373.1|  hypothetical protein SELMODRAFT_445893           96.7    2e-19   
ref|XP_002972797.1|  hypothetical protein SELMODRAFT_413416           96.7    3e-19   
gb|EAY97907.1|  hypothetical protein OsI_19823                        89.0    2e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_001774726.1|  predicted protein                                84.3    3e-15   
ref|XP_001780842.1|  predicted protein                                84.3    4e-15   
ref|NP_001055439.1|  Os05g0390100                                     79.7    1e-13   
ref|XP_005646142.1|  hypothetical protein COCSUDRAFT_30102            79.3    2e-13   Coccomyxa subellipsoidea C-169
gb|KHN18882.1|  Hypothetical protein glysoja_028251                   71.2    7e-11   Glycine soja [wild soybean]
ref|XP_003081806.1|  Mitofusin 1 GTPase, involved in mitochondril...  68.2    7e-10   
emb|CEF99507.1|  P-loop containing nucleoside triphosphate hydrolase  68.2    7e-10   Ostreococcus tauri
ref|XP_001420392.1|  predicted protein                                67.4    9e-10   Ostreococcus lucimarinus CCE9901
ref|XP_005845307.1|  hypothetical protein CHLNCDRAFT_137054           62.4    5e-08   Chlorella variabilis
ref|XP_001689811.1|  predicted protein                                61.6    7e-08   Chlamydomonas reinhardtii
ref|XP_002509117.1|  hypothetical protein MICPUN_62927                53.9    3e-05   Micromonas commoda



>ref|XP_006349668.1| PREDICTED: uncharacterized protein LOC102584745 isoform X1 [Solanum 
tuberosum]
Length=919

 Score =   206 bits (525),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 141/187 (75%), Gaps = 4/187 (2%)
 Frame = +3

Query  54   SVHSPSHWPFASPTPSHYSPPHFKPRLRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLF  233
            SV SP    F  P        HF+ R  C N SV +    NV LV NN  +P+Q PRTLF
Sbjct  10   SVRSPPCSLFTHPRSRQCF--HFRSRRHCANSSVYSP-VDNVKLVINNLNRPEQTPRTLF  66

Query  234  PGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggKLYEAA  413
            PGGFKRPEIKVPSLVL+LS ++V  +  V++EIDQA+SGRV + +LSGGG SGGKLYEAA
Sbjct  67   PGGFKRPEIKVPSLVLKLSCEDVLRDETVVNEIDQAISGRVDVVVLSGGGASGGKLYEAA  126

Query  414  CLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSES-VVLPLV  590
            CLLKSVI+ RAYLL+D RVDIAAAVNASGVLLSDQ LP IVARNTM+D+KSE  VVLPLV
Sbjct  127  CLLKSVIKGRAYLLIDGRVDIAAAVNASGVLLSDQDLPAIVARNTMMDSKSEELVVLPLV  186

Query  591  ARIEQTP  611
            AR  QTP
Sbjct  187  ARFVQTP  193



>ref|XP_006349669.1| PREDICTED: uncharacterized protein LOC102584745 isoform X2 [Solanum 
tuberosum]
Length=802

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 135/166 (81%), Gaps = 2/166 (1%)
 Frame = +3

Query  117  HFKPRLRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQ  296
            HF+ R  C N SV +    NV LV NN  +P+Q PRTLFPGGFKRPEIKVPSLVL+LS +
Sbjct  29   HFRSRRHCANSSVYSP-VDNVKLVINNLNRPEQTPRTLFPGGFKRPEIKVPSLVLKLSCE  87

Query  297  EVFDNRNVLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERAYLLVDERVDI  476
            +V  +  V++EIDQA+SGRV + +LSGGG SGGKLYEAACLLKSVI+ RAYLL+D RVDI
Sbjct  88   DVLRDETVVNEIDQAISGRVDVVVLSGGGASGGKLYEAACLLKSVIKGRAYLLIDGRVDI  147

Query  477  AAAVNASGVLLSDQGLPTIVARNTMLDTKSES-VVLPLVARIEQTP  611
            AAAVNASGVLLSDQ LP IVARNTM+D+KSE  VVLPLVAR  QTP
Sbjct  148  AAAVNASGVLLSDQDLPAIVARNTMMDSKSEELVVLPLVARFVQTP  193



>ref|XP_009796269.1| PREDICTED: uncharacterized protein LOC104242852 isoform X4 [Nicotiana 
sylvestris]
Length=716

 Score =   202 bits (513),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 137/166 (83%), Gaps = 3/166 (2%)
 Frame = +3

Query  117  HFKPRLRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQ  296
            HF  R R  N SV ++   NV LV NN  +P+Q PRTLFPGG+KRPEIKVPSLVL+LS +
Sbjct  29   HF--RRRRNNYSVYSSPGDNVKLVINNLNRPEQTPRTLFPGGYKRPEIKVPSLVLKLSCE  86

Query  297  EVFDNRNVLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERAYLLVDERVDI  476
            +V ++  V++EID+AVSGRV I +LSGGG SGGKLYEAACLLKSVI+ RAYLL+D RVDI
Sbjct  87   DVLEDETVINEIDRAVSGRVDIVVLSGGGASGGKLYEAACLLKSVIKGRAYLLIDGRVDI  146

Query  477  AAAVNASGVLLSDQGLPTIVARNTMLDTKSES-VVLPLVARIEQTP  611
            AAA++ASGVLLSDQ LP IVARNTM+D+KSE  VVLPLVARI QTP
Sbjct  147  AAAISASGVLLSDQDLPAIVARNTMMDSKSEELVVLPLVARIVQTP  192



>ref|XP_004247163.1| PREDICTED: uncharacterized protein LOC101255731 isoform X1 [Solanum 
lycopersicum]
Length=919

 Score =   202 bits (515),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 134/166 (81%), Gaps = 2/166 (1%)
 Frame = +3

Query  117  HFKPRLRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQ  296
            HF+ R  C N SV +    NV LV NN  +P+Q PRTLFPGGFKRPEIKVP LVL++S +
Sbjct  29   HFRSRRNCANSSVYSP-VDNVKLVINNVNRPEQTPRTLFPGGFKRPEIKVPGLVLKVSCE  87

Query  297  EVFDNRNVLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERAYLLVDERVDI  476
            +V  +  V++EIDQA+SGRV + +LSGGG SGGKLYEAACLLKS+I+  AYLL+D RVDI
Sbjct  88   DVLRDETVVNEIDQAISGRVDVVVLSGGGASGGKLYEAACLLKSIIKGMAYLLIDGRVDI  147

Query  477  AAAVNASGVLLSDQGLPTIVARNTMLDTKSES-VVLPLVARIEQTP  611
            AAAVNASGVLLSDQ LP IVARNTM+D+KSE  VVLPLVARI QTP
Sbjct  148  AAAVNASGVLLSDQDLPAIVARNTMMDSKSEDLVVLPLVARIVQTP  193



>ref|XP_009796267.1| PREDICTED: uncharacterized protein LOC104242852 isoform X2 [Nicotiana 
sylvestris]
Length=825

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 137/166 (83%), Gaps = 3/166 (2%)
 Frame = +3

Query  117  HFKPRLRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQ  296
            HF  R R  N SV ++   NV LV NN  +P+Q PRTLFPGG+KRPEIKVPSLVL+LS +
Sbjct  29   HF--RRRRNNYSVYSSPGDNVKLVINNLNRPEQTPRTLFPGGYKRPEIKVPSLVLKLSCE  86

Query  297  EVFDNRNVLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERAYLLVDERVDI  476
            +V ++  V++EID+AVSGRV I +LSGGG SGGKLYEAACLLKSVI+ RAYLL+D RVDI
Sbjct  87   DVLEDETVINEIDRAVSGRVDIVVLSGGGASGGKLYEAACLLKSVIKGRAYLLIDGRVDI  146

Query  477  AAAVNASGVLLSDQGLPTIVARNTMLDTKSES-VVLPLVARIEQTP  611
            AAA++ASGVLLSDQ LP IVARNTM+D+KSE  VVLPLVARI QTP
Sbjct  147  AAAISASGVLLSDQDLPAIVARNTMMDSKSEELVVLPLVARIVQTP  192



>ref|XP_009796266.1| PREDICTED: uncharacterized protein LOC104242852 isoform X1 [Nicotiana 
sylvestris]
Length=921

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 137/166 (83%), Gaps = 3/166 (2%)
 Frame = +3

Query  117  HFKPRLRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQ  296
            HF  R R  N SV ++   NV LV NN  +P+Q PRTLFPGG+KRPEIKVPSLVL+LS +
Sbjct  29   HF--RRRRNNYSVYSSPGDNVKLVINNLNRPEQTPRTLFPGGYKRPEIKVPSLVLKLSCE  86

Query  297  EVFDNRNVLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERAYLLVDERVDI  476
            +V ++  V++EID+AVSGRV I +LSGGG SGGKLYEAACLLKSVI+ RAYLL+D RVDI
Sbjct  87   DVLEDETVINEIDRAVSGRVDIVVLSGGGASGGKLYEAACLLKSVIKGRAYLLIDGRVDI  146

Query  477  AAAVNASGVLLSDQGLPTIVARNTMLDTKSES-VVLPLVARIEQTP  611
            AAA++ASGVLLSDQ LP IVARNTM+D+KSE  VVLPLVARI QTP
Sbjct  147  AAAISASGVLLSDQDLPAIVARNTMMDSKSEELVVLPLVARIVQTP  192



>ref|XP_009597515.1| PREDICTED: uncharacterized protein LOC104093468 [Nicotiana tomentosiformis]
Length=722

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 138/174 (79%), Gaps = 3/174 (2%)
 Frame = +3

Query  90   PTPSHYSPPHFKPRLRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVP  269
            P P+     HF  R    N SV ++ R NV LV NN  +P+Q PRTLFPGG+KRPEIKVP
Sbjct  20   PHPTRRQCLHFWRRR--NNYSVYSSARVNVKLVINNLNRPEQTPRTLFPGGYKRPEIKVP  77

Query  270  SLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERAY  449
            SLVL+LS ++  ++  V++EID+AVSGRV I +LSGGG SGGKLYEAACLLKSVI+ RAY
Sbjct  78   SLVLKLSCEDALEDETVINEIDRAVSGRVDIVVLSGGGASGGKLYEAACLLKSVIKGRAY  137

Query  450  LLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSES-VVLPLVARIEQT  608
            LL+D RVDIAAA++ASGVLLSDQ LP IVARNTM+D+KSE  VVLPLVARI QT
Sbjct  138  LLIDGRVDIAAAISASGVLLSDQDLPAIVARNTMMDSKSEELVVLPLVARIVQT  191



>ref|XP_011079848.1| PREDICTED: uncharacterized protein LOC105163260 isoform X3 [Sesamum 
indicum]
Length=738

 Score =   185 bits (469),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 119/131 (91%), Gaps = 1/131 (1%)
 Frame = +3

Query  219  PRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAVSGRvgiellsgggvsgg  395
            PR+LFPGG+KRPEIKVP+LVL+LS+ +VF D++ VLD ID+AVS RVGI +L+GG  SG 
Sbjct  66   PRSLFPGGYKRPEIKVPNLVLRLSSDDVFRDDKAVLDVIDEAVSDRVGIVVLTGGEGSGK  125

Query  396  KLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  575
            KLYEAACLLKSVIR+RAYLL+DERVDIAAAVNASGVLLSDQGLPTIVARNTM+D K++SV
Sbjct  126  KLYEAACLLKSVIRDRAYLLIDERVDIAAAVNASGVLLSDQGLPTIVARNTMMDAKTDSV  185

Query  576  VLPLVARIEQT  608
            +LPLVAR  QT
Sbjct  186  ILPLVARNVQT  196



>ref|XP_011079847.1| PREDICTED: uncharacterized protein LOC105163260 isoform X2 [Sesamum 
indicum]
Length=738

 Score =   185 bits (469),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 119/131 (91%), Gaps = 1/131 (1%)
 Frame = +3

Query  219  PRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAVSGRvgiellsgggvsgg  395
            PR+LFPGG+KRPEIKVP+LVL+LS+ +VF D++ VLD ID+AVS RVGI +L+GG  SG 
Sbjct  66   PRSLFPGGYKRPEIKVPNLVLRLSSDDVFRDDKAVLDVIDEAVSDRVGIVVLTGGEGSGK  125

Query  396  KLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  575
            KLYEAACLLKSVIR+RAYLL+DERVDIAAAVNASGVLLSDQGLPTIVARNTM+D K++SV
Sbjct  126  KLYEAACLLKSVIRDRAYLLIDERVDIAAAVNASGVLLSDQGLPTIVARNTMMDAKTDSV  185

Query  576  VLPLVARIEQT  608
            +LPLVAR  QT
Sbjct  186  ILPLVARNVQT  196



>gb|EYU46587.1| hypothetical protein MIMGU_mgv1a0012281mg, partial [Erythranthe 
guttata]
Length=860

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 118/131 (90%), Gaps = 1/131 (1%)
 Frame = +3

Query  219  PRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAVSGRvgiellsgggvsgg  395
            PR+LFPGG+KRPEIKVP+++L+LS+ +V  D+R +LD +D AVSGRVGI LL+GG  SG 
Sbjct  3    PRSLFPGGYKRPEIKVPNIILRLSSDDVLRDDRAILDAVDDAVSGRVGIVLLTGGEGSGK  62

