BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS047H09

Length=457
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAC98299.1|  LEXYL2                                               99.0    6e-21   Solanum lycopersicum
ref|XP_006351808.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  99.4    7e-21   Solanum tuberosum [potatoes]
ref|XP_004230547.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  98.6    1e-20   
ref|XP_009612011.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  97.8    2e-20   Nicotiana tomentosiformis
ref|XP_009762535.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  97.8    2e-20   Nicotiana sylvestris
ref|XP_006341844.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  96.3    7e-20   Solanum tuberosum [potatoes]
ref|NP_001233910.1|  beta-D-xylosidase 1 precursor                    95.9    1e-19   Solanum lycopersicum
gb|EYU35409.1|  hypothetical protein MIMGU_mgv1a001738mg              94.0    5e-19   Erythranthe guttata [common monkey flower]
ref|XP_009403180.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  93.2    8e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011092407.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  92.8    1e-18   Sesamum indicum [beniseed]
ref|XP_004301992.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  92.0    2e-18   Fragaria vesca subsp. vesca
ref|XP_009347830.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  91.7    3e-18   
ref|XP_009401393.1|  PREDICTED: beta-D-xylosidase 4-like              91.3    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011465594.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  91.3    4e-18   Fragaria vesca subsp. vesca
ref|XP_007225245.1|  hypothetical protein PRUPE_ppa001692mg           91.3    5e-18   Prunus persica
ref|XP_009379698.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  90.9    6e-18   
ref|XP_008218886.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  90.9    6e-18   Prunus mume [ume]
ref|XP_008344154.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  90.5    7e-18   
ref|XP_004300692.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  90.5    8e-18   Fragaria vesca subsp. vesca
gb|EYU18509.1|  hypothetical protein MIMGU_mgv1a001665mg              90.5    8e-18   Erythranthe guttata [common monkey flower]
ref|XP_009628814.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  90.5    8e-18   Nicotiana tomentosiformis
emb|CDO97479.1|  unnamed protein product                              89.7    1e-17   Coffea canephora [robusta coffee]
ref|XP_008339210.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  89.4    2e-17   
ref|XP_009801214.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  89.4    2e-17   Nicotiana sylvestris
gb|KDP30704.1|  hypothetical protein JCGZ_16402                       89.0    3e-17   Jatropha curcas
emb|CAN78858.1|  hypothetical protein VITISV_030325                   88.6    3e-17   Vitis vinifera
ref|XP_009354080.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  88.6    4e-17   Pyrus x bretschneideri [bai li]
ref|XP_011087839.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  88.6    4e-17   Sesamum indicum [beniseed]
emb|CBI40687.3|  unnamed protein product                              88.2    4e-17   Vitis vinifera
gb|KCW63063.1|  hypothetical protein EUGRSUZ_G00654                   87.8    5e-17   Eucalyptus grandis [rose gum]
ref|XP_010937054.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  87.8    6e-17   Elaeis guineensis
ref|XP_010068200.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  87.8    7e-17   Eucalyptus grandis [rose gum]
ref|XP_010103839.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2    87.8    7e-17   Morus notabilis
ref|XP_002264183.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  87.8    7e-17   Vitis vinifera
ref|XP_002448619.1|  hypothetical protein SORBIDRAFT_06g030270        87.8    7e-17   Sorghum bicolor [broomcorn]
gb|KHG10349.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2         87.8    8e-17   Gossypium arboreum [tree cotton]
ref|XP_008661822.1|  PREDICTED: uncharacterized protein LOC100279...  87.4    9e-17   
ref|XP_008661823.1|  PREDICTED: uncharacterized protein LOC100279...  87.0    1e-16   Zea mays [maize]
gb|KJB31997.1|  hypothetical protein B456_005G218000                  87.0    1e-16   Gossypium raimondii
gb|KJB31995.1|  hypothetical protein B456_005G218000                  87.0    1e-16   Gossypium raimondii
ref|XP_010687471.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  86.7    1e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002513707.1|  Beta-glucosidase, putative                       86.7    1e-16   Ricinus communis
ref|XP_009407358.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  86.3    2e-16   
emb|CBI20072.3|  unnamed protein product                              84.0    2e-16   Vitis vinifera
ref|XP_004976989.1|  PREDICTED: beta-D-xylosidase 4-like isoform X2   86.3    2e-16   Setaria italica
gb|KJB31996.1|  hypothetical protein B456_005G218000                  85.5    2e-16   Gossypium raimondii
ref|XP_006394136.1|  hypothetical protein EUTSA_v10003678mg           86.3    2e-16   Eutrema salsugineum [saltwater cress]
ref|XP_006653810.1|  PREDICTED: beta-D-xylosidase 4-like              86.3    2e-16   
ref|XP_007043027.1|  Beta-D-xylosidase 4                              86.3    3e-16   
ref|XP_003580652.1|  PREDICTED: beta-D-xylosidase 4-like              85.9    3e-16   Brachypodium distachyon [annual false brome]
ref|XP_011087838.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  85.9    3e-16   Sesamum indicum [beniseed]
ref|XP_007159080.1|  hypothetical protein PHAVU_002G206800g           85.9    3e-16   Phaseolus vulgaris [French bean]
gb|ACL53913.1|  unknown                                               84.3    3e-16   Zea mays [maize]
ref|XP_002298197.2|  beta-glucosidase family protein                  85.5    4e-16   
emb|CAJ65922.1|  xylan 1,4-beta-xylosidase                            85.5    4e-16   Populus tremula x Populus alba [gray poplar]
ref|XP_010444394.1|  PREDICTED: beta-D-xylosidase 4-like              85.5    4e-16   Camelina sativa [gold-of-pleasure]
gb|EEE61783.1|  hypothetical protein OsJ_16354                        85.5    4e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010484241.1|  PREDICTED: beta-D-xylosidase 4                   85.5    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010065531.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  85.5    4e-16   Eucalyptus grandis [rose gum]
ref|NP_001146416.1|  uncharacterized protein LOC100279996             84.7    4e-16   
ref|NP_201262.1|  beta-D-xylosidase 4                                 85.5    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001054038.1|  Os04g0640700                                     85.5    5e-16   
ref|XP_002268626.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  85.1    5e-16   Vitis vinifera
ref|XP_011015574.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  85.1    5e-16   Populus euphratica
gb|AFW59618.1|  putative O-Glycosyl hydrolase superfamily protein     84.3    5e-16   
ref|XP_011046123.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  85.1    5e-16   Populus euphratica
gb|KHN39204.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2         84.7    6e-16   Glycine soja [wild soybean]
ref|XP_008784548.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...  85.1    6e-16   
dbj|BAD94481.1|  beta-xylosidase                                      84.3    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003531047.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  84.7    7e-16   Glycine max [soybeans]
emb|CAE03635.1|  OSJNBb0003B01.27                                     85.1    7e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002303181.1|  beta-glucosidase family protein                  84.7    7e-16   
ref|XP_002866623.1|  beta-xylosidase 4                                84.7    7e-16   Arabidopsis lyrata subsp. lyrata
gb|EYU18507.1|  hypothetical protein MIMGU_mgv1a001685mg              84.7    8e-16   Erythranthe guttata [common monkey flower]
gb|EYU18508.1|  hypothetical protein MIMGU_mgv1a001685mg              84.7    8e-16   Erythranthe guttata [common monkey flower]
ref|XP_009130462.1|  PREDICTED: beta-D-xylosidase 4-like              84.7    9e-16   Brassica rapa
ref|XP_011004967.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  84.3    1e-15   Populus euphratica
ref|XP_010261102.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  84.3    1e-15   Nelumbo nucifera [Indian lotus]
ref|XP_008455235.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  84.0    1e-15   Cucumis melo [Oriental melon]
gb|KFK28148.1|  hypothetical protein AALP_AA8G478800                  83.6    2e-15   Arabis alpina [alpine rockcress]
ref|XP_004504774.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  83.6    2e-15   Cicer arietinum [garbanzo]
gb|KEH31243.1|  beta-xylosidase/alpha-L-arabinofuranosidase-like ...  83.6    2e-15   Medicago truncatula
emb|CDY56487.1|  BnaCnng30450D                                        83.6    2e-15   Brassica napus [oilseed rape]
ref|XP_006280038.1|  hypothetical protein CARUB_v10025915mg           83.2    2e-15   Capsella rubella
ref|XP_010461983.1|  PREDICTED: beta-D-xylosidase 4-like              83.2    2e-15   Camelina sativa [gold-of-pleasure]
emb|CDY51290.1|  BnaA06g23560D                                        83.2    2e-15   Brassica napus [oilseed rape]
ref|XP_009150540.1|  PREDICTED: beta-D-xylosidase 4                   83.2    2e-15   Brassica rapa
dbj|BAE44362.1|  alpha-L-arabinofuranosidase                          83.2    3e-15   Raphanus sativus
emb|CDY31313.1|  BnaA02g34280D                                        82.8    4e-15   Brassica napus [oilseed rape]
ref|XP_003593145.1|  Beta-xylosidase/alpha-L-arabinofuranosidase      82.8    4e-15   Medicago truncatula
sp|A5JTQ2.1|XYL1_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...  82.8    4e-15   Medicago sativa subsp. x varia
gb|KHN26728.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 1         82.0    5e-15   Glycine soja [wild soybean]
ref|XP_010243340.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  82.4    5e-15   Nelumbo nucifera [Indian lotus]
ref|XP_003531557.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  82.4    5e-15   Glycine max [soybeans]
ref|XP_009112141.1|  PREDICTED: beta-D-xylosidase 4-like              82.0    6e-15   Brassica rapa
emb|CDY18705.1|  BnaA09g06900D                                        82.0    6e-15   Brassica napus [oilseed rape]
emb|CDY46812.1|  BnaC02g43200D                                        81.6    8e-15   Brassica napus [oilseed rape]
dbj|BAK03439.1|  predicted protein                                    81.3    9e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004136861.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  81.3    1e-14   
emb|CDX97115.1|  BnaC09g45100D                                        81.3    1e-14   
gb|KCW63062.1|  hypothetical protein EUGRSUZ_G006531                  80.9    1e-14   Eucalyptus grandis [rose gum]
ref|XP_009122535.1|  PREDICTED: beta-D-xylosidase 3-like              81.3    1e-14   Brassica rapa
ref|XP_006493288.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  80.9    1e-14   Citrus sinensis [apfelsine]
dbj|BAJ90420.1|  predicted protein                                    80.9    1e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90315.1|  predicted protein                                    80.9    1e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010065530.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  80.9    1e-14   Eucalyptus grandis [rose gum]
ref|XP_006432467.1|  hypothetical protein CICLE_v10000355mg           80.9    1e-14   Citrus clementina [clementine]
ref|XP_004155509.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  80.9    1e-14   
emb|CDX81229.1|  BnaC09g06400D                                        80.9    1e-14   
ref|XP_010065527.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  80.9    1e-14   Eucalyptus grandis [rose gum]
sp|A5JTQ3.1|XYL2_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...  80.9    1e-14   Medicago sativa subsp. x varia
gb|KFK25272.1|  hypothetical protein AALP_AA8G090500                  80.9    2e-14   Arabis alpina [alpine rockcress]
gb|KCW63060.1|  hypothetical protein EUGRSUZ_G00652                   80.1    2e-14   Eucalyptus grandis [rose gum]
ref|XP_010452969.1|  PREDICTED: beta-D-xylosidase 3-like              80.9    2e-14   Camelina sativa [gold-of-pleasure]
dbj|BAK01582.1|  predicted protein                                    80.5    2e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY35825.1|  BnaC09g37570D                                        80.5    2e-14   Brassica napus [oilseed rape]
gb|KHN33504.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 1         80.5    2e-14   Glycine soja [wild soybean]
ref|XP_003547598.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  80.5    2e-14   Glycine max [soybeans]
ref|XP_010068199.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...  79.7    2e-14   Eucalyptus grandis [rose gum]
ref|XP_004485551.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  80.5    2e-14   Cicer arietinum [garbanzo]
ref|XP_002873418.1|  beta-xylosidase 3                                80.1    3e-14   Arabidopsis lyrata subsp. lyrata
gb|AAK38481.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase iso...  80.1    3e-14   Hordeum vulgare [barley]
gb|ACH60354.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase         74.7    4e-14   Pseudotsuga menziesii
gb|EMT32951.1|  Beta-D-xylosidase 4                                   79.7    4e-14   
gb|KJB77499.1|  hypothetical protein B456_012G140300                  79.7    4e-14   Gossypium raimondii
emb|CDX69892.1|  BnaA10g22410D                                        79.3    5e-14   
ref|XP_010422951.1|  PREDICTED: beta-D-xylosidase 3 isoform X2        79.3    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010422950.1|  PREDICTED: beta-D-xylosidase 3 isoform X1        79.3    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006399455.1|  hypothetical protein EUTSA_v10012739mg           79.0    6e-14   Eutrema salsugineum [saltwater cress]
ref|XP_010065529.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  79.0    7e-14   Eucalyptus grandis [rose gum]
ref|XP_010491610.1|  PREDICTED: beta-D-xylosidase 3-like isoform X1   78.6    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010491609.1|  PREDICTED: beta-D-xylosidase 4-like              78.6    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010491611.1|  PREDICTED: beta-D-xylosidase 3-like isoform X2   78.2    1e-13   Camelina sativa [gold-of-pleasure]
emb|CAB89360.1|  beta-glucosidase-like protein                        77.0    1e-13   Arabidopsis thaliana [mouse-ear cress]
gb|KHG02719.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2         77.4    2e-13   Gossypium arboreum [tree cotton]
ref|NP_196532.2|  Glycosyl hydrolase family protein                   77.0    2e-13   Arabidopsis thaliana [mouse-ear cress]
gb|ACH60351.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase         72.4    3e-13   Pseudotsuga menziesii
ref|XP_007148433.1|  hypothetical protein PHAVU_006G208200g           76.6    4e-13   Phaseolus vulgaris [French bean]
dbj|BAD94522.1|  beta-xylosidase - like protein                       73.9    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006827121.1|  hypothetical protein AMTR_s00010p00246460        75.5    1e-12   Amborella trichopoda
ref|XP_010520456.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...  75.1    1e-12   
emb|CDY01780.1|  BnaC06g28200D                                        75.1    1e-12   
ref|XP_010546362.1|  PREDICTED: beta-D-xylosidase 4                   74.3    2e-12   Tarenaya hassleriana [spider flower]
ref|NP_196535.1|  beta-xylosidase 3                                   74.3    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010424711.1|  PREDICTED: beta-D-xylosidase 4-like              74.3    3e-12   
gb|AEW09080.1|  hypothetical protein CL3618Contig1_02                 66.6    2e-11   Pinus lambertiana
gb|AEW09079.1|  hypothetical protein CL3618Contig1_02                 65.1    7e-11   Pinus radiata
gb|AFG54596.1|  hypothetical protein 0_6952_01                        65.9    8e-11   Pinus taeda
gb|EPS65933.1|  hypothetical protein M569_08842                       69.7    8e-11   Genlisea aurea
gb|AFG54601.1|  hypothetical protein 0_6952_01                        65.9    8e-11   Pinus taeda
gb|AFG54595.1|  hypothetical protein 0_6952_01                        65.9    9e-11   Pinus taeda
gb|AFG54602.1|  hypothetical protein 0_6952_01                        65.5    1e-10   Pinus taeda
emb|CDX96113.1|  BnaA07g26180D                                        69.3    1e-10   
ref|XP_010268028.1|  PREDICTED: probable beta-D-xylosidase 2          68.9    2e-10   Nelumbo nucifera [Indian lotus]
gb|KJB49844.1|  hypothetical protein B456_008G140600                  68.9    2e-10   Gossypium raimondii
ref|XP_006419427.1|  hypothetical protein CICLE_v10004369mg           67.8    4e-10   
ref|XP_011015623.1|  PREDICTED: probable beta-D-xylosidase 2          67.8    4e-10   Populus euphratica
ref|XP_011042236.1|  PREDICTED: probable beta-D-xylosidase 2          67.8    4e-10   Populus euphratica
ref|XP_011041424.1|  PREDICTED: probable beta-D-xylosidase 2          67.8    4e-10   Populus euphratica
ref|XP_002302758.2|  hypothetical protein POPTR_0002s19830g           67.4    5e-10   
ref|XP_009105246.1|  PREDICTED: beta-D-xylosidase 3-like              67.4    5e-10   Brassica rapa
gb|AFG60329.1|  hypothetical protein CL3618Contig1_02                 62.8    6e-10   Pinus taeda
gb|KDO71845.1|  hypothetical protein CISIN_1g0062242mg                66.6    6e-10   Citrus sinensis [apfelsine]
gb|KDO71844.1|  hypothetical protein CISIN_1g0062242mg                66.6    7e-10   Citrus sinensis [apfelsine]
ref|XP_007035744.1|  Periplasmic beta-glucosidase, putative           67.0    7e-10   
gb|KDO71843.1|  hypothetical protein CISIN_1g0062242mg                66.2    8e-10   Citrus sinensis [apfelsine]
ref|XP_002320310.2|  hypothetical protein POPTR_0014s11730g           67.0    8e-10   
ref|XP_009348894.1|  PREDICTED: putative beta-D-xylosidase            67.0    8e-10   
gb|EYU46800.1|  hypothetical protein MIMGU_mgv1a018473mg              67.0    8e-10   Erythranthe guttata [common monkey flower]
ref|XP_006444470.1|  hypothetical protein CICLE_v10018959mg           67.0    8e-10   Citrus clementina [clementine]
ref|XP_008341125.1|  PREDICTED: putative beta-D-xylosidase            66.6    9e-10   
ref|XP_008390557.1|  PREDICTED: putative beta-D-xylosidase            66.6    9e-10   
ref|XP_003519750.1|  PREDICTED: probable beta-D-xylosidase 2-like     66.6    9e-10   Glycine max [soybeans]
gb|KHN08645.1|  Putative beta-D-xylosidase 2                          66.6    9e-10   Glycine soja [wild soybean]
ref|XP_009369955.1|  PREDICTED: putative beta-D-xylosidase            66.6    9e-10   
emb|CDP20993.1|  unnamed protein product                              62.0    9e-10   Coffea canephora [robusta coffee]
gb|KHG14371.1|  Beta-D-xylosidase 1 -like protein                     66.6    1e-09   Gossypium arboreum [tree cotton]
emb|CAJ41429.1|  beta (1,4)-xylosidase                                66.6    1e-09   Populus tremula x Populus alba [gray poplar]
gb|KDO71842.1|  hypothetical protein CISIN_1g0062242mg                65.5    1e-09   Citrus sinensis [apfelsine]
gb|KDP28242.1|  hypothetical protein JCGZ_14013                       66.2    1e-09   Jatropha curcas
gb|KJB72795.1|  hypothetical protein B456_011G198200                  66.2    1e-09   Gossypium raimondii
ref|NP_001280797.1|  putative beta-D-xylosidase precursor             66.2    1e-09   Malus domestica [apple tree]
gb|KDO71849.1|  hypothetical protein CISIN_1g0062242mg                65.1    2e-09   Citrus sinensis [apfelsine]
gb|KHG05051.1|  putative beta-D-xylosidase 2 -like protein            65.9    2e-09   Gossypium arboreum [tree cotton]
gb|KDO87030.1|  hypothetical protein CISIN_1g0041901mg                65.5    2e-09   Citrus sinensis [apfelsine]
emb|CDP17082.1|  unnamed protein product                              62.8    2e-09   Coffea canephora [robusta coffee]
ref|XP_009593976.1|  PREDICTED: probable beta-D-xylosidase 2          65.5    3e-09   Nicotiana tomentosiformis
ref|XP_003535953.1|  PREDICTED: probable beta-D-xylosidase 2          64.7    4e-09   Glycine max [soybeans]
gb|KJB09457.1|  hypothetical protein B456_001G143600                  64.7    4e-09   Gossypium raimondii
ref|XP_010024778.1|  PREDICTED: putative beta-D-xylosidase            64.7    4e-09   Eucalyptus grandis [rose gum]
ref|XP_011079568.1|  PREDICTED: probable beta-D-xylosidase 2          64.7    4e-09   Sesamum indicum [beniseed]
ref|XP_010094323.1|  Beta-D-xylosidase 1                              64.3    5e-09   Morus notabilis
gb|KCW61272.1|  hypothetical protein EUGRSUZ_H04033                   64.3    5e-09   Eucalyptus grandis [rose gum]
ref|XP_009378701.1|  PREDICTED: probable beta-D-xylosidase 2          64.3    6e-09   Pyrus x bretschneideri [bai li]
ref|XP_007051080.1|  Beta-xylosidase 2                                64.3    6e-09   
ref|XP_008353169.1|  PREDICTED: putative beta-D-xylosidase            64.3    6e-09   
ref|XP_010259348.1|  PREDICTED: putative beta-D-xylosidase            64.3    6e-09   Nelumbo nucifera [Indian lotus]
emb|CDO98788.1|  unnamed protein product                              63.9    7e-09   Coffea canephora [robusta coffee]
gb|KHG28205.1|  putative beta-D-xylosidase 2 -like protein            63.2    9e-09   Gossypium arboreum [tree cotton]
ref|XP_006399554.1|  hypothetical protein EUTSA_v10012725mg           63.5    1e-08   Eutrema salsugineum [saltwater cress]
ref|XP_006349198.1|  PREDICTED: probable beta-D-xylosidase 2-like     63.5    1e-08   Solanum tuberosum [potatoes]
ref|XP_010481135.1|  PREDICTED: probable beta-D-xylosidase 2          63.2    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010457247.1|  PREDICTED: probable beta-D-xylosidase 2          63.2    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010679361.1|  PREDICTED: probable beta-D-xylosidase 2          63.2    1e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002889410.1|  hypothetical protein ARALYDRAFT_470222           62.8    2e-08   
ref|XP_002515300.1|  Beta-glucosidase, putative                       62.8    2e-08   Ricinus communis
ref|XP_010087253.1|  putative beta-D-xylosidase 2                     62.8    2e-08   Morus notabilis
ref|XP_010546993.1|  PREDICTED: beta-D-xylosidase 1-like isoform X1   62.4    2e-08   Tarenaya hassleriana [spider flower]
ref|XP_002316021.1|  beta-D-xylosidase family protein                 62.4    2e-08   Populus trichocarpa [western balsam poplar]
dbj|BAD98523.1|  alpha-L-arabinofuranosidase / beta-D-xylosidase      62.4    2e-08   Pyrus pyrifolia [sha li]
dbj|BAF79669.1|  beta-D-xylosidase                                    62.4    2e-08   Pyrus pyrifolia [sha li]
gb|AGR44452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase 2       62.4    2e-08   Pyrus x bretschneideri [bai li]
gb|AAG10624.1|AC022521_2  Similar to xylosidase                       62.4    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25328.1|  hypothetical protein AALP_AA8G098500                  62.4    2e-08   Arabis alpina [alpine rockcress]
ref|NP_563659.1|  probable beta-D-xylosidase 2                        62.4    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001266107.1|  SlArf/Xyl2 protein precursor                     62.4    2e-08   Solanum lycopersicum
dbj|BAC41913.1|  putative beta-xylosidase                             62.4    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306829.1|  hypothetical protein CARUB_v10008371mg           62.4    3e-08   Capsella rubella
ref|XP_010652235.1|  PREDICTED: probable beta-D-xylosidase 2 isof...  62.0    3e-08   Vitis vinifera
ref|XP_009757165.1|  PREDICTED: probable beta-D-xylosidase 2          62.0    3e-08   Nicotiana sylvestris
ref|XP_006306830.1|  hypothetical protein CARUB_v10008371mg           62.0    3e-08   
ref|NP_196618.1|  putative beta-D-xylosidase 6                        62.0    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002270249.1|  PREDICTED: probable beta-D-xylosidase 2 isof...  62.0    3e-08   Vitis vinifera
ref|XP_011020382.1|  PREDICTED: putative beta-D-xylosidase            62.0    4e-08   Populus euphratica
ref|XP_006855294.1|  hypothetical protein AMTR_s00057p00049120        62.0    4e-08   Amborella trichopoda
gb|KJB38535.1|  hypothetical protein B456_006G259500                  61.6    4e-08   Gossypium raimondii
ref|XP_011009934.1|  PREDICTED: putative beta-D-xylosidase            61.6    4e-08   Populus euphratica
ref|XP_009339788.1|  PREDICTED: probable beta-D-xylosidase 2          61.6    5e-08   Pyrus x bretschneideri [bai li]
ref|XP_004300463.1|  PREDICTED: probable beta-D-xylosidase 2          61.2    5e-08   Fragaria vesca subsp. vesca
ref|XP_004136155.1|  PREDICTED: probable beta-D-xylosidase 2-like     61.2    6e-08   Cucumis sativus [cucumbers]
gb|ABK96385.1|  unknown                                               60.1    6e-08   Populus trichocarpa x Populus deltoides
ref|XP_011082425.1|  PREDICTED: probable beta-D-xylosidase 2          61.2    6e-08   Sesamum indicum [beniseed]
ref|XP_002311398.2|  beta-D-xylosidase family protein                 61.2    6e-08   
ref|XP_008386729.1|  PREDICTED: probable beta-D-xylosidase 2          61.2    6e-08   
gb|EYU23074.1|  hypothetical protein MIMGU_mgv1a019840mg              60.8    7e-08   Erythranthe guttata [common monkey flower]
ref|XP_008451490.1|  PREDICTED: probable beta-D-xylosidase 2          60.8    8e-08   Cucumis melo [Oriental melon]
ref|XP_010453089.1|  PREDICTED: probable beta-D-xylosidase 6          60.5    1e-07   
gb|KDP27887.1|  hypothetical protein JCGZ_18967                       60.5    1e-07   Jatropha curcas
ref|XP_003591420.1|  Beta xylosidase                                  60.1    1e-07   Medicago truncatula
ref|XP_010491733.1|  PREDICTED: probable beta-D-xylosidase 6          60.1    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_007138975.1|  hypothetical protein PHAVU_009G254300g           60.1    1e-07   Phaseolus vulgaris [French bean]
emb|CDX97026.1|  BnaC09g45990D                                        60.1    1e-07   
emb|CDY15255.1|  BnaC05g01340D                                        60.1    1e-07   Brassica napus [oilseed rape]
ref|XP_006287090.1|  hypothetical protein CARUB_v10000252mg           60.1    1e-07   
ref|XP_009119616.1|  PREDICTED: probable beta-D-xylosidase 2          59.7    2e-07   Brassica rapa
ref|XP_009111875.1|  PREDICTED: beta-D-xylosidase 1-like              59.7    2e-07   Brassica rapa
emb|CDY49607.1|  BnaA09g03310D                                        59.7    2e-07   Brassica napus [oilseed rape]
ref|XP_006280043.1|  hypothetical protein CARUB_v10025920mg           59.7    2e-07   Capsella rubella
ref|XP_004295104.1|  PREDICTED: putative beta-D-xylosidase            59.7    2e-07   Fragaria vesca subsp. vesca
emb|CDX85405.1|  BnaC07g27160D                                        59.7    2e-07   
ref|XP_006395069.1|  hypothetical protein EUTSA_v10003681mg           59.7    2e-07   Eutrema salsugineum [saltwater cress]
ref|XP_009151303.1|  PREDICTED: beta-D-xylosidase 1                   59.3    2e-07   Brassica rapa
emb|CDX89954.1|  BnaA10g01280D                                        59.3    2e-07   
ref|XP_010254644.1|  PREDICTED: probable beta-D-xylosidase 6          59.3    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_006418321.1|  hypothetical protein EUTSA_v10006876mg           59.3    3e-07   Eutrema salsugineum [saltwater cress]
ref|XP_004151112.1|  PREDICTED: beta-D-xylosidase 1-like              58.9    3e-07   Cucumis sativus [cucumbers]
ref|XP_009129779.1|  PREDICTED: beta-D-xylosidase 1-like              58.9    3e-07   Brassica rapa
emb|CDY33913.1|  BnaA02g30740D                                        58.9    3e-07   Brassica napus [oilseed rape]
gb|KFK26586.1|  hypothetical protein AALP_AA8G267600                  58.9    3e-07   Arabis alpina [alpine rockcress]
ref|XP_010442400.1|  PREDICTED: beta-D-xylosidase 1-like              58.5    3e-07   
emb|CDY21595.1|  BnaC09g46970D                                        58.9    3e-07   Brassica napus [oilseed rape]
ref|XP_010482214.1|  PREDICTED: beta-D-xylosidase 1-like              58.5    4e-07   Camelina sativa [gold-of-pleasure]
ref|XP_002865732.1|  beta-xylosidase 1                                58.5    4e-07   Arabidopsis lyrata subsp. lyrata
gb|AAS17751.2|  beta xylosidase                                       58.5    4e-07   Fragaria x ananassa
emb|CDY05634.1|  BnaC02g39030D                                        58.5    4e-07   
ref|NP_199747.1|  bifunctional {beta}-D-xylosidase/{alpha}-L-arab...  58.5    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007145157.1|  hypothetical protein PHAVU_007G215100g           58.5    4e-07   Phaseolus vulgaris [French bean]
ref|XP_010440503.1|  PREDICTED: beta-D-xylosidase 1                   58.5    4e-07   Camelina sativa [gold-of-pleasure]
dbj|BAO45878.1|  beta-D-xylosidase                                    58.2    5e-07   Acacia mangium
gb|KFK42620.1|  hypothetical protein AALP_AA1G019000                  58.2    5e-07   Arabis alpina [alpine rockcress]
ref|XP_004172482.1|  PREDICTED: beta-D-xylosidase 1-like              58.2    5e-07   
ref|XP_010671663.1|  PREDICTED: beta-D-xylosidase 1                   58.2    5e-07   Beta vulgaris subsp. vulgaris [field beet]
gb|ACD93208.1|  beta xylosidase                                       58.2    5e-07   Camellia sinensis [black tea]
ref|XP_009400278.1|  PREDICTED: probable beta-D-xylosidase 6          58.2    6e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383731.1|  PREDICTED: probable beta-D-xylosidase 2          58.2    6e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004162442.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  58.2    6e-07   
gb|KHN14659.1|  Beta-D-xylosidase 1                                   57.8    6e-07   Glycine soja [wild soybean]
ref|XP_002873465.1|  glycosyl hydrolase family 3 protein              57.8    8e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_010527498.1|  PREDICTED: probable beta-D-xylosidase 6          57.8    8e-07   Tarenaya hassleriana [spider flower]
ref|XP_008223305.1|  PREDICTED: putative beta-D-xylosidase            57.8    8e-07   
gb|ADV41671.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase         57.4    9e-07   
gb|AFU54452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase         57.4    1e-06   
gb|AFU54451.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase         57.4    1e-06   
gb|KCW59657.1|  hypothetical protein EUGRSUZ_H02409                   57.4    1e-06   
emb|CDY00033.1|  BnaC09g02680D                                        57.4    1e-06   
gb|KHN12900.1|  Beta-D-xylosidase 1                                   57.0    1e-06   
dbj|BAJ51947.1|  putative beta-D-xylosidase                           55.8    1e-06   
emb|CBI22910.3|  unnamed protein product                              57.0    1e-06   
ref|XP_010522822.1|  PREDICTED: probable beta-D-xylosidase 2          57.0    1e-06   
emb|CDX69822.1|  BnaA10g21710D                                        56.6    2e-06   
ref|XP_002276351.1|  PREDICTED: putative beta-D-xylosidase            56.6    2e-06   
ref|XP_008458374.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...  56.6    2e-06   
ref|XP_010683056.1|  PREDICTED: probable beta-D-xylosidase 6          56.2    2e-06   
ref|XP_010023414.1|  PREDICTED: probable beta-D-xylosidase 6          56.2    2e-06   
ref|XP_007225668.1|  hypothetical protein PRUPE_ppa001718mg           56.2    2e-06   
ref|NP_001266104.1|  SlArf/Xyl1 protein precursor                     55.8    3e-06   
ref|XP_011026854.1|  PREDICTED: probable beta-D-xylosidase 6 isof...  55.8    3e-06   
gb|KDP32160.1|  hypothetical protein JCGZ_12621                       55.8    3e-06   
ref|XP_009122041.1|  PREDICTED: probable beta-D-xylosidase 6          55.8    3e-06   
dbj|BAQ19511.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase        55.8    3e-06   
ref|XP_010313018.1|  PREDICTED: slArf/Xyl1 protein isoform X1         55.5    4e-06   
ref|XP_010069867.1|  PREDICTED: probable beta-D-xylosidase 2          55.5    4e-06   
dbj|BAF02134.1|  xylosidase                                           54.3    4e-06   
gb|KJB44020.1|  hypothetical protein B456_007G230000                  55.5    5e-06   
gb|KCW58371.1|  hypothetical protein EUGRSUZ_H010551                  55.1    5e-06   
ref|XP_002519194.1|  Periplasmic beta-glucosidase precursor, puta...  55.1    6e-06   
ref|XP_008235191.1|  PREDICTED: probable beta-D-xylosidase 2          54.7    7e-06   
ref|XP_007200621.1|  hypothetical protein PRUPE_ppa001656mg           54.7    7e-06   
gb|KHN19223.1|  Putative beta-D-xylosidase 2                          54.3    9e-06   
dbj|BAF43576.1|  arabinofuranosidase/xylosidase homolog               53.1    1e-05   
ref|XP_003546334.1|  PREDICTED: beta-D-xylosidase 1-like              53.9    1e-05   
ref|XP_003625957.1|  Beta-xylosidase                                  53.9    1e-05   
ref|XP_008808663.1|  PREDICTED: beta-D-xylosidase 1-like              53.9    1e-05   
ref|XP_007163167.1|  hypothetical protein PHAVU_001G212100g           53.5    2e-05   
emb|CDP02677.1|  unnamed protein product                              53.5    2e-05   
sp|P83344.1|XYNB_PRUPE  RecName: Full=Putative beta-D-xylosidase;...  53.1    2e-05   
ref|XP_010687347.1|  PREDICTED: probable beta-D-xylosidase 5          53.5    2e-05   
gb|KDO78722.1|  hypothetical protein CISIN_1g003606mg                 53.5    2e-05   
gb|KDO78723.1|  hypothetical protein CISIN_1g003606mg                 53.5    2e-05   
ref|XP_006466365.1|  PREDICTED: probable beta-D-xylosidase 6-like     53.5    2e-05   
ref|XP_006426203.1|  hypothetical protein CICLE_v10024911mg           53.5    2e-05   
ref|XP_008454298.1|  PREDICTED: probable beta-D-xylosidase 2 isof...  53.5    2e-05   
ref|XP_008796726.1|  PREDICTED: probable beta-D-xylosidase 6          53.1    2e-05   
ref|XP_010914548.1|  PREDICTED: probable beta-D-xylosidase 2          53.1    2e-05   
ref|XP_011100796.1|  PREDICTED: beta-D-xylosidase 1                   53.1    2e-05   
ref|XP_006850394.1|  hypothetical protein AMTR_s00184p00056440        53.1    2e-05   
ref|XP_003533205.2|  PREDICTED: beta-D-xylosidase 1-like              53.1    3e-05   
ref|XP_008454299.1|  PREDICTED: probable beta-D-xylosidase 2 isof...  52.8    3e-05   
ref|XP_003534261.1|  PREDICTED: probable beta-D-xylosidase 6-like     52.8    3e-05   
ref|XP_006352077.1|  PREDICTED: beta-D-xylosidase 1-like              52.8    3e-05   
ref|XP_007047697.1|  Glycosyl hydrolase family protein                52.8    4e-05   
emb|CBI25718.3|  unnamed protein product                              52.4    4e-05   
ref|XP_002264031.2|  PREDICTED: probable beta-D-xylosidase 6          52.4    4e-05   
ref|XP_004288313.2|  PREDICTED: probable beta-D-xylosidase 6 isof...  52.4    4e-05   
ref|XP_009404942.1|  PREDICTED: probable beta-D-xylosidase 6          52.4    4e-05   
gb|AAP83934.1|  auxin-induced beta-glucosidase                        52.4    4e-05   
gb|KGN48676.1|  hypothetical protein Csa_6G497270                     52.0    4e-05   
gb|KHN38910.1|  Putative beta-D-xylosidase 6                          52.0    4e-05   
ref|XP_004160150.1|  PREDICTED: probable beta-D-xylosidase 6-like     52.0    5e-05   
ref|XP_004143540.1|  PREDICTED: probable beta-D-xylosidase 6-like     52.0    5e-05   
ref|XP_008440505.1|  PREDICTED: probable beta-D-xylosidase 6          52.0    6e-05   
ref|XP_004494414.1|  PREDICTED: probable beta-D-xylosidase 2-like     52.0    6e-05   
ref|XP_004487789.1|  PREDICTED: beta-D-xylosidase 1-like              51.6    7e-05   
ref|XP_010556264.1|  PREDICTED: beta-D-xylosidase 1-like              51.6    7e-05   
ref|XP_010105119.1|  putative beta-D-xylosidase 6                     51.6    7e-05   
ref|XP_004979939.1|  PREDICTED: probable beta-D-xylosidase 2-like     51.6    8e-05   
ref|XP_004512546.1|  PREDICTED: probable beta-D-xylosidase 6-like     51.6    8e-05   
ref|XP_002963750.1|  hypothetical protein SELMODRAFT_80102            51.2    8e-05   
ref|XP_003594795.1|  Beta xylosidase                                  51.2    8e-05   
ref|XP_003520749.2|  PREDICTED: probable beta-D-xylosidase 2-like     51.2    1e-04   
ref|XP_002974833.1|  hypothetical protein SELMODRAFT_101733           50.8    1e-04   
ref|XP_003554544.1|  PREDICTED: probable beta-D-xylosidase 2-like     50.8    1e-04   
ref|XP_010918501.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  50.4    1e-04   
gb|KHN43468.1|  Putative beta-D-xylosidase 2                          50.8    1e-04   
ref|XP_011457868.1|  PREDICTED: probable beta-D-xylosidase 5          50.1    2e-04   
ref|NP_001053392.1|  Os04g0530700                                     50.1    2e-04   
ref|XP_002527213.1|  Thermostable beta-glucosidase B, putative        49.7    2e-04   
emb|CAJ86207.1|  B1011H02.4                                           50.1    2e-04   
gb|EEE61389.1|  hypothetical protein OsJ_15562                        50.1    2e-04   
ref|XP_004231972.1|  PREDICTED: probable beta-D-xylosidase 6          49.7    3e-04   
ref|XP_009609889.1|  PREDICTED: putative beta-D-xylosidase            48.9    4e-04   
ref|XP_006357757.1|  PREDICTED: probable beta-D-xylosidase 6-like     49.3    4e-04   
gb|EPS60429.1|  hypothetical protein M569_14372                       48.5    7e-04   
ref|XP_003612944.1|  Beta-D-xylosidase                                48.5    7e-04   
ref|XP_007158321.1|  hypothetical protein PHAVU_002G142900g           48.5    7e-04   
ref|XP_008385726.1|  PREDICTED: probable beta-D-xylosidase 6          48.5    7e-04   
gb|ABY48135.1|  beta-D-xylosidase                                     48.5    8e-04   
ref|XP_009804071.1|  PREDICTED: beta-D-xylosidase 1 isoform X2        48.1    9e-04   
ref|XP_009804070.1|  PREDICTED: beta-D-xylosidase 1 isoform X1        48.1    0.001   