Query  396  KLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  575
            KLYEAACLLKSVIR+RAYLL+DERVDIAAAVNASGVLLSDQGLPTIVARNTM+D K++SV
Sbjct  63   KLYEAACLLKSVIRDRAYLLIDERVDIAAAVNASGVLLSDQGLPTIVARNTMMDAKTDSV  122

Query  576  VLPLVARIEQT  608
            +LPLVAR  QT
Sbjct  123  ILPLVARNVQT  133



>ref|XP_011079846.1| PREDICTED: uncharacterized protein LOC105163260 isoform X1 [Sesamum 
indicum]
Length=921

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 119/131 (91%), Gaps = 1/131 (1%)
 Frame = +3

Query  219  PRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAVSGRvgiellsgggvsgg  395
            PR+LFPGG+KRPEIKVP+LVL+LS+ +VF D++ VLD ID+AVS RVGI +L+GG  SG 
Sbjct  66   PRSLFPGGYKRPEIKVPNLVLRLSSDDVFRDDKAVLDVIDEAVSDRVGIVVLTGGEGSGK  125

Query  396  KLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  575
            KLYEAACLLKSVIR+RAYLL+DERVDIAAAVNASGVLLSDQGLPTIVARNTM+D K++SV
Sbjct  126  KLYEAACLLKSVIRDRAYLLIDERVDIAAAVNASGVLLSDQGLPTIVARNTMMDAKTDSV  185

Query  576  VLPLVARIEQT  608
            +LPLVAR  QT
Sbjct  186  ILPLVARNVQT  196



>gb|KDP21464.1| hypothetical protein JCGZ_21935 [Jatropha curcas]
Length=920

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 135/194 (70%), Gaps = 12/194 (6%)
 Frame = +3

Query  42   LSCCSVHSPSHW-----PFASPTPSHYSPPHFKPRLRCTNISVRAADRSNVSLVFNNEEQ  206
            L C    +PS +     PF +P P   SPPH   R    ++S     RS       N++ 
Sbjct  4    LLCFRTSTPSLYLSPLFPFFTPLPRFKSPPHRTHRFPILSLSNDPFQRSI------NQDS  57

Query  207  PKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggv  386
            P Q PRTLFPGG+KRPEIKVP++VLQL + +V    +VLD ID+AV   VGI +L+ G  
Sbjct  58   PTQ-PRTLFPGGYKRPEIKVPNIVLQLESDDVLPRGDVLDFIDKAVVKWVGIVVLNCGDG  116

Query  387  sggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKS  566
            SG  LYEAACLLKSVIR+RAYLL+ ERVD+AAAVNASGV+LSDQGLP IVARN M+D+KS
Sbjct  117  SGKALYEAACLLKSVIRDRAYLLIGERVDVAAAVNASGVVLSDQGLPAIVARNMMMDSKS  176

Query  567  ESVVLPLVARIEQT  608
            ESVVLPLVAR  QT
Sbjct  177  ESVVLPLVARNVQT  190



>ref|XP_002275196.1| PREDICTED: uncharacterized protein LOC100256371 [Vitis vinifera]
 emb|CBI32337.3| unnamed protein product [Vitis vinifera]
Length=926

 Score =   178 bits (451),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 124/152 (82%), Gaps = 5/152 (3%)
 Frame = +3

Query  168  RSNVSLV--FNNEEQP---KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEI  332
            RS +S+V   NN   P    +QPRT++PGG+KRPEI+VPSLVLQLS  EV D   VLD +
Sbjct  46   RSRLSIVSIANNSIPPTSQNKQPRTVYPGGYKRPEIRVPSLVLQLSVDEVLDRAGVLDVV  105

Query  333  DQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLS  512
            D+AVS  VG+ +L GG  SGG+LYEAACLLKSV+RERAYL+V ERVDIAAAVNA+GV+LS
Sbjct  106  DEAVSKWVGVVVLDGGDGSGGRLYEAACLLKSVVRERAYLMVAERVDIAAAVNANGVVLS  165

Query  513  DQGLPTIVARNTMLDTKSESVVLPLVARIEQT  608
            D+GLP IVARNTM+D++SESV+LPLVAR  QT
Sbjct  166  DKGLPAIVARNTMMDSRSESVILPLVARNVQT  197



>emb|CDP03626.1| unnamed protein product [Coffea canephora]
Length=931

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 116/139 (83%), Gaps = 5/139 (4%)
 Frame = +3

Query  210  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFD---NRNVLDEIDQAVSGRvgiellsgg  380
            +QQPRTLFPGG+KRPEI+VP++VL LS+ EVF+    R VLD +D+A++  V   ++  G
Sbjct  66   QQQPRTLFPGGYKRPEIRVPNVVLLLSSHEVFEEDKTRGVLDVLDKAIASSVVGIVVLRG  125

Query  381  gvsggK--LYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTML  554
            G + G   LYEAAC+LKSVI++RAYLL++ERVDIAAAVNASGVLLSDQGLP IVARNTM+
Sbjct  126  GGARGGKLLYEAACVLKSVIKDRAYLLIEERVDIAAAVNASGVLLSDQGLPAIVARNTMI  185

Query  555  DTKSESVVLPLVARIEQTP  611
            D+KSESVVLPLVAR  +TP
Sbjct  186  DSKSESVVLPLVARTVETP  204



>ref|XP_006575072.1| PREDICTED: uncharacterized protein LOC100785233 isoform X2 [Glycine 
max]
Length=869

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 131/191 (69%), Gaps = 6/191 (3%)
 Frame = +3

Query  51   CSVHSPSHWPFASPTPSH--YSPPHFKPRLRCTNISVRAADRSNVSLVFNNEEQPKQ--Q  218
            CSV SPS  PF +  P H  +S     P  R     + +    + S       +P+   Q
Sbjct  4    CSVTSPSS-PFTAIIPRHTFFSRSSSLPLRRARAFPINSLSNGSSSQFNQQLFRPRDPPQ  62

Query  219  PRTLFPGGFKRPEIKVPSLVLQLSTQEVFD-NRNVLDEIDQAVSGRvgiellsgggvsgg  395
            PRTLFPGG+KRPE+KVP+LVLQL   EV   + + L  ID+AVS  VGI +L+    SGG
Sbjct  63   PRTLFPGGYKRPELKVPTLVLQLDPAEVLSADTDALALIDRAVSKWVGIVVLASNEASGG  122

Query  396  KLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  575
            KLYEAAC LKS+I++RAYLLV ERVDIAAA  ASGVLLSDQGLPT+VARNTMLD+KSE V
Sbjct  123  KLYEAACSLKSLIQDRAYLLVAERVDIAAATAASGVLLSDQGLPTVVARNTMLDSKSELV  182

Query  576  VLPLVARIEQT  608
            VLPLVARI QT
Sbjct  183  VLPLVARIVQT  193



>ref|XP_003520208.1| PREDICTED: uncharacterized protein LOC100785233 isoform X1 [Glycine 
max]
Length=914

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 131/191 (69%), Gaps = 6/191 (3%)
 Frame = +3

Query  51   CSVHSPSHWPFASPTPSH--YSPPHFKPRLRCTNISVRAADRSNVSLVFNNEEQPKQ--Q  218
            CSV SPS  PF +  P H  +S     P  R     + +    + S       +P+   Q
Sbjct  4    CSVTSPSS-PFTAIIPRHTFFSRSSSLPLRRARAFPINSLSNGSSSQFNQQLFRPRDPPQ  62

Query  219  PRTLFPGGFKRPEIKVPSLVLQLSTQEVFD-NRNVLDEIDQAVSGRvgiellsgggvsgg  395
            PRTLFPGG+KRPE+KVP+LVLQL   EV   + + L  ID+AVS  VGI +L+    SGG
Sbjct  63   PRTLFPGGYKRPELKVPTLVLQLDPAEVLSADTDALALIDRAVSKWVGIVVLASNEASGG  122

Query  396  KLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  575
            KLYEAAC LKS+I++RAYLLV ERVDIAAA  ASGVLLSDQGLPT+VARNTMLD+KSE V
Sbjct  123  KLYEAACSLKSLIQDRAYLLVAERVDIAAATAASGVLLSDQGLPTVVARNTMLDSKSELV  182

Query  576  VLPLVARIEQT  608
            VLPLVARI QT
Sbjct  183  VLPLVARIVQT  193



>ref|XP_007201215.1| hypothetical protein PRUPE_ppa001060mg [Prunus persica]
 gb|EMJ02414.1| hypothetical protein PRUPE_ppa001060mg [Prunus persica]
Length=921

 Score =   169 bits (429),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 130/191 (68%), Gaps = 6/191 (3%)
 Frame = +3

Query  42   LSCCSVHSPSHWPFA---SPTP---SHYSPPHFKPRLRCTNISVRAADRSNVSLVFNNEE  203
            +S  S H+ +  P     S TP   +H S    +P  R   +    +  SN     N + 
Sbjct  2    VSLLSFHTSATQPLLLTPSSTPFLHTHLSRIKSQPSRRTRFLISSISQNSNQFTNQNPQT  61

Query  204  QPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsggg  383
             PK+ PRT FPGGFKRPEIKVP++VLQL   +V    + LD ID+AVS  VGI +L+G  
Sbjct  62   PPKKPPRTQFPGGFKRPEIKVPNIVLQLDPDDVLVGDDALDLIDKAVSKWVGILVLNGRE  121

Query  384  vsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTK  563
             SGG+LYEAAC LKSV+R+RAYLL+ ERVDIAAA NASGVLLSDQGLPTIVAR TM+ +K
Sbjct  122  ASGGRLYEAACKLKSVVRDRAYLLISERVDIAAAANASGVLLSDQGLPTIVARGTMMASK  181

Query  564  SESVVLPLVAR  596
            SESV+LPLVAR
Sbjct  182  SESVILPLVAR  192



>ref|XP_010070220.1| PREDICTED: uncharacterized protein LOC104457004 isoform X2 [Eucalyptus 
grandis]
Length=861

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 109/136 (80%), Gaps = 9/136 (7%)
 Frame = +3

Query  216  QPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNV---------LDEIDQAVSGRvgiel  368
            QPRTLFPGG+KRPEIKVP+LVLQL   +V D  +          LD ID+AVSGRVGI +
Sbjct  69   QPRTLFPGGYKRPEIKVPTLVLQLDPDDVLDGSSASAAAAAAAALDSIDEAVSGRVGIVV  128

Query  369  lsgggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNT  548
            L GG  +G +LYEAACLLKSV+R+RAYLL+ ERVDI +A+NASGVLLSDQGLP IVAR+ 
Sbjct  129  LGGGEGTGKRLYEAACLLKSVVRDRAYLLIAERVDIVSAINASGVLLSDQGLPAIVARSM  188

Query  549  MLDTKSESVVLPLVAR  596
            M D++SESVVLPLVAR
Sbjct  189  MADSRSESVVLPLVAR  204



>ref|XP_008235280.1| PREDICTED: uncharacterized protein LOC103334119 [Prunus mume]
Length=921

 Score =   167 bits (422),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 127/178 (71%), Gaps = 3/178 (2%)
 Frame = +3

Query  63   SPSHWPFASPTPSHYSPPHFKPRLRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGG  242
            +PS  PF     +H S    +P  R   +    +  SN S   N +  PKQ PRT FPGG
Sbjct  18   TPSSTPFLH---THLSRIKSQPSRRTQFLISSISQNSNQSTNQNPQTPPKQPPRTQFPGG  74

Query  243  FKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggKLYEAACLL  422
            FKRPEIKVP++VLQL   +V    + LD ID+AVS  VGI +L+G   SGG+LYEAAC L
Sbjct  75   FKRPEIKVPNIVLQLDPDDVLVGDDALDLIDKAVSKWVGILVLNGREASGGRLYEAACKL  134

Query  423  KSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVAR  596
            KSV+R+RAYLL+ ERVDIAAA NASGVLLSDQGLPTIVAR+TM+ +KS+SV+LPLVAR
Sbjct  135  KSVVRDRAYLLISERVDIAAAANASGVLLSDQGLPTIVARSTMMASKSDSVILPLVAR  192



>ref|XP_010070219.1| PREDICTED: uncharacterized protein LOC104457004 isoform X1 [Eucalyptus 
grandis]
Length=938

 Score =   167 bits (422),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 109/136 (80%), Gaps = 9/136 (7%)
 Frame = +3

Query  216  QPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNV---------LDEIDQAVSGRvgiel  368
            QPRTLFPGG+KRPEIKVP+LVLQL   +V D  +          LD ID+AVSGRVGI +
Sbjct  69   QPRTLFPGGYKRPEIKVPTLVLQLDPDDVLDGSSASAAAAAAAALDSIDEAVSGRVGIVV  128

Query  369  lsgggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNT  548
            L GG  +G +LYEAACLLKSV+R+RAYLL+ ERVDI +A+NASGVLLSDQGLP IVAR+ 
Sbjct  129  LGGGEGTGKRLYEAACLLKSVVRDRAYLLIAERVDIVSAINASGVLLSDQGLPAIVARSM  188

Query  549  MLDTKSESVVLPLVAR  596
            M D++SESVVLPLVAR
Sbjct  189  MADSRSESVVLPLVAR  204



>ref|XP_010090399.1| Uncharacterized protein in xynA 3'region [Morus notabilis]
 gb|EXB39369.1| Uncharacterized protein in xynA 3'region [Morus notabilis]
Length=926

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 130/193 (67%), Gaps = 10/193 (5%)
 Frame = +3