>dbj|BAC98299.1| LEXYL2 [Solanum lycopersicum]
Length=633

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 51/71 (72%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            +SPP++HNAP+K L+ FQK+ L+P  + VV FN+DVCKHLSVVDE GNRKVALGLHVLHI
Sbjct  563  TSPPSVHNAPQKHLLDFQKIHLTPQSEGVVKFNLDVCKHLSVVDEVGNRKVALGLHVLHI  622

Query  190  GHLKHSLTVEI  222
            G LKHSLT+ I
Sbjct  623  GDLKHSLTLRI  633



>ref|XP_006351808.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=778

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 51/71 (72%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            +SPP++HNAP+K L+ FQK+ L+P  + VV FN+DVCKHLSVVDE GNRKVALGLHVLHI
Sbjct  708  TSPPSVHNAPQKHLLDFQKIHLTPQSEGVVKFNLDVCKHLSVVDEVGNRKVALGLHVLHI  767

Query  190  GHLKHSLTVEI  222
            G LKHSLT+ I
Sbjct  768  GDLKHSLTLRI  778



>ref|XP_004230547.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Solanum 
lycopersicum]
Length=778

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 51/71 (72%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            +SPP++HNAP+K L+ FQK+ L+P  + VV FN+DVCKHLSVVDE GNRKVALGLHVLHI
Sbjct  708  TSPPSVHNAPQKHLLDFQKIHLTPQSEGVVKFNLDVCKHLSVVDEVGNRKVALGLHVLHI  767

Query  190  GHLKHSLTVEI  222
            G LKHSLT+ I
Sbjct  768  GDLKHSLTLRI  778



>ref|XP_009612011.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=778

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            +SPP++HNAP+K L+ FQK+ L+P  + +V F +DVCKHLSVVDE GN+KVALGLHVLHI
Sbjct  708  TSPPSVHNAPQKHLLEFQKIHLTPQSEGIVKFKLDVCKHLSVVDEVGNKKVALGLHVLHI  767

Query  190  GHLKHSLTVEI  222
            G LKHSLTV I
Sbjct  768  GDLKHSLTVRI  778



>ref|XP_009762535.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=779

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            +SPP++HNAP+K L+ FQK+ L+P  + +V F +DVCKHLSVVDE GN+KVALGLHVLHI
Sbjct  709  TSPPSVHNAPQKHLLEFQKIHLTPQSEGIVKFKLDVCKHLSVVDEVGNKKVALGLHVLHI  768

Query  190  GHLKHSLTVEI  222
            G LKHSLTV I
Sbjct  769  GDLKHSLTVRI  779



>ref|XP_006341844.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=806

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 52/71 (73%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            +SPP++HNAP+K L+GF+KV L+P  + VV FNVDVCKHLSV DE GNRKVALG HVLHI
Sbjct  736  TSPPSVHNAPKKHLLGFEKVHLTPQGEGVVKFNVDVCKHLSVHDELGNRKVALGPHVLHI  795

Query  190  GHLKHSLTVEI  222
            G LKHSLTV I
Sbjct  796  GDLKHSLTVRI  806



>ref|NP_001233910.1| beta-D-xylosidase 1 precursor [Solanum lycopersicum]
 dbj|BAC98298.1| LEXYL1 [Solanum lycopersicum]
Length=770

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 51/71 (72%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            +SPP++HNAP+K L+GF+KV L+P  + VV FNV+VCKHLSV DE GNRKVALG HVLHI
Sbjct  700  TSPPSVHNAPKKHLLGFEKVHLTPQGEGVVKFNVNVCKHLSVHDELGNRKVALGPHVLHI  759

Query  190  GHLKHSLTVEI  222
            G LKHSLTV I
Sbjct  760  GDLKHSLTVRI  770



>gb|EYU35409.1| hypothetical protein MIMGU_mgv1a001738mg [Erythranthe guttata]
Length=767

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP +H APRKQL+GF+KV L P  + VV FNVDVCKHLS+VDE GNRKVALG HVLH+
Sbjct  697  SSPPEVHGAPRKQLLGFEKVHLVPQGEGVVRFNVDVCKHLSLVDEKGNRKVALGEHVLHV  756

Query  190  GHLKHSLTVEI  222
            G+LKHSL V I
Sbjct  757  GNLKHSLNVII  767



>ref|XP_009403180.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Musa acuminata subsp. malaccensis]
Length=769

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPPA+HNAPRK L+GF+KV L P     VVF VDVCK LSVVDE GNRK+ALG HVLH 
Sbjct  699  SSPPAVHNAPRKHLLGFEKVYLGPKAAGDVVFKVDVCKDLSVVDELGNRKLALGSHVLHA  758

Query  190  GHLKHSLTVEI  222
            G LKHSL+++I
Sbjct  759  GSLKHSLSLKI  769



>ref|XP_011092407.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP +HNAP+K L+GFQK+ L P  + +V FNVDVCKHLSVVDE GNRKVALG H+LH+
Sbjct  698  SSPPQVHNAPQKHLLGFQKLHLEPQGEGLVRFNVDVCKHLSVVDEKGNRKVALGEHLLHV  757

Query  190  GHLKHSLTVEI  222
            G LKHSL + +
Sbjct  758  GSLKHSLNLRV  768



>ref|XP_004301992.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=774

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++HNAP+K L+GF+KV LS  ++ +V FNVDVCKHLSVVDE GNRKVALG HVLH+
Sbjct  704  SSPPSVHNAPKKHLLGFEKVFLSSQKEALVKFNVDVCKHLSVVDELGNRKVALGDHVLHV  763

Query  190  GHLKHSLTVEI  222
            G LK +L+V I
Sbjct  764  GDLKQTLSVRI  774



>ref|XP_009347830.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPPA+H +P+K L+GF+KV LS   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+
Sbjct  703  SSPPAVHKSPQKHLLGFEKVFLSAQREALVKFNVDVCKHLSVVDELGNRKVALGEHVLHV  762

Query  190  GHLKHSLTVEI  222
            G LKHS +V I
Sbjct  763  GSLKHSFSVRI  773



>ref|XP_009401393.1| PREDICTED: beta-D-xylosidase 4-like [Musa acuminata subsp. malaccensis]
Length=770

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PPA+H APRK LVGF+KV L P     VVF VDVCK LSVVDE GNRK+ALG HVLH+
Sbjct  700  STPPAVHGAPRKHLVGFEKVFLGPKAVGQVVFKVDVCKDLSVVDELGNRKLALGSHVLHV  759

Query  190  GHLKHSLTVEI  222
            G LKHSL++++
Sbjct  760  GSLKHSLSLKV  770



>ref|XP_011465594.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=799

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++HNAP+K L+GF+KV LS  ++ +V FNVDVCKHLSVVDE GNRKVALG HVLH+
Sbjct  729  SSPPSVHNAPKKHLLGFEKVFLSSQKEALVKFNVDVCKHLSVVDELGNRKVALGDHVLHV  788

Query  190  GHLKHSLTVEI  222
            G LK +L+V I
Sbjct  789  GDLKQTLSVRI  799



>ref|XP_007225245.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
 gb|EMJ26444.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
Length=779

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++HN+P+K L+GF+KV LS   +E+V F VDVCKHLSVVDE GNRKVALG HVLH+
Sbjct  709  SSPPSVHNSPQKHLLGFEKVFLSAQREELVKFKVDVCKHLSVVDELGNRKVALGQHVLHV  768

Query  190  GHLKHSLTVEI  222
            G LKHS +V I
Sbjct  769  GSLKHSFSVGI  779



>ref|XP_009379698.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Pyrus x bretschneideri]
Length=773

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPPA+H +P+K L+GF+KV +S   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+
Sbjct  703  SSPPAVHKSPQKHLLGFEKVFVSAKREALVKFNVDVCKHLSVVDELGNRKVALGKHVLHV  762

Query  190  GHLKHSLTVEI  222
            G LKHS +V I
Sbjct  763  GSLKHSFSVRI  773



>ref|XP_008218886.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Prunus 
mume]
Length=779

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++HN+P+K L+GF+KV LS   +E+V F VDVCKHLSVVDE GNRKVALG HVLH+
Sbjct  709  SSPPSVHNSPQKHLLGFEKVFLSAQREELVKFKVDVCKHLSVVDELGNRKVALGPHVLHV  768

Query  190  GHLKHSLTVEI  222
            G LKHS +V I
Sbjct  769  GSLKHSFSVGI  779



>ref|XP_008344154.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPPA+H +P+K L+GF+KV +S     +V FNVDVCKHLSVVDE GNRKVALG HVLH+
Sbjct  703  SSPPAVHKSPQKHLLGFEKVFVSAQRVALVKFNVDVCKHLSVVDELGNRKVALGEHVLHV  762

Query  190  GHLKHSLTVEI  222
            G LKHS +V I
Sbjct  763  GSLKHSFSVRI  773



>ref|XP_004300692.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=799

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++HNAP+K L+GF+KV LS   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+
Sbjct  729  SSPPSVHNAPKKHLLGFEKVFLSSQGEALVKFNVDVCKHLSVVDELGNRKVALGDHVLHV  788

Query  190  GHLKHSLTVEI  222
            G L+ +L+V I
Sbjct  789  GDLRQTLSVRI  799



>gb|EYU18509.1| hypothetical protein MIMGU_mgv1a001665mg [Erythranthe guttata]
Length=777

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PP +HNAPRKQLV F+KV L P  +EVV F +DVCK LSVVDE GNRKVALG HVLH+
Sbjct  707  SRPPRVHNAPRKQLVAFRKVHLRPKGEEVVRFEIDVCKDLSVVDELGNRKVALGKHVLHV  766

Query  190  GHLKHSLTVEI  222
            G+LKHS  V I
Sbjct  767  GNLKHSFNVTI  777



>ref|XP_009628814.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=781

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            +SPP++HNAP+K L+GF+KV L+P E+ VV FNVDVCKHLS  DE GN+KVALG HVLHI
Sbjct  711  NSPPSVHNAPQKHLLGFEKVHLTPQEEGVVKFNVDVCKHLSGHDELGNKKVALGQHVLHI  770

Query  190  GHLKHSLTVEI  222
            G LKHS TV+I
Sbjct  771  GDLKHSFTVKI  781



>emb|CDO97479.1| unnamed protein product [Coffea canephora]
Length=706

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++HNA +K L+GFQK+ L+P  + +V FNVDVCKHLS+VDE GNRKVA+G HVLH 
Sbjct  636  SSPPSVHNAAQKHLLGFQKLHLAPQTEGLVKFNVDVCKHLSMVDELGNRKVAVGEHVLHA  695

Query  190  GHLKHSLTVEI  222
            G LKH+LTV I
Sbjct  696  GDLKHTLTVRI  706



>ref|XP_008339210.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPPA+H +P+K L+GF+KV LS   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+
Sbjct  703  SSPPAVHKSPQKHLLGFEKVFLSAQREALVKFNVDVCKHLSVVDELGNRKVALGEHVLHV  762

Query  190  GHLKHSLTVEI  222
            G L HS +V I
Sbjct  763  GSLXHSFSVRI  773



>ref|XP_009801214.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=784

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            +SPP++HNAP+K L+GF+KV L+  E+ VV FNVDVCKHLSV DE GN+KVALG HVLHI
Sbjct  714  NSPPSVHNAPQKHLLGFKKVHLTAQEEGVVKFNVDVCKHLSVHDELGNKKVALGQHVLHI  773

Query  190  GHLKHSLTVEI  222
            G LKHS TV I
Sbjct  774  GDLKHSFTVRI  784



>gb|KDP30704.1| hypothetical protein JCGZ_16402 [Jatropha curcas]
Length=770

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP++HN+P+K LV F+KV L       V F VD+CKHLSVVDE GNRK+ALG H+LH+
Sbjct  700  STPPSVHNSPQKHLVDFEKVSLDAQTHSTVQFKVDICKHLSVVDEFGNRKIALGEHILHV  759

Query  190  GHLKHSLTVEI  222
            G+LKHS+T+ I
Sbjct  760  GNLKHSMTLRI  770



>emb|CAN78858.1| hypothetical protein VITISV_030325 [Vitis vinifera]
Length=699

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++HN+P+K L+GF+KV ++     +V F VDVCK LS+VDE G RKVALGLHVLH+
Sbjct  629  SSPPSVHNSPQKHLLGFEKVFVTAKAKALVRFKVDVCKDLSIVDELGTRKVALGLHVLHV  688

Query  190  GHLKHSLTVEI  222
            G+LKHSL V I
Sbjct  689  GNLKHSLNVRI  699



>ref|XP_009354080.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPPA+H +P+K L+GF+KV LS   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+
Sbjct  703  SSPPAVHKSPQKHLLGFEKVFLSAQREALVKFNVDVCKHLSVVDELGNRKVALGEHVLHV  762

Query  190  GHLKHSLTVEI  222
            G LK S +V I
Sbjct  763  GSLKRSFSVRI  773



>ref|XP_011087839.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP +HNAPRK L+G+QK+ L+P  + +V FN+DVCKHLS+VDE GN+KVALG ++LHI
Sbjct  698  SSPPQVHNAPRKHLIGYQKLHLTPQAEGLVRFNIDVCKHLSIVDENGNQKVALGEYILHI  757

Query  190  GHLKHSLTVEI  222
            G L HSL V I
Sbjct  758  GSLMHSLHVVI  768



>emb|CBI40687.3| unnamed protein product [Vitis vinifera]
Length=751

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++HN+P+K L+GF+KV ++     +V F VDVCK LS+VDE G RKVALGLHVLH+
Sbjct  681  SSPPSVHNSPQKHLLGFEKVFVTAKAKALVRFKVDVCKDLSIVDELGTRKVALGLHVLHV  740

Query  190  GHLKHSLTVEI  222
            G+LKHSL V I
Sbjct  741  GNLKHSLNVRI  751



>gb|KCW63063.1| hypothetical protein EUGRSUZ_G00654 [Eucalyptus grandis]
Length=621

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++H AP+KQL+GF+KV L+   +  V F VDVCK LSVVDE G+RKVALG++VLH+
Sbjct  551  SSPPSVHRAPQKQLLGFEKVFLASQSEAQVQFKVDVCKDLSVVDELGHRKVALGMYVLHV  610

Query  190  GHLKHSLTVEI  222
            G LKH+L+V+I
Sbjct  611  GDLKHALSVQI  621



>ref|XP_010937054.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Elaeis guineensis]
Length=772

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP++HN+P+KQL+GF+KV L P     VVF VDVCK LS+VDE GNRKVALG H+LH+
Sbjct  702  STPPSVHNSPQKQLLGFEKVYLGPQGVGNVVFKVDVCKDLSLVDELGNRKVALGSHILHV  761

Query  190  GHLKHSLTVEI  222
            G L HSL V +
Sbjct  762  GSLMHSLKVRV  772



>ref|XP_010068200.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=777

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++H AP+KQL+GF+KV L+   +  V F VDVCK LSVVDE G+RKVALG++VLH+
Sbjct  707  SSPPSVHRAPQKQLLGFEKVFLASQSEAQVQFKVDVCKDLSVVDELGHRKVALGMYVLHV  766

Query  190  GHLKHSLTVEI  222
            G LKH+L+V+I
Sbjct  767  GDLKHALSVQI  777



>ref|XP_010103839.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
 gb|EXB97280.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
Length=778

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++HN+PRK L+GF+KV L    + +V F V++CK LSVVDE G RKVALG H+LH+
Sbjct  708  SSPPSVHNSPRKHLLGFEKVSLKAQSESLVKFTVNICKDLSVVDEVGTRKVALGHHLLHV  767

Query  190  GHLKHSLTVEI  222
            G LKHSL+V I
Sbjct  768  GDLKHSLSVRI  778



>ref|XP_002264183.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Vitis vinifera]
Length=774

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++HN+P+K L+GF+KV ++     +V F VDVCK LS+VDE G RKVALGLHVLH+
Sbjct  704  SSPPSVHNSPQKHLLGFEKVFVTAKAKALVRFKVDVCKDLSIVDELGTRKVALGLHVLHV  763

Query  190  GHLKHSLTVEI  222
            G+LKHSL V I
Sbjct  764  GNLKHSLNVRI  774



>ref|XP_002448619.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
 gb|EES12947.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
Length=767

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPPA+HNAP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+
Sbjct  697  SSPPAVHNAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGNHTLHV  756

Query  190  GHLKHSLTVEI  222
            G LKH+L++ +
Sbjct  757  GDLKHTLSLGV  767



>gb|KHG10349.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=779

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++HN+P+K L+GF+KV L+   + +V F VDVCK LSVVDE G+RKVALG H+LH+
Sbjct  709  SSPPSVHNSPQKHLLGFEKVSLTGKSETLVRFKVDVCKDLSVVDELGSRKVALGQHLLHV  768

Query  190  GHLKHSLTVEI  222
            G LKHSLTV I
Sbjct  769  GSLKHSLTVRI  779



>ref|XP_008661822.1| PREDICTED: uncharacterized protein LOC100279996 isoform X1 [Zea 
mays]
 gb|AFW59620.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=773

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPPA+HNAP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+
Sbjct  703  SSPPAVHNAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHV  762

Query  190  GHLKHSLTVEI  222
            G LKH+L + +
Sbjct  763  GDLKHTLNLGV  773



>ref|XP_008661823.1| PREDICTED: uncharacterized protein LOC100279996 isoform X2 [Zea 
mays]
Length=653

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPPA+HNAP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+
Sbjct  583  SSPPAVHNAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHV  642

Query  190  GHLKHSLTVEI  222
            G LKH+L + +
Sbjct  643  GDLKHTLNLGV  653



>gb|KJB31997.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=631

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++HN+P+K L+GF+KV L+   + +V F VDVCK LSVVDE G+RKVALG H+LH+
Sbjct  561  SSPPSVHNSPQKHLLGFEKVSLTGKSETLVRFKVDVCKDLSVVDELGSRKVALGQHLLHV  620

Query  190  GHLKHSLTVEI  222
            G LKHSLTV I
Sbjct  621  GSLKHSLTVGI  631



>gb|KJB31995.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=779

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++HN+P+K L+GF+KV L+   + +V F VDVCK LSVVDE G+RKVALG H+LH+
Sbjct  709  SSPPSVHNSPQKHLLGFEKVSLTGKSETLVRFKVDVCKDLSVVDELGSRKVALGQHLLHV  768