Query  48   CCSVHSPSHWPFASPTPSHYSPPHFKPRL--RCTNISVRAADRSNVSLVFNNEEQPKQQ-  218
              + H P  +    P   H S    KP L  R   + VR+  ++     F N+  P+ Q 
Sbjct  9    ASTTHHPLFFTLTPPLQLHTS--RLKPCLLRRPPRLPVRSISQNGSQ--FANQSSPELQG  64

Query  219  ---PRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvs  389
               PRT+FPGG+KRPEI+VP LVLQL   EV      LD +D+AVS   GI +L+GG  +
Sbjct  65   QGPPRTVFPGGYKRPEIRVPCLVLQLDADEVLAGDGALDLVDRAVSKWTGIVVLNGGEAT  124

Query  390  ggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  569
            GG++YEAAC LKSV+R+RAYLLV ERVDIAAA NASGV+LSDQGLP IVAR+TM+D+KS+
Sbjct  125  GGRIYEAACKLKSVVRDRAYLLVAERVDIAAAANASGVVLSDQGLPAIVARSTMMDSKSD  184

Query  570  SVVLPLVARIEQT  608
            SVVLPLVAR  QT
Sbjct  185  SVVLPLVARNVQT  197



>ref|XP_010684259.1| PREDICTED: uncharacterized protein LOC104898847 [Beta vulgaris 
subsp. vulgaris]
Length=930

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 131/185 (71%), Gaps = 14/185 (8%)
 Frame = +3

Query  90   PTPSHYSPPHFKPR------LRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKR  251
            PT  HY PP F+P+      L  ++   +     N ++ F+       QPRTLFPGG+KR
Sbjct  24   PTFPHY-PPKFRPQHPQQHPLPHSHHFTKTKSAQNDAM-FDAYIPQNSQPRTLFPGGYKR  81

Query  252  PEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAVSGRvgiellsgggvsgg-----KLYEAA  413
            PEIK+P++VLQLS  ++  D   VLD +D AV+ RVG+ +++GG  S       +LYEAA
Sbjct  82   PEIKIPNIVLQLSAAQILSDTSFVLDFVDSAVAKRVGVVVVNGGEGSSSNSGGGQLYEAA  141

Query  414  CLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVA  593
            CLLKSVIR+RAYLLV ERVDIAAAVNASGVLLSDQGLP IVARNT++ +KSESVVLP+V 
Sbjct  142  CLLKSVIRDRAYLLVAERVDIAAAVNASGVLLSDQGLPPIVARNTLMSSKSESVVLPVVG  201

Query  594  RIEQT  608
            +I QT
Sbjct  202  KIVQT  206



>ref|XP_002307580.2| hypothetical protein POPTR_0005s23080g [Populus trichocarpa]
 gb|EEE94576.2| hypothetical protein POPTR_0005s23080g [Populus trichocarpa]
Length=926

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 131/200 (66%), Gaps = 17/200 (9%)
 Frame = +3

Query  48   CCSVHSP------SHW--PFASPTPSHYSPPHFKPRLRCTNISVRAADRSNVSLVFNNEE  203
              S+HSP      +H+    ++P P   SPPH     R  +  + +   +       N+ 
Sbjct  4    LLSLHSPKPSLFLTHFLPHLSTPLPRFKSPPH-----RTHHFPIHSFPNNQQQQQPANQN  58

Query  204  QPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAVS---GRvgiell  371
               QQPRTLFPGG+KRPEIKVP++VLQL  ++V       LD ID+AVS   G V +   
Sbjct  59   LSNQQPRTLFPGGYKRPEIKVPNIVLQLDPEDVIRGGSEALDLIDKAVSKSVGIVILNGS  118

Query  372  sgggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTM  551
             GGG SG  LYEAACL+ SV+R+RAYLL+ ERVDIA AVNASGV+LSDQGLP +VARN M
Sbjct  119  IGGGGSGKSLYEAACLVNSVVRDRAYLLIGERVDIATAVNASGVVLSDQGLPALVARNMM  178

Query  552  LDTKSESVVLPLVARIEQTP  611
            + +++ESVVLPLVARI QTP
Sbjct  179  MGSRTESVVLPLVARIVQTP  198



>ref|XP_010255949.1| PREDICTED: uncharacterized protein LOC104596469 isoform X3 [Nelumbo 
nucifera]
Length=915

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +3

Query  219  PRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggK  398
            PRTLFPGGFKRPEIKVP++VLQL + EV     VLD ID AVS  VGI +L+    SGG+
Sbjct  131  PRTLFPGGFKRPEIKVPTVVLQLKSDEVLRREGVLDSIDAAVSKWVGIVVLNDADGSGGR  190

Query  399  LYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  578
            LYEAA LLKSVIR+RAYLL+ ERVDIAAAV+ASGVLLSDQGLP IVARN M+ +KS+SVV
Sbjct  191  LYEAARLLKSVIRDRAYLLIAERVDIAAAVSASGVLLSDQGLPAIVARNMMMQSKSDSVV  250

Query  579  LPLVARIEQT  608
            LPLVAR  QT
Sbjct  251  LPLVARNVQT  260



>ref|XP_006444079.1| hypothetical protein CICLE_v10023868mg [Citrus clementina]
 ref|XP_006479727.1| PREDICTED: uncharacterized protein LOC102616592 [Citrus sinensis]
 gb|ESR57319.1| hypothetical protein CICLE_v10023868mg [Citrus clementina]
Length=921

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 129/192 (67%), Gaps = 16/192 (8%)
 Frame = +3

Query  72   HWPFASPTPSHYSPPHF-----KPRLRCTNISVRAADRSNVSLVFNNEE--------QPK  212
            H P   P P   S P+F     KP    T+  +++    N    F +E+        + +
Sbjct  9    HAPTRVPAPRFLSDPYFPIPRFKPPRHRTHFPIKSISNDNS---FRSEDSAAAPVISEKQ  65

Query  213  QQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsg  392
            Q+PRTL+PGG+KRPEIKVP++VLQL   +V    + LD ID+AV+  VGI +L+GG  SG
Sbjct  66   QRPRTLYPGGYKRPEIKVPNVVLQLEPHQVLAGGDALDLIDEAVAKFVGIVVLNGGEASG  125

Query  393  gKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSES  572
              +YEAACLLKSV+++RA  L+ ERVDIAAAVNASGVLLSDQGLP IVARNTM D+ SES
Sbjct  126  KSVYEAACLLKSVVKDRALFLIAERVDIAAAVNASGVLLSDQGLPAIVARNTMKDSMSES  185

Query  573  VVLPLVARIEQT  608
            VVLPLV R  QT
Sbjct  186  VVLPLVGRNVQT  197



>ref|XP_010255948.1| PREDICTED: uncharacterized protein LOC104596469 isoform X2 [Nelumbo 
nucifera]
Length=991

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +3

Query  219  PRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggK  398
            PRTLFPGGFKRPEIKVP++VLQL + EV     VLD ID AVS  VGI +L+    SGG+
Sbjct  131  PRTLFPGGFKRPEIKVPTVVLQLKSDEVLRREGVLDSIDAAVSKWVGIVVLNDADGSGGR  190

Query  399  LYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  578
            LYEAA LLKSVIR+RAYLL+ ERVDIAAAV+ASGVLLSDQGLP IVARN M+ +KS+SVV
Sbjct  191  LYEAARLLKSVIRDRAYLLIAERVDIAAAVSASGVLLSDQGLPAIVARNMMMQSKSDSVV  250

Query  579  LPLVARIEQT  608
            LPLVAR  QT
Sbjct  251  LPLVARNVQT  260



>ref|XP_010255947.1| PREDICTED: uncharacterized protein LOC104596469 isoform X1 [Nelumbo 
nucifera]
Length=992

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +3

Query  219  PRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggK  398
            PRTLFPGGFKRPEIKVP++VLQL + EV     VLD ID AVS  VGI +L+    SGG+
Sbjct  131  PRTLFPGGFKRPEIKVPTVVLQLKSDEVLRREGVLDSIDAAVSKWVGIVVLNDADGSGGR  190

Query  399  LYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  578
            LYEAA LLKSVIR+RAYLL+ ERVDIAAAV+ASGVLLSDQGLP IVARN M+ +KS+SVV
Sbjct  191  LYEAARLLKSVIRDRAYLLIAERVDIAAAVSASGVLLSDQGLPAIVARNMMMQSKSDSVV  250

Query  579  LPLVARIEQT  608
            LPLVAR  QT
Sbjct  251  LPLVARNVQT  260



>ref|XP_008350069.1| PREDICTED: uncharacterized protein LOC103413382 [Malus domestica]
Length=668

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 126/181 (70%), Gaps = 9/181 (5%)
 Frame = +3

Query  66   PSHWPFASPTPSHYSPPHFKPRLRCTNISVRAADRSNVSLVFNNEEQPKQQP-RTLFPGG  242
            PS  P  S T +H  PP      R T   + +  +++      N + P+ QP RT FPGG
Sbjct  23   PSLQPHLSRTKAH--PP------RRTQFFISSISQNSHRFTSQNPQPPEAQPPRTQFPGG  74

Query  243  FKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggKLYEAACLL  422
            FKRPE++VP++VLQL   EV    + LD +D+AVS  VG+  L+G   SGG+LYEAAC L
Sbjct  75   FKRPEVRVPNVVLQLDPDEVLAGEDALDLVDKAVSKWVGVLXLNGRDSSGGRLYEAACKL  134

Query  423  KSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVARIE  602
            KSVIR+RAYLL+ ERVDIAAA NASGVLLSDQGLPTIVAR+TM+ +KS+ VVLPLVAR  
Sbjct  135  KSVIRDRAYLLISERVDIAAAANASGVLLSDQGLPTIVARSTMMASKSDLVVLPLVARYV  194

Query  603  Q  605
            Q
Sbjct  195  Q  195



>gb|KDO68745.1| hypothetical protein CISIN_1g002437mg [Citrus sinensis]
Length=921

 Score =   164 bits (416),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 131/193 (68%), Gaps = 14/193 (7%)
 Frame = +3

Query  60   HSPSHWP---FAS----PTPSHYSPPH---FKPRLRCTNISVRAADRSNVSLVFNNEEQP  209
            H+P+  P   F S    P P    PPH   F  +    + S R+ D +   ++     + 
Sbjct  9    HAPTRVPAPRFLSDPYFPIPRFKPPPHRTHFPIKSISNDNSFRSEDSAAAPVI----SEK  64

Query  210  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvs  389
            +Q+PRTL+PGG+KRPEIKVP++VLQL   +V    + LD ID+AV+  VGI +L+GG  S
Sbjct  65   QQRPRTLYPGGYKRPEIKVPNVVLQLEPHQVLAGGDALDLIDEAVAKFVGIVVLNGGEAS  124

Query  390  ggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  569
            G  +YEAACLLKSV+++RA  L+ ERVDIAAAVNASGVLLSDQGLP IVARNTM D+ SE
Sbjct  125  GKSVYEAACLLKSVVKDRALFLIAERVDIAAAVNASGVLLSDQGLPAIVARNTMKDSMSE  184

Query  570  SVVLPLVARIEQT  608
            SVVLPLV R  QT
Sbjct  185  SVVLPLVGRNVQT  197



>ref|XP_008368936.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103432519 
[Malus domestica]
Length=737

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 126/182 (69%), Gaps = 12/182 (7%)
 Frame = +3

Query  63   SPSHWPFASPTPSHYSPPHFKPRLRCTNISVRAADRSNVSLVFNNEEQPKQQP-RTLFPG  239
            SPS  P  S T +H  PP      R T   + +  +++      N + P+  P RT FPG
Sbjct  22   SPSLQPHLSRTKAH--PP------RRTQFIISSISQNSHRFTSQNPQPPQAHPPRTQFPG  73

Query  240  GFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggKLYEAACL  419
            GFKRPE++VP++VLQL   EV    + LD +D+AVS    + +L+G   SGG+LYEAAC 
Sbjct  74   GFKRPEVRVPNVVLQLDPDEVLAGEDALDLVDKAVS---XVLMLNGRDSSGGRLYEAACK  130

Query  420  LKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVARI  599
            LKSVIR+RAYLL+ ERVDIAAA NASGVLLSDQGLPTIVAR+TM+ +KS+SVVLPLVAR 
Sbjct  131  LKSVIRDRAYLLISERVDIAAAANASGVLLSDQGLPTIVARSTMMASKSDSVVLPLVARY  190

Query  600  EQ  605
             Q
Sbjct  191  VQ  192



>ref|XP_008386504.1| PREDICTED: uncharacterized protein LOC103449010 [Malus domestica]
Length=918

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 128/182 (70%), Gaps = 9/182 (5%)
 Frame = +3

Query  63   SPSHWPFASPTPSHYSPPHFKPRLRCTNISVRAADRSNVSLVFNNEEQPKQQP-RTLFPG  239
            +PS  P  S T +H  PP      R T   + +  +++      N + P+ QP RT FPG
Sbjct  22   TPSLQPHLSRTKAH--PP------RRTQFFISSISQNSHRFTSQNPQPPEAQPPRTQFPG  73

Query  240  GFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggKLYEAACL  419
            GFKRPE++VP++VLQL   EV    + LD +D+AVS  VG+ +L+G   SGG+LYEAAC 
Sbjct  74   GFKRPEVRVPNVVLQLDPDEVLAGEDALDLVDKAVSKWVGVLVLNGRDSSGGRLYEAACK  133

Query  420  LKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVARI  599
            LKSVIR+RAYLL+ ERVDIAAA NASGVLLSDQGLPTIVAR+TM+ +KS+ VVLPLVAR 
Sbjct  134  LKSVIRDRAYLLISERVDIAAAANASGVLLSDQGLPTIVARSTMMASKSDLVVLPLVARY  193

Query  600  EQ  605
             Q
Sbjct  194  VQ  195



>ref|XP_007144634.1| hypothetical protein PHAVU_007G172000g [Phaseolus vulgaris]
 gb|ESW16628.1| hypothetical protein PHAVU_007G172000g [Phaseolus vulgaris]
Length=914

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 132/192 (69%), Gaps = 7/192 (4%)
 Frame = +3

Query  51   CSVHSPSHWPFASPTPSH--YSPPHFKPRLRCTNISVRAADRSNVSLVFNNEE-QPKQ--  215
            CSV +PS    A+  P H  +S P   P LR +  S   +  +  S  FN++   P    
Sbjct  4    CSVTAPSSSLVAAIIPRHTSFSRPSSLP-LRFSRASPVNSLSNGSSAAFNSQLFSPNDPP  62

Query  216  QPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRN-VLDEIDQAVSGRvgiellsgggvsg  392
            QPRTLFPGG+KRPE+KVP+LVLQL + EV    N     ID+AVS  VGI LLS    SG
Sbjct  63   QPRTLFPGGYKRPELKVPTLVLQLDSDEVLAADNHAFALIDKAVSKWVGIVLLSSKEPSG  122

Query  393  gKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSES  572
            GKLYEAAC LKS++++RAYLLV ERVDIAAA   SGVLLSDQGLPT+VAR+TMLD+KSE 
Sbjct  123  GKLYEAACSLKSLLQDRAYLLVAERVDIAAAAACSGVLLSDQGLPTVVARSTMLDSKSEL  182

Query  573  VVLPLVARIEQT  608
            VVLPLVARI  T
Sbjct  183  VVLPLVARIVHT  194



>ref|XP_003590651.1| GTP-binding protein engA [Medicago truncatula]
 gb|AES60902.1| FZO-like protein [Medicago truncatula]
Length=914

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 123/186 (66%), Gaps = 30/186 (16%)
 Frame = +3

Query  72   HWPF-----ASPTPSHYSPPHFKPRLRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFP  236
            H PF     +SP  S+ +  HF P+                        Q + QPRTLFP
Sbjct  34   HLPFRRTLHSSPITSNNASRHFFPK-----------------------TQAQAQPRTLFP  70

Query  237  GGFKRPEIKVPSLVLQLSTQEVFD-NRNVLDEIDQAVSGRvgiellsgg-gvsggKLYEA  410
            GG+KRPE++VP+L+LQL++ ++     + LD ID+AVS  VGI +L+     SGGKLYEA
Sbjct  71   GGYKRPELRVPTLILQLNSDQILTRGESALDLIDKAVSKSVGIVILTSDDEQSGGKLYEA  130

Query  411  ACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLV  590
            ACLLKS+IR+RAYLLV ERVDIAAA   SGVLLSDQGLPT+VARNTML + SE VVLPLV
Sbjct  131  ACLLKSLIRDRAYLLVAERVDIAAAAVTSGVLLSDQGLPTVVARNTMLGSNSELVVLPLV  190

Query  591  ARIEQT  608
            AR  QT
Sbjct  191  ARFVQT  196



>ref|XP_002520749.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41711.1| conserved hypothetical protein [Ricinus communis]
Length=921

 Score =   161 bits (407),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 111/137 (81%), Gaps = 1/137 (1%)
 Frame = +3

Query  201  EQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgg  380
            +Q +Q PRTLFPGG+KRPEIKVPS+VLQL   +V  +   LD +D+A+S  VGI +L+G 
Sbjct  57   QQSQQSPRTLFPGGYKRPEIKVPSIVLQLYPDDVLRD-GALDFLDKALSKWVGIVVLNGA  115

Query  381  gvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDT  560
             V+G  LYEAACLLKSV+++R Y L+ ERVDIAAAVNASGV+LSDQGLP+IVARN M D+
Sbjct  116  DVTGKTLYEAACLLKSVVKDRVYFLIGERVDIAAAVNASGVVLSDQGLPSIVARNMMRDS  175

Query  561  KSESVVLPLVARIEQTP  611
            KSES++LPLV R  Q+P
Sbjct  176  KSESILLPLVGRNVQSP  192



>ref|XP_011032720.1| PREDICTED: uncharacterized protein LOC105131442 [Populus euphratica]
Length=926

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 127/200 (64%), Gaps = 17/200 (9%)
 Frame = +3

Query  48   CCSVHSPS--------HWPFASPTPSHYSPPHFKPRLRCTNISVRAADRSNVSLVFNNEE  203
              S+HSP         H   ++P P    PPH     R  +  + +   +       N+ 
Sbjct  4    LLSLHSPKPSLFLTHFHPHLSTPLPRFKPPPH-----RTHHFPIHSFPNNQQQQQPANQN  58

Query  204  QPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAVS---GRvgiell  371
               QQPRTLFPGG+KRP IKVP++VLQL  ++V       LD ID+AVS   G V +   
Sbjct  59   LSNQQPRTLFPGGYKRPVIKVPNVVLQLDPEDVIRGGSEALDLIDKAVSKSVGIVILNGS  118

Query  372  sgggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTM  551
             GGG SG  LYEAACL+ SV+R+RAYLL+ ERVDIA AVNASGV+LSD+GLP IVARN M
Sbjct  119  IGGGGSGKSLYEAACLVNSVVRDRAYLLIGERVDIATAVNASGVVLSDEGLPAIVARNMM  178

Query  552  LDTKSESVVLPLVARIEQTP  611
            + +++ESVVLPLVARI QTP
Sbjct  179  MGSRTESVVLPLVARIVQTP  198



>gb|KHG12136.1| hypothetical protein F383_07635 [Gossypium arboreum]
Length=927

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 135/194 (70%), Gaps = 5/194 (3%)
 Frame = +3

Query  42   LSCCSVHSPSHWPFA-SPTP---SHYSPPHFKPRLRCTNISVRAADRSNVSLVFNNEE-Q  206
            LS  S  SPS   F  SP+P   S ++   F+  L  T  S+     S+ S     +  Q
Sbjct  5    LSLRSPASPSSALFHFSPSPPFSSRFTKSPFRRFLPPTKPSLSTNSFSSTSQQLGPQGPQ  64

Query  207  PKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggv  386
             +Q PRTLFPGG+KRPEIKVP+ VLQL   +V  + N LD ID+AVS  VG+ +L+GG  
Sbjct  65   NQQAPRTLFPGGYKRPEIKVPNFVLQLDPDDVLADDNALDFIDKAVSKWVGLVVLNGGEG  124

Query  387  sggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKS  566
            SGG++YEAA  LK+V+++RAYLL+ ERVDIAAAV ASGV+LSDQGLP IVARNTM+D+KS
Sbjct  125  SGGRVYEAARSLKAVVKDRAYLLIAERVDIAAAVGASGVVLSDQGLPAIVARNTMMDSKS  184

Query  567  ESVVLPLVARIEQT  608
            +SV LPLVAR  Q+
Sbjct  185  DSVFLPLVARTVQS  198



>ref|XP_007050625.1| FZO-like [Theobroma cacao]
 gb|EOX94782.1| FZO-like [Theobroma cacao]
Length=926

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 139/200 (70%), Gaps = 14/200 (7%)
 Frame = +3

Query  42   LSCCSVHSP--SHWPFASPTPSHYSPPHFKPRLRCTNISVRAADRSNVSL--VFNNEEQ-  206
            ++  S+HSP  +  PF   TPS   PPHF    R  +       +S++S    ++  +Q 
Sbjct  1    MTPLSLHSPASTSAPFFLFTPS---PPHFPRFARSPHRRFLLPTKSSLSNNPFYSTSQQL  57

Query  207  ------PKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiel  368
                   +Q PRTLFPGG+KRPEIKVP++VLQL  +EV  + N LD ID+AVS  VG+ +
Sbjct  58   SPQDPQNQQPPRTLFPGGYKRPEIKVPNVVLQLDPEEVLADGNALDFIDKAVSKWVGLVV  117

Query  369  lsgggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNT  548
            L+GG  SGG++YEAA  LK+V+++RAY L+ ERVDIAAAV ASGV+LSDQGLP IVARNT
Sbjct  118  LNGGEGSGGRVYEAARSLKAVVKDRAYFLITERVDIAAAVRASGVVLSDQGLPAIVARNT  177

Query  549  MLDTKSESVVLPLVARIEQT  608
            M+D+KSESV LPLVAR  QT
Sbjct  178  MMDSKSESVFLPLVARTVQT  197



>ref|XP_004495204.1| PREDICTED: uncharacterized protein LOC101505859 isoform X2 [Cicer 
arietinum]
Length=892

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 111/136 (82%), Gaps = 1/136 (1%)
 Frame = +3

Query  204  QPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFD-NRNVLDEIDQAVSGRvgiellsgg  380
            Q + QPRTLFPGG+KRP+++VP+L+LQL+  ++   +++ LD ID+AVS  VGI +LS  
Sbjct  63   QAQAQPRTLFPGGYKRPKLQVPTLILQLNPDDILTRDQSALDMIDKAVSKSVGIVVLSSN  122

Query  381  gvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDT  560
              SGGKLYEAAC+LKS++R+RAYLLV ERVDIAAA   SGVLLSDQGLPT+VARNTML +
Sbjct  123  EQSGGKLYEAACMLKSLVRDRAYLLVAERVDIAAAAVTSGVLLSDQGLPTVVARNTMLGS  182

Query  561  KSESVVLPLVARIEQT  608
             +E VVLPLVAR  QT
Sbjct  183  NAELVVLPLVARFVQT  198



>ref|XP_004495203.1| PREDICTED: uncharacterized protein LOC101505859 isoform X1 [Cicer 
arietinum]
Length=926

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 111/136 (82%), Gaps = 1/136 (1%)
 Frame = +3

Query  204  QPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFD-NRNVLDEIDQAVSGRvgiellsgg  380
            Q + QPRTLFPGG+KRP+++VP+L+LQL+  ++   +++ LD ID+AVS  VGI +LS  
Sbjct  63   QAQAQPRTLFPGGYKRPKLQVPTLILQLNPDDILTRDQSALDMIDKAVSKSVGIVVLSSN  122

Query  381  gvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDT  560
              SGGKLYEAAC+LKS++R+RAYLLV ERVDIAAA   SGVLLSDQGLPT+VARNTML +
Sbjct  123  EQSGGKLYEAACMLKSLVRDRAYLLVAERVDIAAAAVTSGVLLSDQGLPTVVARNTMLGS  182

Query  561  KSESVVLPLVARIEQT  608
             +E VVLPLVAR  QT
Sbjct  183  NAELVVLPLVARFVQT  198



>ref|XP_008449445.1| PREDICTED: uncharacterized protein LOC103491330 [Cucumis melo]
Length=924

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +3

Query  210  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvs  389
            K QPRTLFP GFKRPEIKVP +VLQL   EV    N LD ID+AVS  VGI +L+ G   
Sbjct  66   KLQPRTLFPSGFKRPEIKVPCVVLQLDAAEVLAGDNALDLIDRAVSKWVGIVVLNSGEGG  125

Query  390  ggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  569
            GGKLYEAAC LKS++ +RAYLL+ ERVDIA AV ASGV+LSDQGLP IVARNTMLD+ S+
Sbjct  126  GGKLYEAACKLKSIVGDRAYLLIAERVDIATAVGASGVVLSDQGLPPIVARNTMLDSTSD  185

Query  570  SVVLPLVAR  596
            S+ LPLVAR
Sbjct  186  SLFLPLVAR  194



>ref|XP_003536908.1| PREDICTED: uncharacterized protein LOC100808213 [Glycine max]
Length=915

 Score =   158 bits (399),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 131/200 (66%), Gaps = 22/200 (11%)
 Frame = +3

Query  51   CSVHSPSHWPFASPTPSHYSPPHFKPRLRCTNISVRAADRSNVSLVFNNEEQ--------  206
            CSV SPS  PF +  P H          R  ++ +R A    ++ + NN E         
Sbjct  4    CSVTSPSS-PFTAIIPRHTHS-------RSPSLPLRVARAFPINSLSNNAESSAQFNQQL  55

Query  207  -----PKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFD-NRNVLDEIDQAVSGRvgiel  368
                 P QQPRTLFPGG+KRPE+ VP+LVLQL   E    + + L  ID+AVS  VGI +
Sbjct  56   FRPSYPPQQPRTLFPGGYKRPELNVPTLVLQLDPDEFLSADTDALALIDKAVSKWVGIVV  115

Query  369  lsgggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNT  548
            L+    SGGKLYEAAC LKS++++RAYLLV ERVDIAAA  ASGVLLSDQGLPT+VARN 
Sbjct  116  LASNQASGGKLYEAACSLKSLLQDRAYLLVAERVDIAAAAAASGVLLSDQGLPTVVARNM  175

Query  549  MLDTKSESVVLPLVARIEQT  608
            MLD+KSE VVLPLVARI +T
Sbjct  176  MLDSKSELVVLPLVARIVRT  195



>ref|XP_004290657.1| PREDICTED: uncharacterized protein LOC101291108 [Fragaria vesca 
subsp. vesca]
Length=914