Query  190  GHLKHSLTVEI  222
            G LKHSLTV I
Sbjct  769  GSLKHSLTVGI  779



>ref|XP_010687471.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Beta vulgaris subsp. vulgaris]
Length=777

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++HN+P+K L+ F+KV L    + + VF VD C+HLSVVDE GNRKVALG+H LHI
Sbjct  707  SSPPSVHNSPKKNLIAFEKVFLHGKTEGMTVFKVDACEHLSVVDEEGNRKVALGVHQLHI  766

Query  190  GHLKHSLTVEI  222
            G++KHS  V I
Sbjct  767  GNMKHSFNVRI  777



>ref|XP_002513707.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF48654.1| Beta-glucosidase, putative [Ricinus communis]
Length=777

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            +PP++HN+P+K LV F+KV L      +V F VDVCKHLSVVDE G+RKVALG HVLH+G
Sbjct  708  TPPSVHNSPQKHLVDFEKVSLDAKTYGMVSFKVDVCKHLSVVDEFGSRKVALGGHVLHVG  767

Query  193  HLKHSLTVEI  222
            +L+HSLTV I
Sbjct  768  NLEHSLTVRI  777



>ref|XP_009407358.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Musa acuminata subsp. malaccensis]
Length=623

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+HNAPRKQLVGF+KV L PNE + V F VD C+ LSV DE+GN KV LG HVLH+
Sbjct  553  NTPPAVHNAPRKQLVGFEKVFLEPNESKNVAFQVDACRDLSVADESGNWKVPLGSHVLHV  612

Query  190  GHLKHSLTVEI  222
            G + H+LT+ I
Sbjct  613  GDVTHTLTLSI  623



>emb|CBI20072.3| unnamed protein product [Vitis vinifera]
Length=333

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++HN+P+K L+GF+KV ++   + +V F VDVCK LS+VDE G RKVALGLHVLH+
Sbjct  263  SSPPSVHNSPQKHLLGFEKVFVTAKAEALVRFKVDVCKDLSIVDELGTRKVALGLHVLHV  322

Query  190  GHLKHSLTVEI  222
            G+LKHSL V I
Sbjct  323  GNLKHSLNVRI  333



>ref|XP_004976989.1| PREDICTED: beta-D-xylosidase 4-like isoform X2 [Setaria italica]
Length=770

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPPA+HNAP K L+GF+KV L P +  VV F VDVC+ LSVVDE GNRKVALG H LH+
Sbjct  700  SSPPAVHNAPAKHLLGFEKVSLEPGQAGVVAFKVDVCRDLSVVDELGNRKVALGSHTLHV  759

Query  190  GHLKHSLTVEI  222
            G LKH++ + +
Sbjct  760  GDLKHTINLRV  770



>gb|KJB31996.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
 gb|KJB31998.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=507

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++HN+P+K L+GF+KV L+   + +V F VDVCK LSVVDE G+RKVALG H+LH+
Sbjct  437  SSPPSVHNSPQKHLLGFEKVSLTGKSETLVRFKVDVCKDLSVVDELGSRKVALGQHLLHV  496

Query  190  GHLKHSLTVEI  222
            G LKHSLTV I
Sbjct  497  GSLKHSLTVGI  507



>ref|XP_006394136.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
 gb|ESQ31422.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
Length=780

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +PRK L+GF+K+RL   E+ VV F V++CK LSVVDE G RK+ALG H+LH+
Sbjct  710  TTPPAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVEICKDLSVVDEIGKRKIALGQHLLHV  769

Query  190  GHLKHSLTVEI  222
            G LKHSL++ I
Sbjct  770  GDLKHSLSIRI  780



>ref|XP_006653810.1| PREDICTED: beta-D-xylosidase 4-like [Oryza brachyantha]
Length=776

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            +SPP++HNAP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+
Sbjct  706  TSPPSVHNAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHV  765

Query  190  GHLKHSLTVEI  222
            G LKH+L + +
Sbjct  766  GDLKHTLNLRV  776



>ref|XP_007043027.1| Beta-D-xylosidase 4 [Theobroma cacao]
 gb|EOX98858.1| Beta-D-xylosidase 4 [Theobroma cacao]
Length=787

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP++HN+PRK L+GF+KV L+   + +V F VDVCK LSVVDE G+RKV+LG HVLH+
Sbjct  717  STPPSVHNSPRKHLLGFEKVLLTGKSESLVRFKVDVCKDLSVVDERGSRKVSLGQHVLHV  776

Query  190  GHLKHSLTVEI  222
            G LKHSL V I
Sbjct  777  GSLKHSLNVRI  787



>ref|XP_003580652.1| PREDICTED: beta-D-xylosidase 4-like [Brachypodium distachyon]
Length=774

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPPA+HNAP K L+GF+K+ L P +  V  F VDVCK LSVVDE GNRKVALG H LH+
Sbjct  704  SSPPAVHNAPAKHLLGFEKLNLEPGQAGVAAFKVDVCKDLSVVDELGNRKVALGGHTLHV  763

Query  190  GHLKHSLTVEI  222
            G LKH+L + +
Sbjct  764  GDLKHTLNLGV  774



>ref|XP_011087838.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP +HNA +K L+GF+K+ L+P  +  V F++DVCKHLSVVDE G RKVALG HVLH+
Sbjct  698  SSPPQVHNAAQKHLLGFEKLHLTPQAEGQVRFDIDVCKHLSVVDENGARKVALGEHVLHV  757

Query  190  GHLKHSLTVEI  222
            G L HSL V I
Sbjct  758  GSLTHSLNVMI  768



>ref|XP_007159080.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
 gb|ESW31074.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
Length=773

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PPA+HNAP+K L+GF+KV L    + +V F VDVCK LS+VDE GNRKVALG H+LH+
Sbjct  703  STPPAVHNAPQKHLLGFEKVHLIGKSEALVRFKVDVCKDLSIVDELGNRKVALGQHLLHV  762

Query  190  GHLKHSLTVEI  222
            G+LKH L+V I
Sbjct  763  GNLKHPLSVMI  773



>gb|ACL53913.1| unknown [Zea mays]
 gb|ACN36701.1| unknown [Zea mays]
 gb|AFW59617.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=405

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPPA+HNAP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+
Sbjct  335  SSPPAVHNAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHV  394

Query  190  GHLKHSLTVEI  222
            G LKH+L + +
Sbjct  395  GDLKHTLNLGV  405



>ref|XP_002298197.2| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE83002.2| beta-glucosidase family protein [Populus trichocarpa]
Length=778

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP++HN+P+K LVGF+KV L    D  V F VDVCK LSVVDE G++KVALG HVLHI
Sbjct  708  STPPSVHNSPQKHLVGFEKVFLHAQTDSHVGFKVDVCKDLSVVDELGSKKVALGEHVLHI  767

Query  190  GHLKHSLTVEI  222
            G LKHS+TV I
Sbjct  768  GSLKHSMTVRI  778



>emb|CAJ65922.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=757

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP++HN+P+K LVGF+KV L    D  V F VDVCK LSVVDE G++KVALG HVLHI
Sbjct  687  STPPSVHNSPQKHLVGFEKVFLHAQTDSHVGFKVDVCKDLSVVDELGSKKVALGEHVLHI  746

Query  190  GHLKHSLTVEI  222
            G LKHS+TV I
Sbjct  747  GSLKHSMTVRI  757



>ref|XP_010444394.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +PRK L+GF+KVRL   E+ VV F V+VCK LSVVDE G RK+ LG H+LH+
Sbjct  706  TTPPAVHGSPRKHLLGFEKVRLGKMEEAVVRFRVEVCKDLSVVDEVGKRKIGLGKHLLHV  765

Query  190  GHLKHSLTVEI  222
            G LKHSL++ I
Sbjct  766  GDLKHSLSIRI  776



>gb|EEE61783.1| hypothetical protein OsJ_16354 [Oryza sativa Japonica Group]
Length=771

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++H+AP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+
Sbjct  701  SSPPSVHSAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHV  760

Query  190  GHLKHSLTVEI  222
            G LKH+L + +
Sbjct  761  GDLKHTLNLRV  771



>ref|XP_010484241.1| PREDICTED: beta-D-xylosidase 4 [Camelina sativa]
Length=785

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +PRK L+GF+KVRL   E+ VV F V+VCK LSVVDE GNRK++LG H+LH+
Sbjct  715  TTPPAVHGSPRKHLLGFEKVRLGKMEEAVVRFKVEVCKDLSVVDEVGNRKISLGKHLLHV  774

Query  190  GHLKHSLTVEI  222
            G LKH L++ I
Sbjct  775  GDLKHYLSIRI  785



>ref|XP_010065531.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63059.1| hypothetical protein EUGRSUZ_G00651 [Eucalyptus grandis]
Length=789

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++H APRK L+GF+KV L+   +  V F VDVCK L VVDE G RKVALG+H+LH+
Sbjct  706  SSPPSVHRAPRKHLLGFEKVFLASQSEAQVQFKVDVCKDLGVVDELGCRKVALGMHILHV  765

Query  190  GHLKHSLTVEI  222
            G LKH+L+V+I
Sbjct  766  GDLKHALSVQI  776



>ref|NP_001146416.1| uncharacterized protein LOC100279996 [Zea mays]
 gb|ACN32073.1| unknown [Zea mays]
Length=507

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPPA+HNAP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+
Sbjct  437  SSPPAVHNAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHV  496

Query  190  GHLKHSLTVEI  222
            G LKH+L + +
Sbjct  497  GDLKHTLNLGV  507



>ref|NP_201262.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
 sp|Q9FLG1.1|BXL4_ARATH RecName: Full=Beta-D-xylosidase 4; Short=AtBXL4; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11424.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AED97922.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
Length=784

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +PRK LVGF+K+RL   E+ VV F V++CK LSVVDE G RK+ LG H+LH+
Sbjct  714  TTPPAIHGSPRKHLVGFEKIRLGKREEAVVRFKVEICKDLSVVDEIGKRKIGLGKHLLHV  773

Query  190  GHLKHSLTVEI  222
            G LKHSL++ I
Sbjct  774  GDLKHSLSIRI  784



>ref|NP_001054038.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAE02971.2| OSJNBb0079B02.3 [Oryza sativa Japonica Group]
 dbj|BAF15952.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAH67823.1| OSIGBa0138H21-OSIGBa0138E01.14 [Oryza sativa Indica Group]
 gb|EEC78109.1| hypothetical protein OsI_17615 [Oryza sativa Indica Group]
Length=765

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++H+AP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+
Sbjct  695  SSPPSVHSAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHV  754

Query  190  GHLKHSLTVEI  222
            G LKH+L + +
Sbjct  755  GDLKHTLNLRV  765



>ref|XP_002268626.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Vitis 
vinifera]
 emb|CBI39114.3| unnamed protein product [Vitis vinifera]
Length=774

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++HN+P+K L+GF+KV ++   + +V F VDVCK LS+VDE G +KVALGLHVLH+
Sbjct  704  SSPPSVHNSPQKHLLGFEKVFVTAKAEALVRFKVDVCKDLSIVDELGTQKVALGLHVLHV  763

Query  190  GHLKHSLTVEI  222
            G LKHSL V I
Sbjct  764  GSLKHSLNVRI  774



>ref|XP_011015574.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP++HN+P+K L+GF+KV L    D  V F VDVCK LSVVDE G++KVALG HVLHI
Sbjct  706  STPPSVHNSPQKHLLGFEKVFLHAQTDSHVGFKVDVCKDLSVVDELGSKKVALGEHVLHI  765

Query  190  GHLKHSLTVEI  222
            G LKHSLTV I
Sbjct  766  GSLKHSLTVRI  776



>gb|AFW59618.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=475

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPPA+HNAP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+
Sbjct  405  SSPPAVHNAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHV  464

Query  190  GHLKHSLTVEI  222
            G LKH+L + +
Sbjct  465  GDLKHTLNLGV  475



>ref|XP_011046123.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP++HN+P+K L+GF+KV L    D  V F VDVCK LSVVDE G++KVALG HVLHI
Sbjct  706  STPPSVHNSPQKHLLGFEKVFLHAQTDSHVGFKVDVCKDLSVVDELGSKKVALGEHVLHI  765

Query  190  GHLKHSLTVEI  222
            G LKHSLTV I
Sbjct  766  GSLKHSLTVRI  776



>gb|KHN39204.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Glycine soja]
Length=648

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PPA+HNAP+K L+GF+KV L    + +V F VDVCK LS+VDE GNRKVALG H+LH+
Sbjct  578  STPPAVHNAPQKHLLGFEKVHLIGKSEALVSFKVDVCKDLSIVDELGNRKVALGQHLLHV  637

Query  190  GHLKHSLTVEI  222
            G LKH L+V I
Sbjct  638  GDLKHPLSVMI  648



>ref|XP_008784548.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2-like [Phoenix dactylifera]
Length=773

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP++HN+P+K L+GF+K+ L P     VVFNVDVCK LS+VDE GNR VALG HVLH+
Sbjct  703  STPPSVHNSPQKHLLGFEKIYLGPKXVGYVVFNVDVCKDLSLVDELGNRMVALGSHVLHV  762

Query  190  GHLKHSLTVEI  222
            G LKHSL V +
Sbjct  763  GSLKHSLRVRV  773



>dbj|BAD94481.1| beta-xylosidase [Arabidopsis thaliana]
Length=523

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +PRK LVGF+K+RL   E+ VV F V++CK LSVVDE G RK+ LG H+LH+
Sbjct  453  TTPPAIHGSPRKHLVGFEKIRLGKREEAVVRFKVEICKDLSVVDEIGKRKIGLGKHLLHV  512

Query  190  GHLKHSLTVEI  222
            G LKHSL++ I
Sbjct  513  GDLKHSLSIRI  523



>ref|XP_003531047.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=765

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PPA+HNAP+K L+GF+KV L    + +V F VDVCK LS+VDE GNRKVALG H+LH+
Sbjct  695  STPPAVHNAPQKHLLGFEKVHLIGKSEALVSFKVDVCKDLSIVDELGNRKVALGQHLLHV  754

Query  190  GHLKHSLTVEI  222
            G LKH L+V I
Sbjct  755  GDLKHPLSVMI  765



>emb|CAE03635.1| OSJNBb0003B01.27 [Oryza sativa Japonica Group]
Length=839

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++H+AP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+
Sbjct  769  SSPPSVHSAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHV  828

Query  190  GHLKHSLTVEI  222
            G LKH+L + +
Sbjct  829  GDLKHTLNLRV  839



>ref|XP_002303181.1| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE78160.1| beta-glucosidase family protein [Populus trichocarpa]
Length=773

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPPA+HN+P+K LVGF+KV L+      V F VD+CK LSVVDE G++KVALG HVLH+
Sbjct  703  SSPPAVHNSPQKHLVGFEKVFLNAQTGRHVRFKVDICKDLSVVDELGSKKVALGEHVLHV  762

Query  190  GHLKHSLTVEI  222
            G LKH L+V I
Sbjct  763  GSLKHFLSVRI  773



>ref|XP_002866623.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42882.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
Length=784

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +PRK L+GF+K+RL   E+ VV F V+VCK LSVVDE G RK+ LG H+LH+
Sbjct  714  TTPPAIHGSPRKHLLGFEKIRLGKMEEAVVRFKVEVCKDLSVVDEIGKRKIGLGKHLLHV  773

Query  190  GHLKHSLTVEI  222
            G LKHSL++ I
Sbjct  774  GDLKHSLSIRI  784



>gb|EYU18507.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=773

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PP +HNAPRKQLV F+KV L P  +EVV F +DVCK LSVVDE GNRKVALG HVLH+
Sbjct  703  SRPPRVHNAPRKQLVAFRKVHLRPKGEEVVRFEIDVCKDLSVVDELGNRKVALGKHVLHV  762

Query  190  GHLKHSLTVEI  222
            G+LKH   V I
Sbjct  763  GNLKHFFNVTI  773



>gb|EYU18508.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=770

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PP +HNAPRKQLV F+KV L P  +EVV F +DVCK LSVVDE GNRKVALG HVLH+
Sbjct  700  SRPPRVHNAPRKQLVAFRKVHLRPKGEEVVRFEIDVCKDLSVVDELGNRKVALGKHVLHV  759

Query  190  GHLKHSLTVEI  222
            G+LKH   V I
Sbjct  760  GNLKHFFNVTI  770



>ref|XP_009130462.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=778

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +PRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+
Sbjct  708  TTPPAVHGSPRKHLLGFEKIRLGKREEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLLHV  767

Query  190  GHLKHSLTVEI  222
            G LKHSL++ I
Sbjct  768  GDLKHSLSIRI  778



>ref|XP_011004967.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Populus euphratica]
Length=775

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPPA+HNAP+K LVGF+KV L+      V F V++CK LS+VDE G++KVALG HVLH+
Sbjct  705  SSPPAVHNAPQKHLVGFKKVFLNAQTGRHVRFKVNICKDLSLVDELGSKKVALGEHVLHV  764

Query  190  GHLKHSLTVEI  222
            G LKH L+V I
Sbjct  765  GSLKHFLSVRI  775



>ref|XP_010261102.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=773

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP++HNAP K L+GF+KV L+   + +V FNVDVCK LSVVDE G RKVALG HVLH+
Sbjct  703  STPPSVHNAPNKHLLGFEKVFLTSQNEALVKFNVDVCKDLSVVDELGRRKVALGSHVLHV  762

Query  190  GHLKHSLTVEI  222
            G LKHSL + I
Sbjct  763  GSLKHSLNIRI  773



>ref|XP_008455235.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cucumis melo]
Length=791

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP++HN+P+K L+GF+KV L    + VV F VDVCK LSV DE G+RKVALGLH+LH+
Sbjct  721  STPPSVHNSPQKHLLGFEKVSLGRGREMVVRFKVDVCKDLSVTDEVGSRKVALGLHILHV  780

Query  190  GHLKHSLTVEI  222
            G LKHSL V +
Sbjct  781  GTLKHSLNVRV  791



>gb|KFK28148.1| hypothetical protein AALP_AA8G478800 [Arabis alpina]
Length=779

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PP +H +PRK L+GF+K+RL   E+ VV F V++CK LSVVDE G RK+ALG H+LH+
Sbjct  709  TTPPDVHGSPRKHLLGFEKIRLGKMEEAVVRFKVEICKDLSVVDEIGKRKIALGKHLLHV  768

Query  190  GHLKHSLTVEI  222
            G LKHSL++ I
Sbjct  769  GDLKHSLSIRI  779



>ref|XP_004504774.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cicer arietinum]
Length=774

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PPA+HNAP+K L+ F+KV L    + VV F VDVCK LSVVDE GNRKVALG H+LH+
Sbjct  704  STPPAVHNAPQKHLLAFEKVHLMGKSEAVVSFKVDVCKDLSVVDEVGNRKVALGQHMLHV  763

Query  190  GHLKHSLTVEI  222
            G LKH L V I
Sbjct  764  GDLKHPLGVRI  774



>gb|KEH31243.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=774

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PPA+HNAP+K L+ F+KV  +   + +V F VDVCK LSVVDE GNRKVALG H+LH+
Sbjct  704  STPPAVHNAPQKHLLAFEKVHFTGKSEALVSFKVDVCKDLSVVDELGNRKVALGKHMLHV  763

Query  190  GHLKHSLTVEI  222
            G LKH L+V I
Sbjct  764  GDLKHPLSVMI  774



>emb|CDY56487.1| BnaCnng30450D [Brassica napus]
Length=791

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +PRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+
Sbjct  721  TTPPAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLLHV  780

Query  190  GHLKHSLTVEI  222
            G +KHSL++ I
Sbjct  781  GDVKHSLSIRI  791



>ref|XP_006280038.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
 gb|EOA12936.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
Length=784

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +P+K L+GF+K+RL   E+ VV F V VCK LSVVDE G RK+ LG H+LH+
Sbjct  714  TTPPAVHGSPKKHLLGFEKIRLGKMEEAVVRFKVKVCKDLSVVDEIGKRKIGLGKHLLHV  773

Query  190  GHLKHSLTVEI  222
            G LKHSL++ I
Sbjct  774  GDLKHSLSIRI  784



>ref|XP_010461983.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PP +H +PRK L+GF+KVRL   E+ VV F V VCK LSVVDE G RK+ LG H+LH+
Sbjct  706  TTPPDVHGSPRKHLLGFEKVRLGKMEEAVVRFKVAVCKDLSVVDEVGKRKIGLGKHLLHV  765

Query  190  GHLKHSLTVEI  222
            G LKHSL++ I
Sbjct  766  GDLKHSLSIRI  776



>emb|CDY51290.1| BnaA06g23560D [Brassica napus]
Length=780

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +PRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+
Sbjct  710  TTPPAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLSVVDEVGKRKIGLGRHLLHV  769

Query  190  GHLKHSLTVEI  222
            G +KHSL++ I
Sbjct  770  GDVKHSLSIRI  780



>ref|XP_009150540.1| PREDICTED: beta-D-xylosidase 4 [Brassica rapa]
Length=791

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +PRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+
Sbjct  721  TTPPAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLSVVDEVGKRKIGLGRHLLHV  780

Query  190  GHLKHSLTVEI  222
            G +KHSL++ I
Sbjct  781  GDVKHSLSIRI  791



>dbj|BAE44362.1| alpha-L-arabinofuranosidase [Raphanus sativus]
Length=780

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +PRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+
Sbjct  710  TTPPAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLLHV  769

Query  190  GHLKHSLTVEI  222
            G +KHSL++ I
Sbjct  770  GDVKHSLSIRI  780



>emb|CDY31313.1| BnaA02g34280D [Brassica napus]
Length=778

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PP +H +PRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+
Sbjct  708  TTPPTVHGSPRKHLLGFEKIRLGKREEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLLHV  767

Query  190  GHLKHSLTVEI  222
            G LKHSL++ I
Sbjct  768  GDLKHSLSIRI  778



>ref|XP_003593145.1| Beta-xylosidase/alpha-L-arabinofuranosidase [Medicago truncatula]
 gb|AES63396.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=775

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 43/70 (61%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            +PP +HNAP+K L+GF+KV+L+   + +V F VDVC  LSVVDE GNRKV LG H+LH+G
Sbjct  706  TPPNVHNAPQKHLLGFEKVQLAGKSEGMVRFKVDVCNDLSVVDELGNRKVPLGDHMLHVG  765

Query  193  HLKHSLTVEI  222
            +LKHSL+V I
Sbjct  766  NLKHSLSVRI  775



>sp|A5JTQ2.1|XYL1_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 1; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
1; Short=MsXyl1; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor, 
partial [Medicago sativa subsp. x varia]
 gb|ABQ45227.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 43/70 (61%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            +PP +HNAP+K L+GF+KV+L+   + +V F VDVC  LSVVDE GNRKV LG H+LH+G
Sbjct  705  TPPNVHNAPQKHLLGFEKVQLAGKSEGMVRFKVDVCNDLSVVDELGNRKVPLGDHMLHVG  764

Query  193  HLKHSLTVEI  222
            +LKHSL+V I
Sbjct  765  NLKHSLSVRI  774



>gb|KHN26728.1| Beta-xylosidase/alpha-L-arabinofuranosidase 1 [Glycine soja]
Length=648

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            +PP +HNAP+K L+GF+KV L    +  V F VD+CK LSVVDE GNRKV LG H+LH+G
Sbjct  579  TPPDVHNAPQKHLLGFEKVHLPGKSEAQVRFKVDICKDLSVVDELGNRKVPLGQHLLHVG  638

Query  193  HLKHSLTVEI  222
            +LKH L+V +
Sbjct  639  NLKHQLSVSV  648



>ref|XP_010243340.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=771

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PP++HNAP+K L+GF+KV L+   +E+V FNVDVCK LSVVDE G+RKVALG HVL +
Sbjct  701  NTPPSVHNAPKKHLLGFKKVFLTAQSEELVKFNVDVCKDLSVVDELGSRKVALGSHVLQV  760

Query  190  GHLKHSLTVEI  222
            G LKHSL ++I
Sbjct  761  GSLKHSLNIKI  771



>ref|XP_003531557.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            +PP +HNAP+K L+GF+KV L    +  V F VD+CK LSVVDE GNRKV LG H+LH+G
Sbjct  707  TPPDVHNAPQKHLLGFEKVHLPGKSEAQVRFKVDICKDLSVVDELGNRKVPLGQHLLHVG  766

Query  193  HLKHSLTVEI  222
            +LKH L+V +
Sbjct  767  NLKHQLSVSV  776



>ref|XP_009112141.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=776

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PP +H APRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H LH+
Sbjct  706  TTPPEVHGAPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLSVVDEIGKRKIGLGQHRLHV  765

Query  190  GHLKHSLTVEI  222
            G LKHSL++ I
Sbjct  766  GDLKHSLSIRI  776



>emb|CDY18705.1| BnaA09g06900D [Brassica napus]
Length=776

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PP +H APRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H LH+
Sbjct  706  TTPPEVHGAPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLSVVDEIGKRKIGLGQHRLHV  765

Query  190  GHLKHSLTVEI  222
            G LKHSL++ I
Sbjct  766  GDLKHSLSIRI  776



>emb|CDY46812.1| BnaC02g43200D [Brassica napus]
Length=778

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +PRK L+GF+K+ L   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+
Sbjct  708  TTPPAVHGSPRKHLLGFEKISLGKREEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLLHV  767

Query  190  GHLKHSLTVEI  222
            G LKHSL++ I
Sbjct  768  GDLKHSLSIRI  778



>dbj|BAK03439.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=694

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP  HNAP K L+GF+KV L+P E   V F VDVC+ LSVVDE G RKVALG H LH+
Sbjct  624  SSPPPAHNAPAKHLLGFEKVSLAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHV  683

Query  190  GHLKHSLTVEI  222
            G LKH++ + +
Sbjct  684  GDLKHTVELRV  694



>ref|XP_004136861.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
 gb|KGN43688.1| hypothetical protein Csa_7G058620 [Cucumis sativus]
Length=782

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP++HN+P+K L+GF+KV L    + VV F VDVCK LSV DE G+RKVALGLH+LH+
Sbjct  712  STPPSVHNSPQKHLLGFEKVSLGRGGETVVRFKVDVCKDLSVADEVGSRKVALGLHILHV  771

Query  190  GHLKHSLTVEI  222
            G LKHSL V++
Sbjct  772  GTLKHSLNVKV  782



>emb|CDX97115.1| BnaC09g45100D [Brassica napus]
Length=695

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +P K L+ F+KVRL   E  VV FNVDVCK LSVVDE G RK+ALG+HVLH+
Sbjct  625  TTPPAVHRSPVKHLLAFEKVRLGKEEKAVVRFNVDVCKDLSVVDETGKRKIALGVHVLHV  684

Query  190  GHLKHSLTVEI  222
            G LK+SL V I
Sbjct  685  GSLKYSLIVRI  695



>gb|KCW63062.1| hypothetical protein EUGRSUZ_G006531, partial [Eucalyptus grandis]
Length=642

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++H AP+K L+GF+KV L+   +  V F VD+CK L VVDE G +KVALG HVLHI
Sbjct  559  SSPPSVHRAPQKHLLGFEKVFLASQSEAQVQFKVDICKDLGVVDELGCQKVALGTHVLHI  618

Query  190  GHLKHSLTVEI  222
            G LKH+L+V+I
Sbjct  619  GDLKHALSVQI  629



>ref|XP_009122535.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +P K LV F+KVRL   E   V FNVDVCK LSVVDE G RK+ALG+HVLH+
Sbjct  704  TTPPAVHRSPVKHLVAFEKVRLGKKEKAAVRFNVDVCKDLSVVDENGKRKIALGVHVLHV  763

Query  190  GHLKHSLTVEI  222
            G LK+SL V I
Sbjct  764  GSLKYSLIVRI  774



>ref|XP_006493288.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Citrus sinensis]
Length=773

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP++H +P+K L+ F+KV L   E+ +V F VD CK LSVVDE GNRK+ALG H+LH+
Sbjct  703  STPPSVHKSPQKHLLAFEKVFLKGQEEALVSFKVDACKDLSVVDELGNRKLALGDHLLHV  762

Query  190  GHLKHSLTVEI  222
            G+LKHSLTV I
Sbjct  763  GNLKHSLTVRI  773



>dbj|BAJ90420.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96778.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08165.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP  HNAP K L+GF+KV L+P E   V F VDVC+ LSVVDE G RKVALG H LH+
Sbjct  705  SSPPPAHNAPAKHLLGFEKVSLAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHV  764

Query  190  GHLKHSLTVEI  222
            G LKH++ + +
Sbjct  765  GDLKHTVELRV  775



>dbj|BAJ90315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP  HNAP K L+GF+KV L+P E   V F VDVC+ LSVVDE G RKVALG H LH+
Sbjct  705  SSPPPAHNAPAKHLLGFEKVSLAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHV  764

Query  190  GHLKHSLTVEI  222
            G LKH++ + +
Sbjct  765  GDLKHTVELRV  775



>ref|XP_010065530.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=789

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++H AP+K L+GF+KV L+   +  V F VD+CK L VVDE G +KVALG HVLHI
Sbjct  706  SSPPSVHRAPQKHLLGFEKVFLASQSEAQVQFKVDICKDLGVVDELGCQKVALGTHVLHI  765

Query  190  GHLKHSLTVEI  222
            G LKH+L+V+I
Sbjct  766  GDLKHALSVQI  776



>ref|XP_006432467.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
 gb|ESR45707.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
Length=773

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP++H +P+K L+ F+KV L   E+ +V F VD CK LSVVDE GNRK+ALG H+LH+
Sbjct  703  STPPSVHKSPQKHLLAFEKVFLKGQEEALVSFKVDACKDLSVVDELGNRKLALGDHLLHV  762

Query  190  GHLKHSLTVEI  222
            G+LKHSLT+ I
Sbjct  763  GNLKHSLTIRI  773



>ref|XP_004155509.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
Length=809

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP++HN+P+K L+GF+KV L    + VV F VDVCK LSV DE G+RKVALGLH+LH+
Sbjct  739  STPPSVHNSPQKHLLGFEKVSLGRGGETVVRFKVDVCKDLSVADEVGSRKVALGLHILHV  798

Query  190  GHLKHSLTVEI  222
            G LKHSL V++
Sbjct  799  GTLKHSLNVKV  809



>emb|CDX81229.1| BnaC09g06400D [Brassica napus]
Length=776

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PP +H +PRK L+GF+K+RL   E+ VV F VDVCK L+VVDE G RK+ LG H+LH+
Sbjct  706  TTPPEVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLNVVDEIGKRKIGLGQHLLHV  765

Query  190  GHLKHSLTVEI  222
            G LKHSL++ I
Sbjct  766  GDLKHSLSIRI  776



>ref|XP_010065527.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63057.1| hypothetical protein EUGRSUZ_G00649 [Eucalyptus grandis]
Length=790

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++H +P+K L+GF+KV L+   +  V F VDVCK LSVVDE G RKVALG HVLH+
Sbjct  707  SSPPSVHRSPQKHLLGFEKVFLASQSEAQVQFKVDVCKDLSVVDELGGRKVALGTHVLHV  766

Query  190  GHLKHSLTVEI  222
            G LKH+L+V+I
Sbjct  767  GDLKHALSVQI  777



>sp|A5JTQ3.1|XYL2_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 2; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
2; Short=MsXyl2; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor 
[Medicago sativa subsp. x varia]
 gb|ABQ45228.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PPA+HNAP+K L+ F+KV L+   + +V F VDVCK L +VDE GNRKVALG H+LH+
Sbjct  704  STPPAVHNAPQKHLLAFEKVLLTGKSEALVSFKVDVCKDLGLVDELGNRKVALGKHMLHV  763

Query  190  GHLKHSLTVEI  222
            G LKH L+V I
Sbjct  764  GDLKHPLSVMI  774



>gb|KFK25272.1| hypothetical protein AALP_AA8G090500 [Arabis alpina]
Length=772

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +P K L+GF+K+RL  NE+ VV F V+VCK LSVVDE G RK+ LG HVLH+
Sbjct  702  TTPPAIHRSPIKHLLGFEKIRLVKNEETVVRFKVNVCKDLSVVDETGKRKIGLGEHVLHV  761

Query  190  GHLKHSLTVEI  222
            G+LKHSL + +
Sbjct  762  GNLKHSLNIRV  772



>gb|KCW63060.1| hypothetical protein EUGRSUZ_G00652 [Eucalyptus grandis]
Length=460

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++H AP+K L+GF+KV L+   +  + F V+VCK LS+VDE G+RKVALG HVLHI
Sbjct  385  SSPPSVHRAPQKHLLGFEKVFLASQSEAQLQFKVNVCKDLSLVDELGHRKVALGTHVLHI  444

Query  190  GHLKHSLTVEI  222
            G LKH+L+++I
Sbjct  445  GDLKHALSMQI  455



>ref|XP_010452969.1| PREDICTED: beta-D-xylosidase 3-like [Camelina sativa]
Length=779

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +P K L+GF+KVRL  NE+ VV FNVDVCK LSVVDE G RK+ALG H+LH+
Sbjct  709  TTPPAIHGSPIKHLLGFEKVRLGKNEEAVVRFNVDVCKDLSVVDEIGTRKIALGHHLLHV  768

Query  190  GHLKHSLTVEI  222
            G LKHSL + +
Sbjct  769  GSLKHSLNITV  779



>dbj|BAK01582.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=709

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP  HNAP K L+GF+KV L+P E   V F VDVC+ LSVVDE G RKVALG H LH+
Sbjct  639  SSPPPAHNAPAKHLLGFEKVSLAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHV  698

Query  190  GHLKHSLTVEI  222
            G LKH++ + +
Sbjct  699  GDLKHTVELRV  709



>emb|CDY35825.1| BnaC09g37570D [Brassica napus]
Length=774

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +P K L+ F+KVRL   E  VV FNVDVCK LSVVDE G RK+ALG+HVLH+
Sbjct  704  TTPPAVHRSPVKHLLAFEKVRLGKKEKAVVRFNVDVCKDLSVVDETGKRKIALGVHVLHV  763

Query  190  GHLKHSLTVEI  222
            G LK+SL V I
Sbjct  764  GSLKYSLIVRI  774



>gb|KHN33504.1| Beta-xylosidase/alpha-L-arabinofuranosidase 1 [Glycine soja]
Length=648

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            +PP +HNAP+K L+GF+KV L    +  V F VDVCK LSVVDE GNRKV LG H+LH+G
Sbjct  579  TPPDVHNAPQKHLLGFEKVHLPGKSEAQVRFKVDVCKDLSVVDELGNRKVPLGQHLLHVG  638

Query  193  HLKHSLTVEI  222
            +LKH L++ +
Sbjct  639  NLKHPLSLRV  648



>ref|XP_003547598.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            +PP +HNAP+K L+GF+KV L    +  V F VDVCK LSVVDE GNRKV LG H+LH+G
Sbjct  707  TPPDVHNAPQKHLLGFEKVHLPGKSEAQVRFKVDVCKDLSVVDELGNRKVPLGQHLLHVG  766

Query  193  HLKHSLTVEI  222
            +LKH L++ +
Sbjct  767  NLKHPLSLRV  776



>ref|XP_010068199.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2, partial [Eucalyptus grandis]
Length=531

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++H AP+K L+GF+KV L+   +  + F V+VCK LS+VDE G+RKVALG HVLHI
Sbjct  442  SSPPSVHRAPQKHLLGFEKVFLASQSEAQLQFKVNVCKDLSLVDELGHRKVALGTHVLHI  501

Query  190  GHLKHSLTVEI  222
            G LKH+L+++I
Sbjct  502  GDLKHALSMQI  512



>ref|XP_004485551.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cicer arietinum]
Length=775

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            SPP +HNAP+K L+GF+KV+L+   + +V F VDVCK LSVVDE G RKV LG H+LH+G
Sbjct  706  SPPNVHNAPQKHLLGFEKVQLAGKSEALVKFKVDVCKDLSVVDEVGKRKVPLGEHMLHVG  765

Query  193  HLKHSLTVEI  222
            +LK+ L+V I
Sbjct  766  NLKYPLSVRI  775



>ref|XP_002873418.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49677.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
Length=780

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PP +H +PRK L+GF+K+RL   E+ V+ FNVDVCK LSVVDE G RK+ALG ++LH+
Sbjct  709  TTPPEVHGSPRKHLLGFEKIRLGEKEETVIRFNVDVCKDLSVVDEIGKRKIALGHYLLHV  768

Query  190  GHLKHSLTVEI  222
            G  KHSLT+ +
Sbjct  769  GSFKHSLTISV  779



>gb|AAK38481.1| alpha-L-arabinofuranosidase/beta-D-xylosidase isoenzyme ARA-I 
[Hordeum vulgare]
Length=777

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP  HNAP K LVGF+KV L+P E   V F VDVC+ LSVVDE G RKVALG H LH 
Sbjct  707  SSPPPAHNAPAKHLVGFEKVSLAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHD  766

Query  190  GHLKHSLTVEI  222
            G LKH++ + +
Sbjct  767  GDLKHTVELRV  777



>gb|ACH60354.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60358.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60359.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60360.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60362.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60368.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60370.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60371.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60373.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60374.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
macrocarpa]
Length=107

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPPA+H AP+K+L+GF+KV +     E + F+VDVCK LSVVDE G +K+ALG H+LH+
Sbjct  36   SSPPAVHAAPQKKLLGFRKVHVGAGAKERLHFSVDVCKDLSVVDEIGVKKLALGSHLLHV  95

Query  190  GHLKHSLTVEI  222
            G +KHSL +EI
Sbjct  96   GDVKHSLNIEI  106



>gb|EMT32951.1| Beta-D-xylosidase 4 [Aegilops tauschii]
Length=970

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP+ HNAP K L+GF+KV L+P E   V F VDVC+ LSVVDE G RKVALG H LH+
Sbjct  900  SSPPSAHNAPAKHLLGFEKVSLAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHV  959

Query  190  GHLKHSLTVEI  222
            G LKH++ + +
Sbjct  960  GDLKHTVELRV  970



>gb|KJB77499.1| hypothetical protein B456_012G140300 [Gossypium raimondii]
Length=776

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            +PP++HN+PRK L+GF+K+ L      ++ F VDVCK LSVVDE G RK+ALG +VLH+G
Sbjct  707  TPPSVHNSPRKHLIGFEKISLKGKSGTLMRFKVDVCKDLSVVDELGRRKIALGQYVLHVG  766