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  204  QPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsggg  383
            Q  Q PRT FPGGFKRPEIK+P++VLQL  +EV  + +VL  +D+AVS  VGI +L G  
Sbjct  57   QNPQPPRTQFPGGFKRPEIKLPNIVLQLDPEEVLASDDVLPLVDKAVSKWVGILVLDGRQ  116

Query  384  vsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTK  563
             +GG+LY+AAC LKS++R+RAYLL+ ERVDIAAA NASG+LLSDQGLPTIVAR TM+ +K
Sbjct  117  ANGGRLYDAACKLKSLVRDRAYLLISERVDIAAAANASGILLSDQGLPTIVARTTMMASK  176

Query  564  SESVVLPLVAR  596
            S+SV+LPLVAR
Sbjct  177  SDSVILPLVAR  187



>ref|XP_009367692.1| PREDICTED: uncharacterized protein LOC103957273 [Pyrus x bretschneideri]
Length=921

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +3

Query  231  FPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggKLYEA  410
            FPGGFKRPE++VP++VLQL   EV    + LD +D+AVS  VG+ +L+G   SGG+LYEA
Sbjct  71   FPGGFKRPEVRVPNVVLQLDPDEVLAGEDALDLVDKAVSKWVGVLVLNGRDSSGGRLYEA  130

Query  411  ACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLV  590
            AC LKSVIR+RAYLL+ ERVDIAAA NASGVLLSDQGLPTIVAR+TM+ +KS+SVVLPLV
Sbjct  131  ACKLKSVIRDRAYLLISERVDIAAAANASGVLLSDQGLPTIVARSTMMASKSDSVVLPLV  190

Query  591  ARIEQ  605
            AR  Q
Sbjct  191  ARYVQ  195



>ref|XP_009355473.1| PREDICTED: uncharacterized protein LOC103946491 [Pyrus x bretschneideri]
Length=921

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +3

Query  231  FPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggKLYEA  410
            FPGGFKRPE++VP++VLQL   EV    + LD +D+AVS  VG+ +L+G   SGG+LYEA
Sbjct  71   FPGGFKRPEVRVPNVVLQLDPDEVLAGEDALDLVDKAVSKWVGVLVLNGRDSSGGRLYEA  130

Query  411  ACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLV  590
            AC LKSVIR+RAYLL+ ERVDIAAA NASGVLLSDQGLPTIVAR+TM+ +KS+SVVLPLV
Sbjct  131  ACKLKSVIRDRAYLLISERVDIAAAANASGVLLSDQGLPTIVARSTMMASKSDSVVLPLV  190

Query  591  ARIEQ  605
            AR  Q
Sbjct  191  ARYVQ  195



>ref|XP_004140223.1| PREDICTED: uncharacterized protein LOC101213431 [Cucumis sativus]
 gb|KGN47899.1| hypothetical protein Csa_6G410050 [Cucumis sativus]
Length=924

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +3

Query  210  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvs  389
            K QPRTLFP GFKRPEIKVP +VLQL   EV    + LD +D+AVS  VGI +L+ G   
Sbjct  66   KPQPRTLFPSGFKRPEIKVPCVVLQLDAAEVLAGDDALDLVDRAVSKWVGIVVLNSGEGG  125

Query  390  ggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  569
            GGKLYEAAC LKS++ +RAYLL+ ERVDIA AV ASGV+LSDQGLP IVARNTMLD+ S+
Sbjct  126  GGKLYEAACKLKSLVGDRAYLLIAERVDIATAVGASGVVLSDQGLPPIVARNTMLDSTSD  185

Query  570  SVVLPLVAR  596
            S+ LPLVAR
Sbjct  186  SLFLPLVAR  194



>ref|XP_004167583.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101213431 
[Cucumis sativus]
Length=924

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +3

Query  210  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvs  389
            K QPRTLFP GFKRPEIKVP +VLQL   EV    + LD +D+AVS  VGI +L+ G   
Sbjct  66   KPQPRTLFPSGFKRPEIKVPCVVLQLDAAEVLAGDDALDLVDRAVSKWVGIVVLNSGEGG  125

Query  390  ggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  569
            GGKLYEAAC LKS++ +RAYLL+ ERVDIA AV ASGV+LSDQGLP IVARNTMLD+ S+
Sbjct  126  GGKLYEAACKLKSLVGDRAYLLIAERVDIATAVGASGVVLSDQGLPPIVARNTMLDSTSD  185

Query  570  SVVLPLVAR  596
            S+ LPLVAR
Sbjct  186  SLFLPLVAR  194



>gb|KJB23087.1| hypothetical protein B456_004G080200 [Gossypium raimondii]
Length=850

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +3

Query  222  RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggKL  401
            RTLFPGG+KRPEIKVP+ VLQL   +V  + N LD ID+AVS  VG+ +L+GG  SGG++
Sbjct  70   RTLFPGGYKRPEIKVPNFVLQLDPNDVLADDNALDFIDKAVSKWVGLVVLNGGEGSGGRV  129

Query  402  YEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVL  581
            YEAA  LK+V+++RAYLL+ ERVDIAAAV ASGV+LSDQGLP IVARNTM+D+KS+SV L
Sbjct  130  YEAARSLKAVVKDRAYLLIAERVDIAAAVGASGVVLSDQGLPAIVARNTMMDSKSDSVFL  189

Query  582  PLVARIEQT  608
            PLVAR  Q+
Sbjct  190  PLVARTVQS  198



>gb|KJB23088.1| hypothetical protein B456_004G080200 [Gossypium raimondii]
Length=927

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +3

Query  222  RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggKL  401
            RTLFPGG+KRPEIKVP+ VLQL   +V  + N LD ID+AVS  VG+ +L+GG  SGG++
Sbjct  70   RTLFPGGYKRPEIKVPNFVLQLDPNDVLADDNALDFIDKAVSKWVGLVVLNGGEGSGGRV  129

Query  402  YEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVL  581
            YEAA  LK+V+++RAYLL+ ERVDIAAAV ASGV+LSDQGLP IVARNTM+D+KS+SV L
Sbjct  130  YEAARSLKAVVKDRAYLLIAERVDIAAAVGASGVVLSDQGLPAIVARNTMMDSKSDSVFL  189

Query  582  PLVARIEQT  608
            PLVAR  Q+
Sbjct  190  PLVARTVQS  198



>ref|XP_008783174.1| PREDICTED: uncharacterized protein LOC103702498 isoform X1 [Phoenix 
dactylifera]
Length=922

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = +3

Query  201  EQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgg  380
            EQ ++Q RTLFPGGFKRPEIKVP+LVL+L  +EV      + EID AV+  VG+ +L  G
Sbjct  58   EQQQRQLRTLFPGGFKRPEIKVPTLVLRLRAEEVLRREGSIAEIDVAVAKGVGMVVLDCG  117

Query  381  gvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDT  560
              SGG LYEAAC LKSVI +RAY L+ ERVDIAAAV ASGV+LSD+G+P IVARN M+ +
Sbjct  118  DESGGGLYEAACSLKSVIGDRAYFLIAERVDIAAAVGASGVVLSDKGIPAIVARNMMMQS  177

Query  561  KSESVVLPLVARIEQT  608
            K +SV LPLVAR  QT
Sbjct  178  KPDSVYLPLVARTVQT  193



>ref|XP_010927024.1| PREDICTED: uncharacterized protein LOC105049151 isoform X2 [Elaeis 
guineensis]
Length=881

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +3

Query  222  RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggKL  401
            RTLFPGGFKRPEIKVP+LVL+LS +EV      + +ID AV+  VG+ +L  GG SGG+L
Sbjct  71   RTLFPGGFKRPEIKVPTLVLRLSAEEVLRGEESIAQIDVAVAKGVGMVVLDCGGESGGRL  130

Query  402  YEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVL  581
            YEAAC LKSVI +RAY L+ ERVDIA+AV ASGV+LSD+G+P IVARN M+ +K +SV L
Sbjct  131  YEAACRLKSVIGDRAYFLIAERVDIASAVGASGVVLSDKGIPAIVARNMMMKSKPDSVYL  190

Query  582  PLVARIEQT  608
            PLVAR  QT
Sbjct  191  PLVARTVQT  199



>ref|XP_010927025.1| PREDICTED: uncharacterized protein LOC105049151 isoform X3 [Elaeis 
guineensis]
Length=872

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +3

Query  222  RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggKL  401
            RTLFPGGFKRPEIKVP+LVL+LS +EV      + +ID AV+  VG+ +L  GG SGG+L
Sbjct  71   RTLFPGGFKRPEIKVPTLVLRLSAEEVLRGEESIAQIDVAVAKGVGMVVLDCGGESGGRL  130

Query  402  YEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVL  581
            YEAAC LKSVI +RAY L+ ERVDIA+AV ASGV+LSD+G+P IVARN M+ +K +SV L
Sbjct  131  YEAACRLKSVIGDRAYFLIAERVDIASAVGASGVVLSDKGIPAIVARNMMMKSKPDSVYL  190

Query  582  PLVARIEQT  608
            PLVAR  QT
Sbjct  191  PLVARTVQT  199



>ref|XP_010927023.1| PREDICTED: uncharacterized protein LOC105049151 isoform X1 [Elaeis 
guineensis]
Length=928

 Score =   147 bits (370),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +3

Query  222  RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggKL  401
            RTLFPGGFKRPEIKVP+LVL+LS +EV      + +ID AV+  VG+ +L  GG SGG+L
Sbjct  71   RTLFPGGFKRPEIKVPTLVLRLSAEEVLRGEESIAQIDVAVAKGVGMVVLDCGGESGGRL  130

Query  402  YEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVL  581
            YEAAC LKSVI +RAY L+ ERVDIA+AV ASGV+LSD+G+P IVARN M+ +K +SV L
Sbjct  131  YEAACRLKSVIGDRAYFLIAERVDIASAVGASGVVLSDKGIPAIVARNMMMKSKPDSVYL  190

Query  582  PLVARIEQT  608
            PLVAR  QT
Sbjct  191  PLVARTVQT  199



>gb|AAQ65198.1| At1g03160 [Arabidopsis thaliana]
Length=642

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 117/171 (68%), Gaps = 16/171 (9%)
 Frame = +3

Query  99   SHYSPPHFK--PRLRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPS  272
            S ++PP  +    L   NIS  +AD+++ S           +PRTL+PGG+KRPE+ VP 
Sbjct  32   SSFTPPRHRRFSSLSIRNISHESADQTSSS-----------RPRTLYPGGYKRPELAVPG  80

Query  273  LVLQLSTQEVF--DNRNVLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERA  446
            L+L+L   EV   +    LD +D+A++ +    ++  GG + GKLYEAACLLKS+++ RA
Sbjct  81   LLLRLDADEVMSGNREETLDLVDRALA-KSVQIVVIDGGATAGKLYEAACLLKSLVKGRA  139

Query  447  YLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVARI  599
            YLL+ ERVDIA+AV ASGV LSD+GLP IVARNT++ +  +SV+LPLVARI
Sbjct  140  YLLIAERVDIASAVGASGVALSDEGLPAIVARNTLMGSNPDSVLLPLVARI  190



>ref|NP_001077452.1| FZO-like protein [Arabidopsis thaliana]
 dbj|BAD44060.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAE99647.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE27538.1| FZO-like protein [Arabidopsis thaliana]
Length=740

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 117/171 (68%), Gaps = 16/171 (9%)
 Frame = +3

Query  99   SHYSPPHFK--PRLRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPS  272
            S ++PP  +    L   NIS  +AD+++ S           +PRTL+PGG+KRPE+ VP 
Sbjct  32   SSFTPPRHRRFSSLSIRNISHESADQTSSS-----------RPRTLYPGGYKRPELAVPG  80

Query  273  LVLQLSTQEVF--DNRNVLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERA  446
            L+L+L   EV   +    LD +D+A++ +    ++  GG + GKLYEAACLLKS+++ RA
Sbjct  81   LLLRLDADEVMSGNREETLDLVDRALA-KSVQIVVIDGGATAGKLYEAACLLKSLVKGRA  139

Query  447  YLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVARI  599
            YLL+ ERVDIA+AV ASGV LSD+GLP IVARNT++ +  +SV+LPLVARI
Sbjct  140  YLLIAERVDIASAVGASGVALSDEGLPAIVARNTLMGSNPDSVLLPLVARI  190



>gb|AAD25810.1|AC006550_18 F10O3.1, partial [Arabidopsis thaliana]
Length=823

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 117/171 (68%), Gaps = 16/171 (9%)
 Frame = +3

Query  99   SHYSPPHFK--PRLRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPS  272
            S ++PP  +    L   NIS  +AD+++ S           +PRTL+PGG+KRPE+ VP 
Sbjct  70   SSFTPPRHRRFSSLSIRNISHESADQTSSS-----------RPRTLYPGGYKRPELAVPG  118

Query  273  LVLQLSTQEVF--DNRNVLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERA  446
            L+L+L   EV   +    LD +D+A++ +    ++  GG + GKLYEAACLLKS+++ RA
Sbjct  119  LLLRLDADEVMSGNREETLDLVDRALA-KSVQIVVIDGGATAGKLYEAACLLKSLVKGRA  177

Query  447  YLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVARI  599
            YLL+ ERVDIA+AV ASGV LSD+GLP IVARNT++ +  +SV+LPLVARI
Sbjct  178  YLLIAERVDIASAVGASGVALSDEGLPAIVARNTLMGSNPDSVLLPLVARI  228