Query  193  HLKHSLTVEI  222
            + KH+L++ I
Sbjct  767  NFKHTLSLRI  776



>emb|CDX69892.1| BnaA10g22410D [Brassica napus]
Length=774

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +P K LV F+KVRL   E   V FNVDVCK LSVVDE G RK+ALG+HVLH+
Sbjct  704  TTPPAVHRSPVKHLVAFEKVRLGKKEKAAVRFNVDVCKDLSVVDETGKRKIALGVHVLHV  763

Query  190  GHLKHSLTV  216
            G LK+SL V
Sbjct  764  GSLKYSLIV  772



>ref|XP_010422951.1| PREDICTED: beta-D-xylosidase 3 isoform X2 [Camelina sativa]
Length=752

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +P K L+GF+KVRL  NE+ VV F VDVCK LSVVDE G RK+ALG H LH+
Sbjct  682  TTPPAIHGSPIKHLLGFEKVRLGKNEEAVVSFKVDVCKDLSVVDEIGTRKIALGHHHLHV  741

Query  190  GHLKHSLTVEI  222
            G LKHSL + +
Sbjct  742  GSLKHSLNITV  752



>ref|XP_010422950.1| PREDICTED: beta-D-xylosidase 3 isoform X1 [Camelina sativa]
Length=794

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +P K L+GF+KVRL  NE+ VV F VDVCK LSVVDE G RK+ALG H LH+
Sbjct  724  TTPPAIHGSPIKHLLGFEKVRLGKNEEAVVSFKVDVCKDLSVVDEIGTRKIALGHHHLHV  783

Query  190  GHLKHSLTVEI  222
            G LKHSL + +
Sbjct  784  GSLKHSLNITV  794



>ref|XP_006399455.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
 gb|ESQ40908.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
Length=779

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +P K L+GF+KVRL  NE+ VV F VDVC+ LSVVDE G RK+ALG H+LH+
Sbjct  709  TTPPAIHRSPIKHLLGFEKVRLGKNEEAVVRFKVDVCQDLSVVDEIGKRKIALGQHLLHV  768

Query  190  GHLKHSLTVEI  222
            G LKH+L + +
Sbjct  769  GSLKHTLNIRV  779



>ref|XP_010065529.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63058.1| hypothetical protein EUGRSUZ_G00650 [Eucalyptus grandis]
Length=789

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP++H AP+K L+GF+KV L+   +  V F VDVCK LSVVDE G+ KVALG HVLH+
Sbjct  706  SSPPSVHRAPQKHLLGFEKVFLASQSEAQVQFKVDVCKDLSVVDELGHWKVALGTHVLHV  765

Query  190  GHLKHSLTVEI  222
            G LKH+L+V+I
Sbjct  766  GDLKHALSVQI  776



>ref|XP_010491610.1| PREDICTED: beta-D-xylosidase 3-like isoform X1 [Camelina sativa]
Length=779

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +P K L+GF+KVRL  NE+ VV F VDVCK LSVVDE G RK+ALG ++LH+
Sbjct  709  TTPPAIHGSPIKHLLGFEKVRLRKNEEAVVRFKVDVCKDLSVVDEIGTRKIALGHYLLHV  768

Query  190  GHLKHSLTVEI  222
            G LKHSL + +
Sbjct  769  GSLKHSLNITV  779



>ref|XP_010491609.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PP +H +P K L+GF+KVRL  +E+ +V F V+VCK LSVVDE G RK+ALG H+LH+
Sbjct  710  TTPPEVHGSPVKHLLGFEKVRLRKSEEAMVRFKVNVCKDLSVVDEIGTRKIALGHHLLHV  769

Query  190  GHLKHSLTVEI  222
            G LKHSL + +
Sbjct  770  GSLKHSLNITV  780



>ref|XP_010491611.1| PREDICTED: beta-D-xylosidase 3-like isoform X2 [Camelina sativa]
Length=765

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA+H +P K L+GF+KVRL  NE+ VV F VDVCK LSVVDE G RK+ALG ++LH+
Sbjct  695  TTPPAIHGSPIKHLLGFEKVRLRKNEEAVVRFKVDVCKDLSVVDEIGTRKIALGHYLLHV  754

Query  190  GHLKHSLTVEI  222
            G LKHSL + +
Sbjct  755  GSLKHSLNITV  765



>emb|CAB89360.1| beta-glucosidase-like protein [Arabidopsis thaliana]
 dbj|BAB09525.1| unnamed protein product [Arabidopsis thaliana]
Length=411

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PP +H +PRKQL+GF+K+RL   E+ VV F VDVCK L VVDE G RK+ALG H+LH+
Sbjct  341  TTPPEVHGSPRKQLLGFEKIRLGKKEETVVRFKVDVCKDLGVVDEIGKRKLALGHHLLHV  400

Query  190  GHLKHSLTVEI  222
            G LKHS  + +
Sbjct  401  GSLKHSFNISV  411



>gb|KHG02719.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=776

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            +PP++HN+PRK L+GF+K+ L      ++ F VDVCK LSVVDE G RK+ALG +VLH+G
Sbjct  707  TPPSVHNSPRKHLIGFEKISLKGKSGTLMRFKVDVCKDLSVVDELGRRKIALGQYVLHVG  766

Query  193  HLKHSLTVEI  222
            + KH+L++ I
Sbjct  767  NFKHTLSLRI  776



>ref|NP_196532.2| Glycosyl hydrolase family protein [Arabidopsis thaliana]
 gb|AED91435.1| Glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=526

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PP +H +PRKQL+GF+K+RL   E+ VV F VDVCK L VVDE G RK+ALG H+LH+
Sbjct  456  TTPPEVHGSPRKQLLGFEKIRLGKKEETVVRFKVDVCKDLGVVDEIGKRKLALGHHLLHV  515

Query  190  GHLKHSLTVEI  222
            G LKHS  + +
Sbjct  516  GSLKHSFNISV  526



>gb|ACH60351.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60352.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60353.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60355.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60356.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60357.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60361.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60363.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60364.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60365.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60366.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60367.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60369.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60372.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
Length=107

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPPA+H AP+K+L+GF+KV +     E + F+VDVCK LSVVDE G +K+ALG H+LH+
Sbjct  36   SSPPAVHGAPQKKLLGFRKVHVGAGAKERLHFSVDVCKDLSVVDEIGVKKLALGSHLLHV  95

Query  190  GHLKHSLTVEI  222
            G ++HSL ++I
Sbjct  96   GDVEHSLNIQI  106



>ref|XP_007148433.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
 gb|ESW20427.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
Length=775

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            +PP +HNAP+K L+ F+KV L    +  V F VDVCK LSVVDE GNRKV LG H+LH+G
Sbjct  706  TPPHVHNAPQKHLLAFEKVHLPGKSETQVRFKVDVCKDLSVVDELGNRKVPLGQHLLHVG  765

Query  193  HLKHSLTVEI  222
            + KH ++V +
Sbjct  766  NFKHPISVRV  775



>dbj|BAD94522.1| beta-xylosidase - like protein [Arabidopsis thaliana]
Length=287

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++ P +H +P KQL+GF+K+RL  +E+ VV FNV+VCK LSVVDE G RK+ALG H+LH+
Sbjct  217  TTSPQVHGSPIKQLLGFEKIRLGKSEEAVVRFNVNVCKDLSVVDETGKRKIALGHHLLHV  276

Query  190  GHLKHSLTVEI  222
            G LKHSL + +
Sbjct  277  GSLKHSLNISV  287



>ref|XP_006827121.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
 gb|ERM94358.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
Length=769

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP +HNAPRK+L+GF+KV + P  +  V F V+VC+ L VVDE G++KVALG H  H+
Sbjct  699  STPPRVHNAPRKRLLGFEKVHVEPRSERAVEFRVEVCEGLGVVDEFGSKKVALGSHTFHV  758

Query  190  GHLKHSLTV  216
            G+L HSL+V
Sbjct  759  GNLVHSLSV  767



>ref|XP_010520456.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 4 [Tarenaya 
hassleriana]
Length=750

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +1

Query  16   PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIGH  195
            P A+  +PRK L+GF+KVRL   E+ VV F V+VCK LSVVDEAG RK+ LG HVL +G+
Sbjct  682  PSAVKGSPRKHLLGFEKVRLGKGEEAVVRFRVEVCKDLSVVDEAGKRKIVLGDHVLRVGN  741

Query  196  LKHSLTVEI  222
            LKHSL + +
Sbjct  742  LKHSLKIRV  750



>emb|CDY01780.1| BnaC06g28200D [Brassica napus]
Length=776

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 43/70 (61%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            SPPA+H +P K L+ F+KVR    E  VV F VDVCK LSVVDE G RK+ALG HVLH+G
Sbjct  707  SPPAVHRSPVKHLLAFEKVRPGMKEKTVVRFEVDVCKDLSVVDETGKRKIALGKHVLHVG  766

Query  193  HLKHSLTVEI  222
             LK+SL + I
Sbjct  767  SLKYSLYITI  776



>ref|XP_010546362.1| PREDICTED: beta-D-xylosidase 4 [Tarenaya hassleriana]
Length=781

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +1

Query  10   SSPP--ALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVL  183
            ++PP  ++  +PRK L+GF+KVRL   E++VV F ++VCK LS+VDE G RKV LG HVL
Sbjct  709  TTPPQSSVRGSPRKHLLGFEKVRLGKEEEKVVRFRIEVCKDLSLVDEFGTRKVVLGEHVL  768

Query  184  HIGHLKHSLTVEI  222
            H+G LKHSL+V +
Sbjct  769  HVGSLKHSLSVRV  781



>ref|NP_196535.1| beta-xylosidase 3 [Arabidopsis thaliana]
 sp|Q9LXD6.1|BXL3_ARATH RecName: Full=Beta-D-xylosidase 3; Short=AtBXL3; AltName: Full=Alpha-L-arabinofuranosidase; 
Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB89357.1| beta-xylosidase-like protein [Arabidopsis thaliana]
 dbj|BAB09531.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AAK96639.1| AT5g09730/F17I14_80 [Arabidopsis thaliana]
 gb|AED91439.1| beta-xylosidase 3 [Arabidopsis thaliana]
Length=773

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++ P +H +P KQL+GF+K+RL  +E+ VV FNV+VCK LSVVDE G RK+ALG H+LH+
Sbjct  703  TTSPQVHGSPIKQLLGFEKIRLGKSEEAVVRFNVNVCKDLSVVDETGKRKIALGHHLLHV  762

Query  190  GHLKHSLTVEI  222
            G LKHSL + +
Sbjct  763  GSLKHSLNISV  773



>ref|XP_010424711.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PP +H +P K L+GF+KVRL  +E+ +V FNVDVCK LSVVDE G RK+ALG H+LH+
Sbjct  709  TTPPEVHGSPVKHLLGFEKVRLGKSEEAMVRFNVDVCKDLSVVDEIGTRKIALGHHLLHV  768

Query  190  GHLKHSLTV  216
            G LKHSL +
Sbjct  769  GSLKHSLNI  777



>gb|AEW09080.1| hypothetical protein CL3618Contig1_02, partial [Pinus lambertiana]
Length=86

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP+ H+AP+KQL+GF+K+ L     E V F ++VCK LS+VD+ G RK+ +G H+LHI
Sbjct  19   SSPPSRHHAPKKQLLGFRKLHLQAGAMEKVHFTLNVCKDLSIVDKTGTRKLPVGSHLLHI  78

Query  190  GHLKHSLT  213
            G L+HS++
Sbjct  79   GDLQHSVS  86



>gb|AEW09079.1| hypothetical protein CL3618Contig1_02, partial [Pinus radiata]
Length=86

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP+ H+AP+KQL+GF+K+ L     E V F ++VCK LS+VD+ G RK+ +G H+LHI
Sbjct  19   SSPPSKHHAPKKQLLGFRKLHLQAGAMEKVHFTLNVCKDLSIVDKTGTRKLPVGSHLLHI  78

Query  190  GHLKHSLT  213
            G ++HS++
Sbjct  79   GDVQHSVS  86



>gb|AFG54596.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
Length=128

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            SPP +H +P+K L+ F+KV +     E V F++DVCK LS+VDE G +K+ALG H+LH+G
Sbjct  58   SPPTIHRSPQKSLMDFRKVHVGAGATERVQFSIDVCKDLSIVDEIGVKKLALGSHILHVG  117

Query  193  HLKHSLTVEI  222
             ++HSL ++I
Sbjct  118  DVQHSLNLQI  127



>gb|EPS65933.1| hypothetical protein M569_08842, partial [Genlisea aurea]
Length=763

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            S P +H+AP K+L+GF K+ L    + V  F +DVC+HLSVVDE G RK+ LG HVLH+G
Sbjct  694  STPRVHDAPEKRLLGFDKLHLGGWGEGVARFRIDVCEHLSVVDEFGKRKLGLGEHVLHVG  753

Query  193  HLKHSLTVEI  222
              KHS  V I
Sbjct  754  GSKHSFNVAI  763



>gb|AFG54601.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
Length=128

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            SPP +H +P+K L+ F+KV +     E V F++DVCK LS+VDE G +K+ALG H+LH+G
Sbjct  58   SPPTIHRSPQKSLMDFRKVHVGAGATERVQFSIDVCKDLSIVDEIGVKKLALGSHILHVG  117

Query  193  HLKHSLTVEI  222
             ++HSL ++I
Sbjct  118  DVQHSLNLQI  127



>gb|AFG54595.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54597.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54598.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54599.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54600.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54605.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54606.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54607.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54608.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54610.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
Length=128

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            SPP +H +P+K L+ F+KV +     E V F++DVCK LS+VDE G +K+ALG H+LH+G
Sbjct  58   SPPTIHRSPQKSLMDFRKVHVGAGATERVQFSIDVCKDLSIVDEIGVKKLALGSHILHVG  117

Query  193  HLKHSLTVEI  222
             ++HSL ++I
Sbjct  118  DVQHSLNLQI  127



>gb|AFG54602.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54603.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54604.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54609.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
Length=128

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            SPP +H +P+K L+ F+KV +     E V F +DVCK LS+VDE G +K+ALG H+LH+G
Sbjct  58   SPPTIHRSPQKSLMDFRKVHVGAGATERVQFGIDVCKDLSIVDEIGVKKLALGSHILHVG  117

Query  193  HLKHSLTVEI  222
             ++HSL ++I
Sbjct  118  DVQHSLNLQI  127



>emb|CDX96113.1| BnaA07g26180D [Brassica napus]
Length=1013

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  13    SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
             +PPA+H +P K LV F+K+ L   E  VV F++DVCK LSVVDE G R++ALG +VLH+G
Sbjct  944   TPPAVHRSPVKHLVTFEKLLLGRTEIAVVRFDLDVCKDLSVVDETGKRQIALGEYVLHVG  1003

Query  193   HLKHSLTVEI  222
              LK+SL + I
Sbjct  1004  SLKYSLYITI  1013



>ref|XP_010268028.1| PREDICTED: probable beta-D-xylosidase 2 [Nelumbo nucifera]
Length=767

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +1

Query  7    SSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLH  186
            SS PPA H  P+KQLV F+KV L     + V   + +CK LSVVD+ G R++ LG HVLH
Sbjct  695  SSPPPAEHWVPQKQLVAFEKVHLPAGSQQRVQITIHLCKFLSVVDKLGIRRIPLGQHVLH  754

Query  187  IGHLKHSLTV  216
            IG++ HS+ +
Sbjct  755  IGNIHHSIVL  764



>gb|KJB49844.1| hypothetical protein B456_008G140600 [Gossypium raimondii]
Length=774

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PPA H AP KQLV F KV +    ++ V  ++ VCK LSVVD +G R++ +GLH +HI
Sbjct  696  STPPAGHWAPSKQLVAFAKVYVPARSEQQVGISIHVCKFLSVVDRSGVRRIPIGLHRIHI  755

Query  190  GHLKHSLTVE  219
            G +KHS+++E
Sbjct  756  GDVKHSVSLE  765



>ref|XP_006419427.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
 gb|ESR32667.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
Length=777

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            + PPA + +P KQL+GF+KV ++    + V  ++ VCKHLSVVD+ G R++ +G H LHI
Sbjct  692  AKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHI  751

Query  190  GHLKHSLTVE  219
            G LKHS++++
Sbjct  752  GDLKHSISLQ  761



>ref|XP_011015623.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PPA H AP KQLV F+KV ++    + V  N+ VCK LSVVD +G R++ +G H LHI
Sbjct  692  SRPPARHWAPHKQLVAFEKVHVAAGTQQRVGINIHVCKSLSVVDASGIRRIPMGEHSLHI  751

Query  190  GHLKHSLTVE  219
            G +KHS++++
Sbjct  752  GDVKHSVSLQ  761



>ref|XP_011042236.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PPA H AP KQLV F+KV ++      V  NV VCK LSVVD +G R++ +G H LHI
Sbjct  692  SKPPAGHWAPLKQLVAFEKVHVTAGTQRRVGINVHVCKFLSVVDRSGIRRIPMGAHSLHI  751

Query  190  GHLKHSLTVE  219
            G +KHS++++
Sbjct  752  GDVKHSVSLQ  761



>ref|XP_011041424.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PPA H AP KQLV F+KV ++    + V  N+ VCK LSVVD +G R++ +G H LHI
Sbjct  692  SRPPARHWAPHKQLVAFEKVHVAAGTQQRVGINIHVCKSLSVVDASGIRRIPMGEHSLHI  751

Query  190  GHLKHSLTVE  219
            G +KHS++++
Sbjct  752  GDVKHSVSLQ  761



>ref|XP_002302758.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
 gb|EEE82031.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
Length=770

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PPA H AP KQLV F+KV ++    + V  NV VCK LSVVD +G R++ +G H LHI
Sbjct  692  SKPPAGHWAPLKQLVAFEKVHVAAGTQQRVGINVHVCKFLSVVDRSGIRRIPMGAHSLHI  751

Query  190  GHLKHSLTVE  219
            G +KHS++++
Sbjct  752  GDVKHSVSLQ  761



>ref|XP_009105246.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            +PPA+H +P K LV F+K+ L   E  VV F +DVCK LSVVDE G R++ALG +VLH+G
Sbjct  705  TPPAVHRSPVKHLVTFEKLLLGRTEMAVVRFELDVCKDLSVVDETGKRQIALGEYVLHVG  764

Query  193  HLKHSLTVEI  222
             L +SL + I
Sbjct  765  SLTYSLYITI  774



>gb|AFG60329.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60330.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60331.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60332.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60333.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60334.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60335.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60336.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60337.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60338.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60339.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60340.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60341.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60342.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60343.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60344.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60345.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60346.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
Length=86

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP+ H+AP+K L+GF+K+ L     E V F ++VCK LS+VD+ G RK+ +G H+LHI
Sbjct  19   SSPPSKHHAPKKLLLGFRKLHLQAGAMEKVHFTLNVCKDLSIVDKTGTRKLPVGSHLLHI  78

Query  190  GHLKHSLT  213
            G ++HS++
Sbjct  79   GDIQHSVS  86



>gb|KDO71845.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
 gb|KDO71846.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
 gb|KDO71847.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
 gb|KDO71848.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=486

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            + PPA + +P KQL+GF+KV ++    + V  ++ VCKHLSVVD+ G R++ +G H LHI
Sbjct  409  AKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHI  468