>ref|NP_171815.3| FZO-like protein [Arabidopsis thaliana]
 gb|ABE96616.1| FZL [Arabidopsis thaliana]
 gb|AEE27537.1| FZO-like protein [Arabidopsis thaliana]
Length=912

 Score =   144 bits (364),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 118/171 (69%), Gaps = 16/171 (9%)
 Frame = +3

Query  99   SHYSPPHFK--PRLRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPS  272
            S ++PP  +    L   NIS  +AD+++ S           +PRTL+PGG+KRPE+ VP 
Sbjct  32   SSFTPPRHRRFSSLSIRNISHESADQTSSS-----------RPRTLYPGGYKRPELAVPG  80

Query  273  LVLQLSTQEVFD-NRN-VLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERA  446
            L+L+L   EV   NR   LD +D+A++ +    ++  GG + GKLYEAACLLKS+++ RA
Sbjct  81   LLLRLDADEVMSGNREETLDLVDRALA-KSVQIVVIDGGATAGKLYEAACLLKSLVKGRA  139

Query  447  YLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVARI  599
            YLL+ ERVDIA+AV ASGV LSD+GLP IVARNT++ +  +SV+LPLVARI
Sbjct  140  YLLIAERVDIASAVGASGVALSDEGLPAIVARNTLMGSNPDSVLLPLVARI  190



>ref|XP_006418260.1| hypothetical protein EUTSA_v10006729mg [Eutrema salsugineum]
 gb|ESQ36613.1| hypothetical protein EUTSA_v10006729mg [Eutrema salsugineum]
Length=926

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 125/194 (64%), Gaps = 25/194 (13%)
 Frame = +3

Query  57   VHSPSHWPFASP---------TPSHYSPPHFK--PRLRCTNISVRAADRSNVSLVFNNEE  203
            V SP  +  ASP           S +SPP  +    L   N+S  +AD+S+ S       
Sbjct  11   VTSPLIFSAASPPFPRRCGRLLSSSFSPPRHRRISSLSIKNVSHESADQSSPS-------  63

Query  204  QPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFD-NRN-VLDEIDQAVSGRvgiellsg  377
                +PRTL+PGG+KRPE+ VP L+L++   E+   NR+  LD +D+A++ +    ++  
Sbjct  64   ----RPRTLYPGGYKRPELAVPGLLLRIDADEIMSGNRDETLDLVDRALA-KSVQIVVLD  118

Query  378  ggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLD  557
            GG + G+LYEAACLLKS+++ RAYLL+ ERVDIA AV ASGV LSD+GLP IVARNT++ 
Sbjct  119  GGATAGRLYEAACLLKSLVKGRAYLLIAERVDIATAVGASGVALSDEGLPAIVARNTLMG  178

Query  558  TKSESVVLPLVARI  599
            +  +SVVLPLVARI
Sbjct  179  SNPDSVVLPLVARI  192



>ref|XP_010474923.1| PREDICTED: uncharacterized protein LOC104754425 isoform X2 [Camelina 
sativa]
Length=761

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 112/157 (71%), Gaps = 8/157 (5%)
 Frame = +3

Query  135  RCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVF--D  308
            R +++S+R     NVS    ++     +PRTL+PGG+KRPE+ VP L+L+L   EV   +
Sbjct  44   RLSSLSIR-----NVSHESADQTSSSSRPRTLYPGGYKRPELAVPGLLLRLDADEVMSGN  98

Query  309  NRNVLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAV  488
                LD +D+A++ +    ++  GG + GKLYEAACLLKS+++ RAYLL+ ERVDIA+AV
Sbjct  99   REETLDLVDRALA-KSVQIVVIDGGATAGKLYEAACLLKSLVKGRAYLLIAERVDIASAV  157

Query  489  NASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVARI  599
             A+GV LSD+GLP IVARNT++ T  +SVVLPLVARI
Sbjct  158  GATGVALSDEGLPAIVARNTLMGTNPDSVVLPLVARI  194



>ref|XP_010474922.1| PREDICTED: uncharacterized protein LOC104754425 isoform X1 [Camelina 
sativa]
Length=932

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 112/157 (71%), Gaps = 8/157 (5%)
 Frame = +3

Query  135  RCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVF--D  308
            R +++S+R     NVS    ++     +PRTL+PGG+KRPE+ VP L+L+L   EV   +
Sbjct  44   RLSSLSIR-----NVSHESADQTSSSSRPRTLYPGGYKRPELAVPGLLLRLDADEVMSGN  98

Query  309  NRNVLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAV  488
                LD +D+A++ +    ++  GG + GKLYEAACLLKS+++ RAYLL+ ERVDIA+AV
Sbjct  99   REETLDLVDRALA-KSVQIVVIDGGATAGKLYEAACLLKSLVKGRAYLLIAERVDIASAV  157

Query  489  NASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVARI  599
             A+GV LSD+GLP IVARNT++ T  +SVVLPLVARI
Sbjct  158  GATGVALSDEGLPAIVARNTLMGTNPDSVVLPLVARI  194



>ref|XP_006851107.1| hypothetical protein AMTR_s00025p00248100 [Amborella trichopoda]
 gb|ERN12688.1| hypothetical protein AMTR_s00025p00248100 [Amborella trichopoda]
Length=947

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 117/181 (65%), Gaps = 13/181 (7%)
 Frame = +3

Query  54   SVHSPSHWPFASPTPSHYSPPHFKPRLRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLF  233
            S+ S S +  ++ +PS +     +P  R    S R+ +  +V              +TLF
Sbjct  47   SISSFSPFSLSTFSPSSHRLHRRRPSFRSQFGSTRSQNEPDV-------------KKTLF  93

Query  234  PGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggKLYEAA  413
            PGGFKR EIKVP+L+LQL   EV +  + L   D AVS  V + +L+GG  S G++YEAA
Sbjct  94   PGGFKRAEIKVPTLILQLEVAEVLEGGDALRFTDAAVSEMVSMVVLNGGDESAGRIYEAA  153

Query  414  CLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVA  593
              LK V+R  +YLL+ ERVDIA+AV A+GV+LSDQGLP I+ARN M+++KSES+VLPLVA
Sbjct  154  LALKRVLRGSSYLLISERVDIASAVGANGVVLSDQGLPAIIARNMMMESKSESIVLPLVA  213

Query  594  R  596
            R
Sbjct  214  R  214



>ref|XP_002889440.1| hypothetical protein ARALYDRAFT_470295 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65699.1| hypothetical protein ARALYDRAFT_470295 [Arabidopsis lyrata subsp. 
lyrata]
Length=923

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 15/170 (9%)
 Frame = +3

Query  99   SHYSPPHFK-PRLRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSL  275
            S  +P H + P L   N+S  +AD+++ S           +PRTL+PGG+KRPE+ VP +
Sbjct  33   SFTAPRHRRLPSLSIRNVSHESADQTSSS-----------RPRTLYPGGYKRPELAVPGV  81

Query  276  VLQLSTQEVFD-NRN-VLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERAY  449
            +L+L   EV   NR   +D +D+A++ +    ++  GG + GKLYEAACLLKS+++ RAY
Sbjct  82   LLRLDADEVMSGNREETVDLVDRALA-KSVQIVVIDGGATAGKLYEAACLLKSLVKGRAY  140

Query  450  LLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVARI  599
            LL+ ERVDIA+AV ASGV LSD+GLP IVARNT++ +  +SVVLPLVARI
Sbjct  141  LLIAERVDIASAVGASGVALSDEGLPAIVARNTLMGSNPDSVVLPLVARI  190



>ref|XP_009401044.1| PREDICTED: uncharacterized protein LOC103985144 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=833

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 124/200 (62%), Gaps = 23/200 (12%)
 Frame = +3

Query  57   VHSPSHWPFASPTPSHYSPPHFKPRLRCTNI------SVRAADRSNVSLVFNNEEQPKQQ  218
            V SP H+P ++  P H  P  FKP L   NI      S R A    ++ + +        
Sbjct  3    VCSPCHYPVSARRPPHL-PLLFKPIL--LNIFHRPPFSKRRAAPQPINAIGDQSSSFSGT  59

Query  219  P-----------RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgie  365
            P           RTLFPGGFKRPE+ +P+LVL+LS  EV +      ++D A+  RVG+ 
Sbjct  60   PQQQHQQRQKQVRTLFPGGFKRPELNIPTLVLRLSVDEVLEREA---DVDVALLKRVGVV  116

Query  366  llsgggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARN  545
            +L GG  SG +LYEAAC LKS++R+RAYLL+ ERVDIAAAV ASGV+LSD  +P +VARN
Sbjct  117  VLDGGDQSGARLYEAACALKSLLRDRAYLLIAERVDIAAAVGASGVVLSDSAIPALVARN  176

Query  546  TMLDTKSESVVLPLVARIEQ  605
             M+ ++S+SV LPLVAR  Q
Sbjct  177  MMMKSRSDSVYLPLVARTVQ  196



>ref|XP_010522727.1| PREDICTED: uncharacterized protein LOC104801235 isoform X2 [Tarenaya 
hassleriana]
Length=724

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 106/146 (73%), Gaps = 4/146 (3%)
 Frame = +3

Query  174  NVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNR--NVLDEIDQAVS  347
            N+S    +++ P  +PRT++PGG+KRPEI VP L+L+L   E+        L  + +A++
Sbjct  55   NISYDSADQDLP-SRPRTVYPGGYKRPEIPVPGLLLKLDADELLSGSRDEALALVGRALA  113

Query  348  GRvgiellsgggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLP  527
             +    ++  GG +GG+LYEAACLLKSV++ RAYLL+ ERVDIA AV ASGV+LSDQGLP
Sbjct  114  -KSIEIVVLDGGATGGRLYEAACLLKSVVKGRAYLLISERVDIATAVGASGVVLSDQGLP  172

Query  528  TIVARNTMLDTKSESVVLPLVARIEQ  605
             IVARNTM+ + SESVVLPLVAR  Q
Sbjct  173  AIVARNTMMGSNSESVVLPLVARTAQ  198



>ref|XP_006306709.1| hypothetical protein CARUB_v10008235mg [Capsella rubella]
 gb|EOA39607.1| hypothetical protein CARUB_v10008235mg [Capsella rubella]
Length=929

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 111/158 (70%), Gaps = 14/158 (9%)
 Frame = +3

Query  132  LRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFD-  308
            L   N+S  +AD+++ S           +PRTL+PGG+KRPE+ VP L+L+L   EV   
Sbjct  48   LSIRNVSHESADQTSSS-----------RPRTLYPGGYKRPELAVPGLLLRLDADEVMSG  96

Query  309  NRN-VLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAA  485
            NR   LD +D+A++ +    ++  GG + GKLYEAACLLKS+++ RAYLL+ ERVDIA A
Sbjct  97   NREETLDLVDRALA-KSVQIVVIDGGATAGKLYEAACLLKSLVKGRAYLLIAERVDIATA  155

Query  486  VNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVARI  599
            V ASGV LSD+GLP IVARNT++ +  +S+VLPLVARI
Sbjct  156  VGASGVALSDEGLPAIVARNTLMGSNPDSIVLPLVARI  193



>ref|XP_009401043.1| PREDICTED: uncharacterized protein LOC103985144 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=926

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 124/200 (62%), Gaps = 23/200 (12%)
 Frame = +3

Query  57   VHSPSHWPFASPTPSHYSPPHFKPRLRCTNI------SVRAADRSNVSLVFNNEEQPKQQ  218
            V SP H+P ++  P H  P  FKP L   NI      S R A    ++ + +        
Sbjct  3    VCSPCHYPVSARRPPHL-PLLFKPIL--LNIFHRPPFSKRRAAPQPINAIGDQSSSFSGT  59

Query  219  P-----------RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgie  365
            P           RTLFPGGFKRPE+ +P+LVL+LS  EV +      ++D A+  RVG+ 
Sbjct  60   PQQQHQQRQKQVRTLFPGGFKRPELNIPTLVLRLSVDEVLEREA---DVDVALLKRVGVV  116

Query  366  llsgggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARN  545
            +L GG  SG +LYEAAC LKS++R+RAYLL+ ERVDIAAAV ASGV+LSD  +P +VARN
Sbjct  117  VLDGGDQSGARLYEAACALKSLLRDRAYLLIAERVDIAAAVGASGVVLSDSAIPALVARN  176

Query  546  TMLDTKSESVVLPLVARIEQ  605
             M+ ++S+SV LPLVAR  Q
Sbjct  177  MMMKSRSDSVYLPLVARTVQ  196



>ref|XP_010474935.1| PREDICTED: uncharacterized protein LOC104754437 [Camelina sativa]
Length=930

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 112/158 (71%), Gaps = 14/158 (9%)
 Frame = +3

Query  132  LRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFD-  308
            L   N+S  +AD+++ S           +PRTL+PGG+KRPE+ VP L+L+L   EV   
Sbjct  48   LSIRNVSHESADQTSSS-----------RPRTLYPGGYKRPELAVPGLLLRLDADEVMSG  96

Query  309  NRN-VLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAA  485
            NR   LD +D+A++ +    ++  GG + GKLYEAACLLKS+++ RAYLL+ ERVDIA+A
Sbjct  97   NREETLDLVDRALA-KSVQIVVIDGGATAGKLYEAACLLKSLVKGRAYLLIAERVDIASA  155