Query  190  GHLKHSLTVE  219
            G LKHS++++
Sbjct  469  GDLKHSISLQ  478



>gb|KDO71844.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=485

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            + PPA + +P KQL+GF+KV ++    + V  ++ VCKHLSVVD+ G R++ +G H LHI
Sbjct  408  AKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHI  467

Query  190  GHLKHSLTVE  219
            G LKHS++++
Sbjct  468  GDLKHSISLQ  477



>ref|XP_007035744.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
 gb|EOY06670.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
Length=776

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PPA   +P KQL+GF +V +     + V  N+  CKHLS+VDE G R++ +G H LHI
Sbjct  699  STPPAGKWSPNKQLIGFHRVHVLAGSQQRVEINIHACKHLSIVDELGIRRIPMGAHSLHI  758

Query  190  GHLKHSLTVE  219
            G L+HS++++
Sbjct  759  GDLEHSISLQ  768



>gb|KDO71843.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=476

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            + PPA + +P KQL+GF+KV ++    + V  ++ VCKHLSVVD+ G R++ +G H LHI
Sbjct  399  AKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHI  458

Query  190  GHLKHSLTVE  219
            G LKHS++++
Sbjct  459  GDLKHSISLQ  468



>ref|XP_002320310.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
 gb|EEE98625.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
Length=765

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PPA H AP KQLV F+KV ++    + V  N+ VCK LSVVD +G R++ +G H LHI
Sbjct  687  SRPPARHWAPHKQLVAFEKVHVAAGTQQRVGINIHVCKSLSVVDGSGIRRIPMGEHSLHI  746

Query  190  GHLKHSLTVE  219
            G +KHS++++
Sbjct  747  GDVKHSVSLQ  756



>ref|XP_009348894.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 37/70 (53%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA   AP KQLVGF KV +    +  V   V VCKHLSVVD+ G R++ LG H L I
Sbjct  699  ATPPAEKWAPNKQLVGFHKVHIVAGSERRVRVGVHVCKHLSVVDKFGIRRIPLGEHKLEI  758

Query  190  GHLKHSLTVE  219
            G LKH ++VE
Sbjct  759  GDLKHHVSVE  768



>gb|EYU46800.1| hypothetical protein MIMGU_mgv1a018473mg [Erythranthe guttata]
Length=757

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            +SPP    AP KQLV F+KVR++    E V   + VCK LSVVD AG R++ +G+H LHI
Sbjct  679  ASPPGGGWAPHKQLVAFEKVRVAAGGQERVAVRIHVCKFLSVVDGAGIRRIPMGVHALHI  738

Query  190  GHLKHSLTVE  219
            G +KHS++++
Sbjct  739  GGVKHSVSLQ  748



>ref|XP_006444470.1| hypothetical protein CICLE_v10018959mg [Citrus clementina]
 ref|XP_006492318.1| PREDICTED: probable beta-D-xylosidase 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492319.1| PREDICTED: probable beta-D-xylosidase 2-like isoform X2 [Citrus 
sinensis]
 gb|ESR57710.1| hypothetical protein CICLE_v10018959mg [Citrus clementina]
Length=770

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PPA H AP KQLV F+KV +     + V  N+ VCK+LSVVD +G R++ LG H +HI
Sbjct  692  STPPAGHWAPHKQLVAFEKVHVPAGAQQRVGINIHVCKYLSVVDRSGTRRIPLGEHNIHI  751

Query  190  GHLKHSLTV  216
            G  KHS+++
Sbjct  752  GGTKHSVSL  760



>ref|XP_008341125.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            +PPA   AP KQLVGF KV +    +  V   V VCKHLSVVD+ G R++ LG H L IG
Sbjct  700  TPPAEKWAPNKQLVGFHKVHIVAGSERRVRVGVHVCKHLSVVDKFGIRRIPLGEHKLEIG  759

Query  193  HLKHSLTVE  219
             LKH ++VE
Sbjct  760  DLKHHVSVE  768



>ref|XP_008390557.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +1

Query  13   SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIG  192
            +PPA   AP KQLVGF KV +    +  V   V VCKHLSVVD+ G R++ LG H L IG
Sbjct  700  TPPAEKWAPNKQLVGFHKVHIVAGSERRVRVGVHVCKHLSVVDKFGIRRIPLGEHKLEIG  759

Query  193  HLKHSLTVE  219
             LKH ++VE
Sbjct  760  DLKHHVSVE  768



>ref|XP_003519750.1| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=772

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +1

Query  10   SSPPAL--HNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVL  183
            S+PPA   H AP KQLV F+KV +     + V   + VCK LSVVD +G R++ +GLH L
Sbjct  692  SAPPAGNGHWAPHKQLVAFEKVHIPAKAQQRVRVKIHVCKLLSVVDRSGTRRIPMGLHSL  751

Query  184  HIGHLKHSLTVE  219
            HIG +KHS++++
Sbjct  752  HIGDVKHSVSLQ  763



>gb|KHN08645.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=749

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +1

Query  10   SSPPAL--HNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVL  183
            S+PPA   H AP KQLV F+KV +     + V   + VCK LSVVD +G R++ +GLH L
Sbjct  669  SAPPAGNGHWAPHKQLVAFEKVHIPAKAQQRVRVKIHVCKLLSVVDRSGTRRIPMGLHSL  728

Query  184  HIGHLKHSLTVE  219
            HIG +KHS++++
Sbjct  729  HIGDVKHSVSLQ  740



>ref|XP_009369955.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 37/70 (53%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PPA   AP KQLVGF KV +    +  V   V VCKHLSVVD+ G R++ LG H L I
Sbjct  699  ATPPAEKWAPNKQLVGFHKVHIVAGLERRVRVGVHVCKHLSVVDKFGIRRIPLGEHKLEI  758

Query  190  GHLKHSLTVE  219
            G LKH ++VE
Sbjct  759  GDLKHHVSVE  768



>emb|CDP20993.1| unnamed protein product [Coffea canephora]
Length=74

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  34   APRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLT  213
            AP+K L+GFQK+ L+P  + +V FNV VCKHLS+VD+ G RK+A G ++LH+  LKH LT
Sbjct  10   APQKHLLGFQKLHLTPQTEGLVEFNVHVCKHLSMVDKLGKRKIATGKYMLHVEDLKHRLT  69

Query  214  VEI  222
            V +
Sbjct  70   VTV  72



>gb|KHG14371.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=772

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +1

Query  10   SSPPALHN-APRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLH  186
            S+PPA    +P KQL+GF +V +     + V  N+  CKHLSVVDE G R++ +G H LH
Sbjct  694  STPPAGQKWSPNKQLIGFHRVHVVAGSKQRVKINIHACKHLSVVDEFGIRRIPMGSHSLH  753

Query  187  IGHLKHSLTVE  219
            IG LKHS++++
Sbjct  754  IGDLKHSISLQ  764



>emb|CAJ41429.1| beta (1,4)-xylosidase [Populus tremula x Populus alba]
Length=732

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +1

Query  16   PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIGH  195
            PPA H AP KQLV F+KV ++    + V  N+ VCK LSVVD +G R++ +G H LHIG 
Sbjct  656  PPARHWAPHKQLVAFEKVHVAAGTQQRVGINIHVCKSLSVVDGSGIRRIPMGEHSLHIGD  715

Query  196  LKHSLTVE  219
            +KHS++++
Sbjct  716  VKHSVSLQ  723



>gb|KDO71842.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=369

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            + PPA + +P KQL+GF+KV ++    + V  ++ VCKHLSVVD+ G R++ +G H LHI
Sbjct  292  AKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHI  351

Query  190  GHLKHSLTVE  219
            G LKHS++++
Sbjct  352  GDLKHSISLQ  361



>gb|KDP28242.1| hypothetical protein JCGZ_14013 [Jatropha curcas]
Length=772

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PPA   AP KQLV F+KV ++    + V  N+ VCK+LSVVD+ G R++ +GLH LHI
Sbjct  694  STPPAGLWAPHKQLVAFEKVHVAAGSQQRVGINIHVCKYLSVVDKYGIRRIPIGLHSLHI  753

Query  190  GHLKHSLTVE  219
            G ++HS++++
Sbjct  754  GDIEHSVSLQ  763



>gb|KJB72795.1| hypothetical protein B456_011G198200 [Gossypium raimondii]
Length=772

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +1

Query  10   SSPPALHN-APRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLH  186
            S+PPA    +P KQL+GF +V +     + V  N+  CKHLSVVDE G R++ +G H LH
Sbjct  694  STPPAGQKWSPNKQLIGFHRVHVIAGSKQRVKINIHACKHLSVVDEFGIRRIPMGSHSLH  753

Query  187  IGHLKHSLTVE  219
            IG LKHS++++
Sbjct  754  IGDLKHSISLQ  764



>ref|NP_001280797.1| putative beta-D-xylosidase precursor [Malus domestica]
 gb|ADI79208.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Malus domestica]
Length=774

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PP    AP KQLVGF KV +    +  V   V VCKHLSVVDE G R++ LG H L I
Sbjct  697  ATPPTGKWAPNKQLVGFHKVHIVAGSERRVRVGVQVCKHLSVVDELGIRRIPLGQHKLEI  756

Query  190  GHLKHSLTVE  219
            G L+H ++VE
Sbjct  757  GDLQHHVSVE  766



>gb|KDO71849.1| hypothetical protein CISIN_1g0062242mg [Citrus sinensis]
Length=415

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            + PPA + +P KQL+GF+KV ++    + V  ++ VCKHLSVVD+ G R++ +G H LHI
Sbjct  338  AKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHI  397

Query  190  GHLKHSLTVE  219
            G LKHS++++
Sbjct  398  GDLKHSISLQ  407



>gb|KHG05051.1| putative beta-D-xylosidase 2 -like protein [Gossypium arboreum]
Length=776

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PPA H AP+KQLV F KV +       V  N+ VCK LSVVD +G R++  G+H LHI
Sbjct  698  SKPPAGHWAPQKQLVAFAKVHVPARSQRRVGINIHVCKFLSVVDRSGVRRIPTGVHNLHI  757

Query  190  GHLKHSLTVE  219
            G  KHSL+++
Sbjct  758  GGAKHSLSLQ  767



>gb|KDO87030.1| hypothetical protein CISIN_1g0041901mg, partial [Citrus sinensis]
 gb|KDO87031.1| hypothetical protein CISIN_1g0041901mg, partial [Citrus sinensis]
Length=544

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PPA H AP KQLV F+KV +     + V  N+ VCK+LSVVD +G R++ LG H +HI
Sbjct  466  STPPAGHWAPHKQLVAFEKVHVPAGAQQRVGINIHVCKYLSVVDRSGTRRIPLGEHNIHI  525

Query  190  GHLKHSLTV  216
            G  KHS+++
Sbjct  526  GGTKHSVSL  534



>emb|CDP17082.1| unnamed protein product [Coffea canephora]
Length=195

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +1

Query  7    SSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLH  186
            SS P + H AP KQLV F+KV +     + V   + VCK+LSVVD AG R++ +GLH LH
Sbjct  116  SSPPGSGHWAPHKQLVAFEKVHVPARAQQRVFLKIHVCKYLSVVDRAGIRRIPMGLHSLH  175

Query  187  IGHLKHSLTVE  219
            IG + HS++++
Sbjct  176  IGPITHSISLQ  186



>ref|XP_009593976.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana tomentosiformis]
Length=773

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PP    AP KQLV FQKV +     + V  N+ VCK+LSVVD+AG R++ +G H LHI
Sbjct  695  SKPPIGLWAPHKQLVAFQKVHVPAGSLQRVAINIHVCKYLSVVDKAGVRRIPIGEHSLHI  754

Query  190  GHLKHSLTVE  219
            G  KHSL+++
Sbjct  755  GDAKHSLSLQ  764



>ref|XP_003535953.1| PREDICTED: probable beta-D-xylosidase 2 [Glycine max]
Length=771

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +1

Query  10   SSPPAL--HNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVL  183
            S+PPA   H AP KQLV FQK+ +     + V  N+ VCK LSVVD +G R+V +GLH L
Sbjct  691  SAPPAGNGHWAPHKQLVAFQKLHIPSKAQQRVNVNIHVCKLLSVVDRSGTRRVPMGLHSL  750

Query  184  HIGHLKHSLTVE  219
            HIG +KH ++++
Sbjct  751  HIGDVKHYVSLQ  762



>gb|KJB09457.1| hypothetical protein B456_001G143600 [Gossypium raimondii]
Length=797

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PPA H AP+KQLV F KV +       V  N+ VCK LSVVD +G R++  G+H LHI
Sbjct  719  SKPPAGHWAPQKQLVAFAKVLVPARSQRRVGINIHVCKFLSVVDRSGVRRIPTGVHNLHI  778

Query  190  GHLKHSLTVE  219
            G +KH L+++
Sbjct  779  GGIKHPLSLQ  788



>ref|XP_010024778.1| PREDICTED: putative beta-D-xylosidase [Eucalyptus grandis]
 gb|KCW61273.1| hypothetical protein EUGRSUZ_H04033 [Eucalyptus grandis]
Length=788

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP    +P +QL+GF+KV +S      V  +V VC+HLSVVDE G R++ +G H LH+
Sbjct  715  SAPPEGKWSPARQLIGFEKVHVSAGSQRRVRIDVRVCEHLSVVDEFGIRRIPIGEHKLHV  774

Query  190  GHLKHSLTVE  219
            G ++HS+T++
Sbjct  775  GDVEHSMTLQ  784



>ref|XP_011079568.1| PREDICTED: probable beta-D-xylosidase 2 [Sesamum indicum]
Length=771

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP    AP KQL+ F+KV+++    E V   + VCK+LSVVD AG R++ +G H LHI
Sbjct  693  STPPRGLGAPHKQLITFEKVKVAAGGQERVPIKIHVCKYLSVVDGAGVRRIPMGEHALHI  752

Query  190  GHLKHSLTVE  219
            G ++H++++E
Sbjct  753  GDIRHAISLE  762



>ref|XP_010094323.1| Beta-D-xylosidase 1 [Morus notabilis]
 gb|EXB55743.1| Beta-D-xylosidase 1 [Morus notabilis]
Length=783

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP    A  KQLVGFQKV L+    + V+  V VCKHLS+VD+ G R++ +G H LHI
Sbjct  705  STPPTHKWAAHKQLVGFQKVHLAAGSRQRVILGVHVCKHLSIVDQFGIRRIPMGEHTLHI  764

Query  190  G-HLKHSLTVE  219
            G  LKHS++ +
Sbjct  765  GDDLKHSISFQ  775



>gb|KCW61272.1| hypothetical protein EUGRSUZ_H04033 [Eucalyptus grandis]
Length=749

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP    +P +QL+GF+KV +S      V  +V VC+HLSVVDE G R++ +G H LH+
Sbjct  676  SAPPEGKWSPARQLIGFEKVHVSAGSQRRVRIDVRVCEHLSVVDEFGIRRIPIGEHKLHV  735

Query  190  GHLKHSLTVE  219
            G ++HS+T++
Sbjct  736  GDVEHSMTLQ  745



>ref|XP_009378701.1| PREDICTED: probable beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=789

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PPA   APRKQLV F+KV +       V   + VCK LSVVD  G R++ +G H LHI
Sbjct  708  STPPAQDWAPRKQLVAFEKVYVPARAQRRVRIQIHVCKSLSVVDRFGIRRIPMGQHNLHI  767

Query  190  GHLKHSLTVE  219
            G L HS++++
Sbjct  768  GDLMHSVSLK  777



>ref|XP_007051080.1| Beta-xylosidase 2 [Theobroma cacao]
 gb|EOX95237.1| Beta-xylosidase 2 [Theobroma cacao]
Length=818

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+ PA H AP+KQLV F KVR+     + +  N+ VCK LSVVD +G R++ +G+H LHI
Sbjct  740  STTPAGHWAPQKQLVAFAKVRVPAGAQQRIGINIHVCKFLSVVDGSGVRRIPIGVHNLHI  799

Query  190  GHLKHSLTVE  219
            G++KHS++++
Sbjct  800  GNVKHSVSLQ  809



>ref|XP_008353169.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=774

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++PP    AP KQLVGF KV +    +  V   V VCKHLSVVD  G R++ LG H L I
Sbjct  697  ATPPTGKWAPNKQLVGFHKVHIVAGSERRVRVGVQVCKHLSVVDXXGIRRIPLGQHKLEI  756

Query  190  GHLKHSLTVE  219
            G L+H ++VE
Sbjct  757  GDLQHHVSVE  766



>ref|XP_010259348.1| PREDICTED: putative beta-D-xylosidase [Nelumbo nucifera]
Length=775

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PP    AP KQLV F+KV +    ++ V   +  CKHLSVVD  G R++ +G H LHI
Sbjct  698  SEPPTGQWAPSKQLVAFEKVHVPAGTEQRVEVKIHACKHLSVVDRFGIRRIPMGEHSLHI  757

Query  190  GHLKHSLTVE  219
            G +KHS++++
Sbjct  758  GDVKHSVSLQ  767



>emb|CDO98788.1| unnamed protein product [Coffea canephora]
Length=770

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PPA   AP KQLV F+KV +     + +  + D CKHLSVVD  G R++ +G+H L I
Sbjct  693  STPPAGKWAPAKQLVAFEKVHVLAGAQQRISVHFDACKHLSVVDRFGIRRIPMGVHSLQI  752

Query  190  GHLKHSLTVE  219
            G L+H++T++
Sbjct  753  GDLEHAITLQ  762



>gb|KHG28205.1| putative beta-D-xylosidase 2 -like protein [Gossypium arboreum]
Length=529

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PPA H AP KQLV F KV +    ++ V  ++ VCK LSVVD +G R++ +GLH +HI
Sbjct  451  SIPPAGHWAPSKQLVAFAKVYVLARSEQQVGISIHVCKFLSVVDRSGVRRIPIGLHHIHI  510

Query  190  GHLKHSLTVE  219
            G +KHS+++E
Sbjct  511  GDVKHSVSLE  520



>ref|XP_006399554.1| hypothetical protein EUTSA_v10012725mg [Eutrema salsugineum]
 gb|ESQ41007.1| hypothetical protein EUTSA_v10012725mg [Eutrema salsugineum]
Length=796

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +1

Query  7    SSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLH  186
            S  PP L   P+KQL+GF +V +  NE    VF +D CK LSV ++AG R + LG+HVL 
Sbjct  725  SRMPPVLSGVPKKQLIGFDRVHVRSNEMIETVFVIDPCKQLSVANDAGKRVIPLGVHVLF  784

Query  187  IGHLKHSLTVE  219
            +G  +HSL++E
Sbjct  785  LGDSQHSLSLE  795



>ref|XP_006349198.1| PREDICTED: probable beta-D-xylosidase 2-like [Solanum tuberosum]
Length=774

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PP     P KQLV FQKV +     + V  N+ VCK+LSVVD+AG R++++G H +HI
Sbjct  696  SKPPVDVWVPHKQLVAFQKVYVPARSKQRVAINIHVCKYLSVVDKAGVRRISIGEHSIHI  755

Query  190  GHLKHSLTVE  219
            G  KHSL+++
Sbjct  756  GDAKHSLSLQ  765



>ref|XP_010481135.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP    AP+KQLV F++V ++  E + V  N+ VCK+LSVVD AGNR++ +G H +HI
Sbjct  691  SAPPGGEWAPKKQLVAFERVHVAVGEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHI  750