Query  486  VNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVARI  599
            V A+GV LSD+GLP IVARNT++ +  +SVVLPLVARI
Sbjct  156  VGATGVALSDEGLPAIVARNTLMGSNPDSVVLPLVARI  193



>ref|XP_011026335.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105126973 
[Populus euphratica]
Length=1020

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 98/137 (72%), Gaps = 7/137 (5%)
 Frame = +3

Query  222  RTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAVSGRv------giellsgg  380
            RTLFPGG+KRPEIKV ++V QL +++V        D ID+AVS  V      G     G 
Sbjct  140  RTLFPGGYKRPEIKVANIVPQLDSEDVIRSGSEASDLIDKAVSKSVGIVVLNGGSDGDGR  199

Query  381  gvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDT  560
            G  G  LYEAA L+KSV+R+RAYLL+ ERVDIAAAVNA GV+LSDQGLP  V RN ++ +
Sbjct  200  GGRGKSLYEAAFLVKSVVRDRAYLLIGERVDIAAAVNARGVVLSDQGLPAFVVRNMLMGS  259

Query  561  KSESVVLPLVARIEQTP  611
            KSESVVLPLVARI QTP
Sbjct  260  KSESVVLPLVARIVQTP  276



>ref|XP_010522715.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522716.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522717.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522719.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522720.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522721.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522722.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522723.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522724.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522725.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522726.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
Length=932

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 104/150 (69%), Gaps = 12/150 (8%)
 Frame = +3

Query  174  NVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVS--  347
            N+S    +++ P  +PRT++PGG+KRPEI VP L+L+L   E+          D+A++  
Sbjct  55   NISYDSADQDLP-SRPRTVYPGGYKRPEIPVPGLLLKLDADELLSGSR-----DEALALV  108

Query  348  GRvgiellsggg----vsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSD  515
            GR   + +         +GG+LYEAACLLKSV++ RAYLL+ ERVDIA AV ASGV+LSD
Sbjct  109  GRALAKSIEIVVLDGGATGGRLYEAACLLKSVVKGRAYLLISERVDIATAVGASGVVLSD  168

Query  516  QGLPTIVARNTMLDTKSESVVLPLVARIEQ  605
            QGLP IVARNTM+ + SESVVLPLVAR  Q
Sbjct  169  QGLPAIVARNTMMGSNSESVVLPLVARTAQ  198



>ref|XP_010481655.1| PREDICTED: uncharacterized protein LOC104760424 [Camelina sativa]
Length=930

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 110/158 (70%), Gaps = 14/158 (9%)
 Frame = +3

Query  132  LRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVF--  305
            L   N+S  +AD+++ S           +PRTL+PGG+KRPE+ VP L+L+L   EV   
Sbjct  48   LSIRNVSHESADQTSSS-----------RPRTLYPGGYKRPELAVPGLLLRLDADEVMSG  96

Query  306  DNRNVLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAA  485
            +    LD +D+A++ +    ++  GG + GKLYEAACLLKS+++ RAYL++ ERVDIA A
Sbjct  97   NREETLDLVDRALA-KSVQIVVIDGGATAGKLYEAACLLKSLVKGRAYLMIAERVDIATA  155

Query  486  VNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVARI  599
            V A+GV LSD+GLP IVARNT++ +  +SVVLPLVARI
Sbjct  156  VGATGVALSDEGLPAIVARNTLMGSNPDSVVLPLVARI  193



>emb|CDX86689.1| BnaC08g00140D [Brassica napus]
Length=909

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 122/169 (72%), Gaps = 12/169 (7%)
 Frame = +3

Query  99   SHYSPPHFKPRLRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLV  278
            S +SPP  K   R +++S+R     N SL   ++  P  +PRTL+PGG+KRPE+ VP L+
Sbjct  32   SSFSPPRHK---RLSSLSIR-----NASLESADQTSP-SRPRTLYPGGYKRPELAVPGLL  82

Query  279  LQLSTQEVFD-NRN-VLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERAYL  452
            L+L   EV   NR+  LD ID+A++ +    ++  GG + GKLYEAACLLKS+++ RAYL
Sbjct  83   LRLDADEVMSGNRDETLDLIDRALT-KSVQIVVLDGGDTAGKLYEAACLLKSLVKGRAYL  141

Query  453  LVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVARI  599
            L+ ERVDIAAAV ASGV LSD+GLP IVARNT++ + SESVVLPLVARI
Sbjct  142  LIAERVDIAAAVGASGVALSDEGLPAIVARNTLMGSNSESVVLPLVARI  190



>emb|CDY15452.1| BnaA08g27360D [Brassica napus]
Length=907

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 123/169 (73%), Gaps = 12/169 (7%)
 Frame = +3

Query  99   SHYSPPHFKPRLRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLV  278
            S +SPP  K   R +++S+R     N SL   ++  P  +PRTL+PGG+KRPE+ VP L+
Sbjct  32   SSFSPPRHK---RLSSLSIR-----NASLESADQTSP-SRPRTLYPGGYKRPELAVPGLL  82

Query  279  LQLSTQEVFD-NRN-VLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERAYL  452
            L+L   EV   NR+  LD ID+A++ +    ++  GGV+ GKLYEAACLLKS+++ RAYL
Sbjct  83   LRLDADEVMSGNRDETLDLIDRALA-KSVQIVVLDGGVNAGKLYEAACLLKSLVKGRAYL  141

Query  453  LVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVARI  599
            L+ ERVDIAAAV ASGV LSD+GLP IVARNT++ + SESVVLPLVARI
Sbjct  142  LIAERVDIAAAVGASGVALSDEGLPAIVARNTLMGSNSESVVLPLVARI  190



>ref|XP_009111165.1| PREDICTED: uncharacterized protein LOC103836629 [Brassica rapa]
Length=909

 Score =   138 bits (348),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 123/169 (73%), Gaps = 12/169 (7%)
 Frame = +3

Query  99   SHYSPPHFKPRLRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLV  278
            S +SPP  K   R +++S+R     N SL   ++  P  +PRTL+PGG+KRPE+ VP L+
Sbjct  32   SSFSPPRHK---RLSSLSIR-----NASLESADQTSP-SRPRTLYPGGYKRPELAVPGLL  82

Query  279  LQLSTQEVFD-NRN-VLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERAYL  452
            L+L   EV   NR+  LD ID+A++ +    ++  GGV+ GKLYEAACLLKS+++ RAYL
Sbjct  83   LRLDADEVMSGNRDETLDLIDRALA-KSVQIVVLDGGVNAGKLYEAACLLKSLVKGRAYL  141

Query  453  LVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVARI  599
            L+ ERVDIAAAV ASGV LSD+GLP IVARNT++ + SESVVLPLVARI
Sbjct  142  LIAERVDIAAAVGASGVALSDEGLPAIVARNTLMGSNSESVVLPLVARI  190



>gb|EPS64568.1| hypothetical protein M569_10214, partial [Genlisea aurea]
Length=146

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = +3

Query  132  LRCTNISVRAADRSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDN  311
            LRC+  +  A       L  ++    +  PR+LFPGG+KRPEI +P+L+L+L   EV  +
Sbjct  18   LRCSATASTAVAGVRKHLCPDSGHINQNPPRSLFPGGYKRPEISLPNLLLRLRADEVLSD  77

Query  312  RNVLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVN  491
             +VL+ +D+AVS R+GI +L+GG  SG KLYEAA LLKSVIR+RAYLL+D+R+DIAAA+ 
Sbjct  78   GDVLNLVDEAVSDRIGIVVLTGGKNSGRKLYEAAGLLKSVIRDRAYLLIDDRIDIAAAIK  137

Query  492  ASGVLLSDQ  518
            ASGVLLSD+
Sbjct  138  ASGVLLSDK  146



>ref|XP_002300848.2| hypothetical protein POPTR_0002s05420g [Populus trichocarpa]
 gb|EEE80121.2| hypothetical protein POPTR_0002s05420g [Populus trichocarpa]
Length=797

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 92/130 (71%), Gaps = 13/130 (10%)
 Frame = +3

Query  222  RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggKL  401
            RTLFPGG+KRPEIKVP++V QL +++V             + G V      GGG SG  L
Sbjct  60   RTLFPGGYKRPEIKVPNIVPQLDSEDV-------------IRGCVSDGDGGGGGGSGKSL  106

Query  402  YEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVL  581
            YEAA L+KSV+R+RAYLL+ ERV IAAAVNA GV+LSD+GLP  + RN +  +KSESVVL
Sbjct  107  YEAAFLVKSVVRDRAYLLIGERVYIAAAVNARGVVLSDKGLPAFLVRNMLTGSKSESVVL  166

Query  582  PLVARIEQTP  611
            PL ARI QTP
Sbjct  167  PLAARIVQTP  176



>ref|XP_010233244.1| PREDICTED: uncharacterized protein LOC100838168 [Brachypodium 
distachyon]
Length=965

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 95/132 (72%), Gaps = 3/132 (2%)
 Frame = +3

Query  210  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvs  389
            KQ PRTLFPGGFKRPEI+VP+LVL++   E   +    D +  AV+  VGI +L  G   
Sbjct  103  KQPPRTLFPGGFKRPEIQVPALVLRVGVDEALGSG---DTVASAVARGVGIVVLEAGEEG  159

Query  390  ggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  569
            GG+ YEAA  LK+ + +RAYLL+ ERVD+A+AV ASGV+L+D G+P IVAR+ M+ + SE
Sbjct  160  GGRAYEAARALKAAVGDRAYLLIAERVDVASAVGASGVVLADDGIPAIVARSMMMKSNSE  219

Query  570  SVVLPLVARIEQ  605
            S+ LPLVAR  Q
Sbjct  220  SIYLPLVARTVQ  231



>gb|AFW77879.1| hypothetical protein ZEAMMB73_997279, partial [Zea mays]
Length=794

 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 96/129 (74%), Gaps = 3/129 (2%)
 Frame = +3

Query  210  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvs  389
            K+ PRTLFPGGFKRPEI+VP+LVL++ T+E        DE+  AVS  VGI +L  G   
Sbjct  54   KEPPRTLFPGGFKRPEIQVPALVLRVGTEEAL---RCGDEVADAVSRGVGIVVLEAGEEG  110

Query  390  ggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  569
            GG+ YEAA  L++ + +RAYLL+ ERVD+A+AV ASGV+L+D G+P IVAR+ M+ + ++
Sbjct  111  GGRSYEAARALRATVGDRAYLLIAERVDVASAVGASGVVLADDGIPAIVARSMMMKSNAD  170

Query  570  SVVLPLVAR  596
            S+ LP+VAR
Sbjct  171  SIYLPIVAR  179



>ref|XP_008649599.1| PREDICTED: uncharacterized protein LOC103630315 [Zea mays]
Length=917

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 96/129 (74%), Gaps = 3/129 (2%)
 Frame = +3

Query  210  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvs  389
            K+ PRTLFPGGFKRPEI+VP+LVL++ T+E        DE+  AVS  VGI +L  G   
Sbjct  54   KEPPRTLFPGGFKRPEIQVPALVLRVGTEEAL---RCGDEVADAVSRGVGIVVLEAGEEG  110

Query  390  ggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  569
            GG+ YEAA  L++ + +RAYLL+ ERVD+A+AV ASGV+L+D G+P IVAR+ M+ + ++
Sbjct  111  GGRSYEAARALRATVGDRAYLLIAERVDVASAVGASGVVLADDGIPAIVARSMMMKSNAD  170

Query  570  SVVLPLVAR  596
            S+ LP+VAR
Sbjct  171  SIYLPIVAR  179



>ref|XP_004963794.1| PREDICTED: uncharacterized protein LOC101755934, partial [Setaria 
italica]
Length=895

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 96/129 (74%), Gaps = 3/129 (2%)
 Frame = +3

Query  210  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvs  389
            K+ PRTLFPGGFKRPEI+VP+LVL++  +E   +    DE+  AV+  VGI +L  G   
Sbjct  33   KEPPRTLFPGGFKRPEIQVPALVLRVGAEEALRSG---DEVAAAVARGVGIVVLEAGEEG  89

Query  390  ggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  569
            GG+ YEAA  L++ + +RAYLL+ ERVD+A+AV ASGV+L+D G+P IVAR+ M+ + ++
Sbjct  90   GGRAYEAAVKLRAAVGDRAYLLITERVDVASAVGASGVVLADDGIPAIVARSMMMKSNAD  149

Query  570  SVVLPLVAR  596
            S+ LP+VAR
Sbjct  150  SIYLPIVAR  158



>ref|XP_002439739.1| hypothetical protein SORBIDRAFT_09g019290 [Sorghum bicolor]
 gb|EES18169.1| hypothetical protein SORBIDRAFT_09g019290 [Sorghum bicolor]
Length=922

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 95/129 (74%), Gaps = 3/129 (2%)
 Frame = +3

Query  210  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvs  389
            K+ PRTLFPGGFKRPEI+VP+LVL++  +E        DE+  AVS  VGI +L  G   
Sbjct  59   KEPPRTLFPGGFKRPEIQVPALVLRVGAEEAL---RCGDEVAAAVSRGVGIVVLEAGEEG  115

Query  390  ggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  569
            GG+ YEAA  L++ + +RAYLL+ ERVD+A+AV ASGV+L+D G+P IVAR+ M+ + ++
Sbjct  116  GGRAYEAARALRATVGDRAYLLIAERVDVASAVGASGVVLADDGIPAIVARSMMMKSNAD  175

Query  570  SVVLPLVAR  596
            S+ LP+VAR
Sbjct  176  SIYLPIVAR  184



>gb|EAY97909.1| hypothetical protein OsI_19825 [Oryza sativa Indica Group]
Length=925

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 95/129 (74%), Gaps = 3/129 (2%)
 Frame = +3

Query  210  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvs  389
            ++ PRTLFPGGFKRPEI+VP+LVL++   E   +    D +  AV+  VGI +L  G   
Sbjct  62   REPPRTLFPGGFKRPEIRVPALVLRVGADEALASG---DAVVAAVARGVGIVVLEAGAEG  118

Query  390  ggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  569
            GG++YEAA  LK+ + +RAYLLV ERVD+A+AV ASGV+L+D G+P IVAR+ M+ + S+
Sbjct  119  GGRVYEAALSLKASVGDRAYLLVAERVDVASAVGASGVVLADDGIPAIVARSMMMKSNSD  178

Query  570  SVVLPLVAR  596
            S+ LPLVAR
Sbjct  179  SIYLPLVAR  187



>gb|EEE63597.1| hypothetical protein OsJ_18414 [Oryza sativa Japonica Group]
Length=922

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 95/129 (74%), Gaps = 3/129 (2%)
 Frame = +3

Query  210  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvs  389
            ++ PRTLFPGGFKRPEI+VP+LVL++   E   +    D +  AV+  VGI +L  G   
Sbjct  63   REPPRTLFPGGFKRPEIRVPALVLRVGADEALASG---DAVVAAVARGVGIVVLEAGEEG  119

Query  390  ggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  569
            GG++YEAA  LK+ + +RAYLLV ERVD+A+AV ASGV+L+D G+P IVAR+ M+ + S+
Sbjct  120  GGRVYEAALSLKASVGDRAYLLVAERVDVASAVGASGVVLADDGIPAIVARSMMMKSNSD  179

Query  570  SVVLPLVAR  596
            S+ LPLVAR
Sbjct  180  SIYLPLVAR  188



>dbj|BAK07723.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=967

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 89/129 (69%), Gaps = 3/129 (2%)
 Frame = +3

Query  210  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvs  389
            K+ PRTLFPGGFKRPEI+VP+LVL++   E   + + +        G   I +L  G   
Sbjct  105  KEPPRTLFPGGFKRPEIQVPALVLRVGVGEALGSGDAVAAAVARGVG---IVVLEAGEEG  161

Query  390  ggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  569
            GG+ YEAA  LK+ + +RAYLL+ ERVD+A+AV ASGV+L+D G+P IVAR  M+ + S+
Sbjct  162  GGRAYEAARALKAAVGDRAYLLIAERVDVASAVGASGVVLADDGIPAIVARGMMMKSNSD  221

Query  570  SVVLPLVAR  596
            S+ LPLVAR
Sbjct  222  SIYLPLVAR  230



>ref|XP_002984373.1| hypothetical protein SELMODRAFT_445893 [Selaginella moellendorffii]
 gb|EFJ14423.1| hypothetical protein SELMODRAFT_445893 [Selaginella moellendorffii]
Length=905

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 82/124 (66%), Gaps = 1/124 (1%)
 Frame = +3

Query  228  LFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAVSGRvgiellsgggvsggKLY  404
            +FPGG +R  +++P L L+L  +++  D       +D AV+  + + +L  G     + Y
Sbjct  73   VFPGGTRRASVRLPGLGLRLKAEDILEDGEEKKAVLDSAVAAGLNLVILEDGKEDSLRFY  132

Query  405  EAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLP  584
            +AA ++ S++R RA +L+ ERVDIAAA  ++GV+LSDQGLP++VAR  M +   E+VVLP
Sbjct  133  DAARIVMSIVRGRADVLIVERVDIAAAAGSNGVVLSDQGLPSVVARRMMQNAMPEAVVLP  192

Query  585  LVAR  596
            LVAR
Sbjct  193  LVAR  196



>ref|XP_002972797.1| hypothetical protein SELMODRAFT_413416 [Selaginella moellendorffii]
 gb|EFJ26018.1| hypothetical protein SELMODRAFT_413416 [Selaginella moellendorffii]
Length=904

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 82/124 (66%), Gaps = 1/124 (1%)
 Frame = +3

Query  228  LFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAVSGRvgiellsgggvsggKLY  404
            +FPGG +R  +++P L L+L  +++  D       +D AV+  + + +L  G     + Y
Sbjct  73   VFPGGTRRASVRLPGLGLRLKAEDILEDGEEKKAVLDSAVAAGLNLVILEDGKEDSLRFY  132

Query  405  EAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLP  584
            +AA ++ S++R RA +L+ ERVDIAAA  ++GV+LSDQGLP++VAR  M +   E+VVLP
Sbjct  133  DAARIVMSIVRGRADVLIVERVDIAAAAGSNGVVLSDQGLPSVVARRMMQNAMPEAVVLP  192

Query  585  LVAR  596
            LVAR
Sbjct  193  LVAR  196



>gb|EAY97907.1| hypothetical protein OsI_19823 [Oryza sativa Indica Group]
Length=163

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 75/104 (72%), Gaps = 3/104 (3%)
 Frame = +3

Query  210  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvs  389
            ++ PRTLFPGGFKRPEI+VP+LVL++   E   +    D +  AV+  VGI +L  G   
Sbjct  62   REPPRTLFPGGFKRPEIRVPALVLRVGADEALASG---DAVVAAVARGVGIVVLEAGEEG  118

Query  390  ggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQG  521
            GG++YEAA  LK+ + +RAYLLV ERVD+A+AV ASGV+L+D G
Sbjct  119  GGRVYEAALSLKASVGDRAYLLVAERVDVASAVGASGVVLADDG  162



>ref|XP_001774726.1| predicted protein [Physcomitrella patens]
 gb|EDQ60397.1| predicted protein [Physcomitrella patens]
Length=823

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  396  KLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  575
            KLY+A C+LK+++R RA LL+ ERVDIAAA  A GVLL+D+GLP +VAR  M ++  E+ 
Sbjct  16   KLYDAGCMLKTMLRGRAELLISERVDIAAASGADGVLLTDEGLPAVVARRMMQNSGLETP  75

Query  576  VLPLVAR  596
             LPLVAR
Sbjct  76   ALPLVAR  82



>ref|XP_001780842.1| predicted protein [Physcomitrella patens]
 gb|EDQ54321.1| predicted protein [Physcomitrella patens]
Length=839

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  396  KLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  575
            +LY+A C+LK+++R RA LL+ ERVDIAAA  A GVLL+D+GLP +VAR  M ++  E+ 
Sbjct  16   RLYDAGCMLKTMLRGRAELLIAERVDIAAASGADGVLLTDEGLPAVVARRMMQNSGLETS  75

Query  576  VLPLVAR  596
            VLPLVAR
Sbjct  76   VLPLVAR  82



>ref|NP_001055439.1| Os05g0390100 [Oryza sativa Japonica Group]
 gb|AAT47445.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17353.1| Os05g0390100 [Oryza sativa Japonica Group]
 dbj|BAG99883.1| unnamed protein product [Oryza sativa Japonica Group]
Length=803

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +3

Query  408  AACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPL  587
            AA  LK+ + +RAYLLV ERVD+A+AV ASGV+L+D G+P IVAR+ M+ + S+S+ LPL
Sbjct  3    AALSLKASVGDRAYLLVAERVDVASAVGASGVVLADDGIPAIVARSMMMKSNSDSIYLPL  62

Query  588  VAR  596
            VAR
Sbjct  63   VAR  65



>ref|XP_005646142.1| hypothetical protein COCSUDRAFT_30102 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21598.1| hypothetical protein COCSUDRAFT_30102 [Coccomyxa subellipsoidea 
C-169]
Length=832

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 71/113 (63%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  TLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEI--DQAVSGRvgiellsgggvsggK  398
            T+FP G K+ ++ +P+ +L L+  +V + R  L +   D   +G  G+ L    G  G +
Sbjct  70   TVFPAGKKQAKVALPACILVLTAADVVERRQELTQSIGDAIAAGATGVLLEDDDGTGGAQ  129

Query  399  LYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLD  557
            LYEAA +LK V+R RA LL+ +R DI AA  A GV+LS +G+PT+VAR ++ D
Sbjct  130  LYEAAIVLKDVLRGRAVLLIQDRTDIVAAAEADGVVLSSRGVPTVVARRSLPD  182



>gb|KHN18882.1| Hypothetical protein glysoja_028251, partial [Glycine soja]
Length=764

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  492  ASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVARIEQT  608
            ASGVLLSDQGLPT+VARNTMLD+KSE VVLPLVARI QT
Sbjct  5    ASGVLLSDQGLPTVVARNTMLDSKSELVVLPLVARIVQT  43



>ref|XP_003081806.1| Mitofusin 1 GTPase, involved in mitochondrila biogenesis (ISS) 
[Ostreococcus tauri]
Length=849

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 63/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  216  QPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsg------  377
            + R+LF  G KR EI++P  V  +  +E    R     ID A+     + +L        
Sbjct  62   EKRSLFASGSKRSEIRIPGFVAYVDVREASTERGT-RAIDNALHAGATMIVLQERGMNGG  120

Query  378  --ggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTM  551
                 SG  LYE+A  LK ++R RA +L+ +R DIA      GV+L+D G+PT+VAR T+
Sbjct  121  VGESASGRALYESATALKDLVRGRAKVLIQDRTDIAVQAELDGVVLTDDGVPTVVARKTL  180



>emb|CEF99507.1| P-loop containing nucleoside triphosphate hydrolase [Ostreococcus 
tauri]
Length=891

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 63/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  216  QPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsg------  377
            + R+LF  G KR EI++P  V  +  +E    R     ID A+     + +L        
Sbjct  62   EKRSLFASGSKRSEIRIPGFVAYVDVREASTERGT-RAIDNALHAGATMIVLQERGMNGG  120

Query  378  --ggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTM  551
                 SG  LYE+A  LK ++R RA +L+ +R DIA      GV+L+D G+PT+VAR T+
Sbjct  121  VGESASGRALYESATALKDLVRGRAKVLIQDRTDIAVQAELDGVVLTDDGVPTVVARKTL  180



>ref|XP_001420392.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO98685.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=632

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 73/132 (55%), Gaps = 7/132 (5%)
 Frame = +3

Query  183  LVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRN--VLDEIDQA----V  344
            L  N      +Q R LF    KR E+++P  +  +   E    R   V+D +  A    V
Sbjct  48   LSGNATATGDKQQRDLFAQ-TKRAEVRIPGFLAYVDVDEATSTRGAEVVDAVLHAGATCV  106

Query  345  SGRvgiellsgggvsggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGL  524
            + R      +GGG SG KLYEAA  LK+++R RA +L+ +R DIAA+    GV+L+D G+
Sbjct  107  ALREYGVDGTGGGNSGKKLYEAATTLKTLVRGRACVLIVDRTDIAASAELDGVVLTDDGV  166

Query  525  PTIVARNTMLDT  560
            PT+VAR  + +T
Sbjct  167  PTVVARKALPET  178



>ref|XP_005845307.1| hypothetical protein CHLNCDRAFT_137054 [Chlorella variabilis]
 gb|EFN53205.1| hypothetical protein CHLNCDRAFT_137054 [Chlorella variabilis]
Length=997

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 69/131 (53%), Gaps = 13/131 (10%)
 Frame = +3

Query  228  LFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEID-------QAVSGRvgiellsgggv  386
            LFP G ++  +++P+L+L ++  +V D       ++          +  V  +   GGG 
Sbjct  74   LFPAGKRQARVQLPALMLAVTAADVLDPAQAGGALEALSAAVAGGATAVVLAQGADGGGS  133

Query  387  sggKLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKS  566
             G +LYEAA  LK ++R RA LL+ +R DI  A  A G LL+  GLPT+VA+  + D   
Sbjct  134  GGAELYEAAVRLKELLRGRAVLLIADRTDIVDAAGADGALLTGAGLPTMVAKRMLQDG--  191

Query  567  ESVVLPLVARI  599
                L LV R+
Sbjct  192  ----LALVGRV  198



>ref|XP_001689811.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP09549.1| predicted protein [Chlamydomonas reinhardtii]
Length=759

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 62/98 (63%), Gaps = 0/98 (0%)
 Frame = +3

Query  258  IKVPSLVLQLSTQEVFDNRNVLDEIDQAVSGRvgiellsgggvsggKLYEAACLLKSVIR  437
            +++P++VLQL   +V  +   LD + QA+ G   + +L     +   +Y+AA  ++  +R
Sbjct  6    VQLPAVVLQLEASKVLADGAALDTLSQALQGGCNMVVLWDSNANAAAMYDAALRVQEALR  65

Query  438  ERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTM  551
             RA LL+ +R DIA A+ A GVLL+DQG+PT+VA+  M
Sbjct  66   ARAPLLLVDRTDIALAIGAQGVLLTDQGVPTVVAKRMM  103



>ref|XP_002509117.1| hypothetical protein MICPUN_62927 [Micromonas sp. RCC299]
 gb|ACO70375.1| hypothetical protein MICPUN_62927 [Micromonas sp. RCC299]
Length=1014

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  396  KLYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTM  551
            +L+ AA  LK  +R RA LLV +R DIAA+    GV+LSD G+P +VAR ++
Sbjct  155  ELFNAALALKESLRGRASLLVADRTDIAASAECDGVVLSDDGVPVVVARKSL  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660