Query  190  GHLKHSLTVE  219
            G  +H+++++
Sbjct  751  GDERHTVSLQ  760



>ref|XP_010457247.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP    AP+KQLV F++V ++  E + V  N+ VCK+LSVVD AGNR++ +G H +HI
Sbjct  691  SAPPGGEWAPKKQLVAFERVHVAVGEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHI  750

Query  190  GHLKHSLTVE  219
            G  +H+++++
Sbjct  751  GDERHTVSLQ  760



>ref|XP_010679361.1| PREDICTED: probable beta-D-xylosidase 2 [Beta vulgaris subsp. 
vulgaris]
Length=765

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PPA   AP+KQLV F++V L     + V  ++ VCK+LSVVD++G R++ LG H +HI
Sbjct  687  SRPPAGKWAPQKQLVAFERVHLPAGSQQRVRVHIHVCKYLSVVDKSGIRRIPLGDHHIHI  746

Query  190  GHLKHSLTVE  219
            G+ +HS++++
Sbjct  747  GNARHSISLK  756



>ref|XP_002889410.1| hypothetical protein ARALYDRAFT_470222 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65669.1| hypothetical protein ARALYDRAFT_470222 [Arabidopsis lyrata subsp. 
lyrata]
Length=763

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP    AP+KQLV F++V ++  E + V  N+ VCK+LSVVD AGNR++ +G H +HI
Sbjct  685  SAPPGGEWAPKKQLVAFERVHVAVGEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHI  744

Query  190  GHLKHSLTVE  219
            G   H+++++
Sbjct  745  GDESHTVSLQ  754



>ref|XP_002515300.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF47284.1| Beta-glucosidase, putative [Ricinus communis]
Length=768

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PPA   +P KQLV F++V +S    E V  ++ VCK LSVVD +G R++ +G H +HI
Sbjct  690  SAPPAGRWSPHKQLVAFERVHVSAGTQERVGISIHVCKLLSVVDRSGIRRIPIGEHSIHI  749

Query  190  GHLKHSLTVE  219
            G++KHS++++
Sbjct  750  GNVKHSVSLQ  759



>ref|XP_010087253.1| putative beta-D-xylosidase 2 [Morus notabilis]
 gb|EXB28603.1| putative beta-D-xylosidase 2 [Morus notabilis]
Length=779

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/72 (46%), Positives = 50/72 (69%), Gaps = 2/72 (3%)
 Frame = +1

Query  10   SSPPAL--HNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVL  183
            S+PP    H AP KQLV FQKVR++    + V  ++ VCK+LSVVD +G R++ +G H +
Sbjct  699  STPPTENGHWAPLKQLVAFQKVRVAAGSQQRVRISIHVCKYLSVVDRSGIRRLPMGEHNI  758

Query  184  HIGHLKHSLTVE  219
            HIG  +HS++++
Sbjct  759  HIGDARHSVSLQ  770



>ref|XP_010546993.1| PREDICTED: beta-D-xylosidase 1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010546994.1| PREDICTED: beta-D-xylosidase 1-like isoform X2 [Tarenaya hassleriana]
 ref|XP_010546995.1| PREDICTED: beta-D-xylosidase 1-like isoform X3 [Tarenaya hassleriana]
Length=775

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  43   KQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  219
            KQLVGF+KV +S     V+  +V  CKHL VVDE G R++  G H LHIG +KHS+ V+
Sbjct  711  KQLVGFEKVHVSAGAKRVIRVDVHACKHLGVVDEYGKRRIPFGEHKLHIGDIKHSILVK  769



>ref|XP_002316021.1| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEF02192.1| beta-D-xylosidase family protein [Populus trichocarpa]
Length=768

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP    + +KQL+GF+KV L     + V  ++ VCKHLSVVD  G R++ +G H L+I
Sbjct  691  SSPPGGKWSTQKQLIGFEKVHLVTGSQKRVKIDIHVCKHLSVVDRFGIRRIPIGEHDLYI  750

Query  190  GHLKHSLTVE  219
            G LKHS++++
Sbjct  751  GDLKHSISLQ  760



>dbj|BAD98523.1| alpha-L-arabinofuranosidase / beta-D-xylosidase [Pyrus pyrifolia]
Length=774

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++ PA   AP KQLVGF KV +    +  V   V VCKHLS+VD+ G R++ LG H L I
Sbjct  697  ATQPAGKWAPNKQLVGFHKVHIVAGSERRVRVGVHVCKHLSIVDKLGIRRIPLGQHKLEI  756

Query  190  GHLKHSLTVE  219
            G LKH +++E
Sbjct  757  GDLKHYVSIE  766



>dbj|BAF79669.1| beta-D-xylosidase [Pyrus pyrifolia]
Length=774

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++ PA   AP KQLVGF KV +    +  V   V VCKHLS+VD+ G R++ LG H L I
Sbjct  697  ATQPAGKWAPNKQLVGFHKVHIVAGSERRVRVGVHVCKHLSIVDKLGIRRIPLGQHKLEI  756

Query  190  GHLKHSLTVE  219
            G LKH +++E
Sbjct  757  GDLKHYVSIE  766



>gb|AGR44452.1| alpha-L-arabinofuranosidase/beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=774

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            ++ PA   AP KQLVGF KV +    +  V   V VCKHLS+VD+ G R++ LG H L I
Sbjct  697  ATQPAGKWAPNKQLVGFHKVHIVAGSERRVRVGVHVCKHLSIVDKLGIRRIPLGQHKLEI  756

Query  190  GHLKHSLTVE  219
            G LKH +++E
Sbjct  757  GDLKHYVSIE  766



>gb|AAG10624.1|AC022521_2 Similar to xylosidase [Arabidopsis thaliana]
Length=763

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP    AP+KQLV F++V ++  E + V  N+ VCK+LSVVD AGNR++ +G H +HI
Sbjct  685  SAPPGGEWAPKKQLVAFERVHVAVGEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHI  744

Query  190  GHLKHSLTVE  219
            G   H+++++
Sbjct  745  GDESHTVSLQ  754



>gb|KFK25328.1| hypothetical protein AALP_AA8G098500 [Arabis alpina]
Length=791

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +1

Query  7    SSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLH  186
            S  PP L   P KQL+GF +V +  NE    VF +D CK L+V ++ G R +ALG HVL 
Sbjct  720  SKMPPVLSGVPEKQLIGFDRVHVGSNEIVETVFVIDPCKDLTVANDVGKRVIALGNHVLF  779

Query  187  IGHLKHSLTVE  219
            +G L+HSL++E
Sbjct  780  LGDLQHSLSLE  790



>ref|NP_563659.1| probable beta-D-xylosidase 2 [Arabidopsis thaliana]
 sp|Q94KD8.1|BXL2_ARATH RecName: Full=Probable beta-D-xylosidase 2; Short=AtBXL2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK56255.1|AF367266_1 At1g02640/T14P4_11 [Arabidopsis thaliana]
 gb|AAN28891.1| At1g02640/T14P4_11 [Arabidopsis thaliana]
 gb|AEE27453.1| probable beta-D-xylosidase 2 [Arabidopsis thaliana]
Length=768

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP    AP+KQLV F++V ++  E + V  N+ VCK+LSVVD AGNR++ +G H +HI
Sbjct  690  SAPPGGEWAPKKQLVAFERVHVAVGEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHI  749

Query  190  GHLKHSLTVE  219
            G   H+++++
Sbjct  750  GDESHTVSLQ  759



>ref|NP_001266107.1| SlArf/Xyl2 protein precursor [Solanum lycopersicum]
 dbj|BAL44717.1| SlArf/Xyl2 [Solanum lycopersicum]
Length=774

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PP     P KQLV FQKV +     + V  N+ VCK+LSVVD AG R++ +G H +HI
Sbjct  696  SKPPVDIWVPHKQLVAFQKVYVPARSKQRVAINIHVCKYLSVVDRAGVRRIPIGEHSIHI  755

Query  190  GHLKHSLTVE  219
            G  KHSL+++
Sbjct  756  GDAKHSLSLQ  765



>dbj|BAC41913.1| putative beta-xylosidase [Arabidopsis thaliana]
Length=732

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +1

Query  7    SSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLH  186
            S  PP L   P KQL+G+ +V +  NE    VF +D CK LSV ++ G R + LG HVL 
Sbjct  661  SKMPPVLSGVPEKQLIGYDRVHVRSNEMMETVFVIDPCKQLSVANDVGKRVIPLGSHVLF  720

Query  187  IGHLKHSLTVE  219
            +G L+HSL+VE
Sbjct  721  LGDLQHSLSVE  731



>ref|XP_006306829.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
 gb|EOA39727.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
Length=768

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP    AP+KQLV F++V ++  E + V  N+ VCK+LSVVD AGNR++ +G H +HI
Sbjct  690  SAPPGGEWAPKKQLVAFERVHVAVGEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHI  749

Query  190  GHLKHSLTVE  219
            G   H+++++
Sbjct  750  GDESHTVSLQ  759



>ref|XP_010652235.1| PREDICTED: probable beta-D-xylosidase 2 isoform X2 [Vitis vinifera]
Length=626

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PPA H AP KQLV F+KV ++    + V  N+ VCK+LSVVD +G R++ +G H LHI
Sbjct  548  SKPPAGHWAPHKQLVAFEKVHVAARTQQRVQINIHVCKYLSVVDRSGIRRIPMGQHGLHI  607

Query  190  GHLKHSLTVE  219
            G  KH ++++
Sbjct  608  GDTKHLVSLQ  617



>ref|XP_009757165.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana sylvestris]
Length=770

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PP     P KQLV FQKV +     + V  N+ VCK+LSVVD AG R++ +G H LHI
Sbjct  692  SKPPVGLWVPHKQLVAFQKVYVPAGSLQRVTINIHVCKYLSVVDRAGVRRIPIGEHSLHI  751

Query  190  GHLKHSLTVE  219
            G  KH+L+++
Sbjct  752  GDAKHTLSLQ  761



>ref|XP_006306830.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
 gb|EOA39728.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
Length=625

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP    AP+KQLV F++V ++  E + V  N+ VCK+LSVVD AGNR++ +G H +HI
Sbjct  547  SAPPGGEWAPKKQLVAFERVHVAVGEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHI  606

Query  190  GHLKHSLTVE  219
            G   H+++++
Sbjct  607  GDESHTVSLQ  616



>ref|NP_196618.1| putative beta-D-xylosidase 6 [Arabidopsis thaliana]
 sp|Q9LXA8.1|BXL6_ARATH RecName: Full=Probable beta-D-xylosidase 6; Short=AtBXL6; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB89387.1| beta-xylosidase-like protein [Arabidopsis thaliana]
 gb|AAL09717.1| AT5g10560/F12B17_90 [Arabidopsis thaliana]
 gb|AED91563.1| putative beta-D-xylosidase 6 [Arabidopsis thaliana]
Length=792

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +1

Query  7    SSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLH  186
            S  PP L   P KQL+G+ +V +  NE    VF +D CK LSV ++ G R + LG HVL 
Sbjct  721  SKMPPVLSGVPEKQLIGYDRVHVRSNEMMETVFVIDPCKQLSVANDVGKRVIPLGSHVLF  780

Query  187  IGHLKHSLTVE  219
            +G L+HSL+VE
Sbjct  781  LGDLQHSLSVE  791



>ref|XP_002270249.1| PREDICTED: probable beta-D-xylosidase 2 isoform X1 [Vitis vinifera]
 emb|CBI36935.3| unnamed protein product [Vitis vinifera]
Length=768

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PPA H AP KQLV F+KV ++    + V  N+ VCK+LSVVD +G R++ +G H LHI
Sbjct  690  SKPPAGHWAPHKQLVAFEKVHVAARTQQRVQINIHVCKYLSVVDRSGIRRIPMGQHGLHI  749

Query  190  GHLKHSLTVE  219
            G  KH ++++
Sbjct  750  GDTKHLVSLQ  759



>ref|XP_011020382.1| PREDICTED: putative beta-D-xylosidase [Populus euphratica]
Length=768

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP    +  K+L+GF+KV L     + V  ++ VCKHLSVVD  G R++ +G H LHI
Sbjct  691  SSPPEGKWSTNKKLIGFEKVHLVAGSKKRVKIDIPVCKHLSVVDRFGIRRLPIGKHDLHI  750

Query  190  GHLKHSLTVE  219
            G LKHS++++
Sbjct  751  GDLKHSISLQ  760



>ref|XP_006855294.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
 gb|ERN16761.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
Length=768

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP  H AP KQLVGF+++ L  N  +   F++DVC+ LS+VD+ G +K+ +G H+  +
Sbjct  695  STPPQGHGAPSKQLVGFRRIHLPSNSQQQARFDIDVCRDLSIVDQFGLKKLPIGSHLFQV  754

Query  190  GHLKHSLTVEI  222
            G L HS+++++
Sbjct  755  GELTHSVSLQL  765



>gb|KJB38535.1| hypothetical protein B456_006G259500 [Gossypium raimondii]
Length=774

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +1

Query  7    SSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLH  186
            S  P A+  +P KQL+ F +V +     + V  NV  CKHLSVVDE G R++ +G H L+
Sbjct  696  SEPPAAVKWSPNKQLISFHRVHVIAGSKQRVKINVHACKHLSVVDEFGIRRIPMGQHSLY  755

Query  187  IGHLKHSLTVE  219
            IG LKHS++++
Sbjct  756  IGDLKHSISLQ  766



>ref|XP_011009934.1| PREDICTED: putative beta-D-xylosidase [Populus euphratica]
Length=767

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP    + +KQL+GF+KV L     + V  ++ VCKHLSVVD  G R++ +G H L+I
Sbjct  690  SSPPGGKWSTQKQLIGFEKVHLVTGSQKRVKIDIHVCKHLSVVDRFGIRRIPIGEHDLYI  749

Query  190  GHLKHSLTV  216
            G LKHS+++
Sbjct  750  GDLKHSISL  758



>ref|XP_009339788.1| PREDICTED: probable beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=788

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PPA   AP KQLV F+KV +       V  N+ VCK LSVVD  G R++ +G H LHI
Sbjct  707  STPPAQDWAPHKQLVTFEKVYVPARAQRRVRINIHVCKSLSVVDRFGIRRIPMGQHNLHI  766

Query  190  GHLKHSLTVE  219
            G L HS++++
Sbjct  767  GDLMHSISLK  776



>ref|XP_004300463.1| PREDICTED: probable beta-D-xylosidase 2 [Fragaria vesca subsp. 
vesca]
Length=790

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 37/73 (51%), Positives = 48/73 (66%), Gaps = 3/73 (4%)
 Frame = +1

Query  10   SSPPAL--HNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVL  183
            SSPPA   H  P KQLV F+KV +       V FN+ VCKHLSVVD +G R++ +G H L
Sbjct  711  SSPPAAAGHWVPHKQLVAFEKVYVPARTQRRVRFNIHVCKHLSVVDRSGIRRIPMGRHDL  770

Query  184  HIG-HLKHSLTVE  219
            HIG H+ HS +++
Sbjct  771  HIGDHIVHSFSIQ  783



>ref|XP_004136155.1| PREDICTED: probable beta-D-xylosidase 2-like [Cucumis sativus]
 gb|KGN45007.1| hypothetical protein Csa_7G407600 [Cucumis sativus]
Length=772

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 33/72 (46%), Positives = 51/72 (71%), Gaps = 2/72 (3%)
 Frame = +1

Query  10   SSPPA--LHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVL  183
            S+PPA      PRKQLV F+K+ L+  E   +  +V VCK+LSVVD+ G R++ LG H +
Sbjct  692  STPPANGATWVPRKQLVAFEKLHLASREKRRLQVHVHVCKYLSVVDKLGVRRIPLGDHYI  751

Query  184  HIGHLKHSLTVE  219
            HIG++KH+++++
Sbjct  752  HIGNVKHTVSLQ  763



>gb|ABK96385.1| unknown [Populus trichocarpa x Populus deltoides]
Length=343

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP    + +KQL+GF+KV L     + V  ++ VCKHLSVVD  G R++  G H L+I
Sbjct  266  SSPPGGKWSTQKQLIGFEKVHLVTGSQKRVKIDIHVCKHLSVVDRFGIRRIPNGEHYLYI  325

Query  190  GHLKHSLTVE  219
            G LKHS++++
Sbjct  326  GDLKHSISLQ  335



>ref|XP_011082425.1| PREDICTED: probable beta-D-xylosidase 2 [Sesamum indicum]
Length=791

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP    AP+KQLV F+KV +     + +  ++ VCK+LSVVD  G R++ +G H LHI
Sbjct  713  SSPPGGDWAPQKQLVAFEKVSVRAGGQQRIGVSIRVCKYLSVVDRFGVRRIPMGEHGLHI  772

Query  190  GHLKHSLTVE  219
            G  +H++++E
Sbjct  773  GDARHAVSLE  782



>ref|XP_002311398.2| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEE88765.2| beta-D-xylosidase family protein [Populus trichocarpa]
Length=771

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP    +  K+L+GF+KV +     + V  ++ VCKHLSVVD  G R++ +G H LHI
Sbjct  694  SSPPEGKWSANKKLIGFEKVHIVAGSKKRVKIDIPVCKHLSVVDRFGIRRLPIGKHDLHI  753

Query  190  GHLKHSLTVE  219
            G LKHS++++
Sbjct  754  GDLKHSISLQ  763



>ref|XP_008386729.1| PREDICTED: probable beta-D-xylosidase 2 [Malus domestica]
Length=788

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PPA   AP KQLV F+KV +       +  N+ VCK LSVVD  G R++ +G H LHI
Sbjct  707  STPPAQDWAPHKQLVTFEKVYVPARAQRRLRINIHVCKSLSVVDRFGIRRIPMGQHNLHI  766

Query  190  GHLKHSLTVE  219
            G L HS++++
Sbjct  767  GDLMHSVSLK  776



>gb|EYU23074.1| hypothetical protein MIMGU_mgv1a019840mg, partial [Erythranthe 
guttata]
Length=739

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 48/73 (66%), Gaps = 3/73 (4%)
 Frame = +1

Query  10   SSPPA---LHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHV  180
            SSPP+    H AP+KQLV F+KV L     + V   + VC+ +SVVDE+G R+V +G H 
Sbjct  665  SSPPSDGGRHWAPQKQLVAFEKVSLPAGGRQRVAVKIHVCRQMSVVDESGIRRVPMGEHS  724

Query  181  LHIGHLKHSLTVE  219
            L+IG  +H +++E
Sbjct  725  LYIGDARHVVSLE  737



>ref|XP_008451490.1| PREDICTED: probable beta-D-xylosidase 2 [Cucumis melo]
Length=773

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 51/72 (71%), Gaps = 2/72 (3%)
 Frame = +1

Query  10   SSPPA--LHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVL  183
            S+PPA      PRKQLV F+K+ LS  E   +  +V +CK+LSVVD+ G R++ LG HV+
Sbjct  693  STPPANGATWVPRKQLVAFEKLHLSSKEKRRLQVHVHICKYLSVVDKLGVRRIPLGDHVI  752

Query  184  HIGHLKHSLTVE  219
            HIG +KH+++++
Sbjct  753  HIGDVKHTISLQ  764



>ref|XP_010453089.1| PREDICTED: probable beta-D-xylosidase 6 [Camelina sativa]
Length=798

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = +1

Query  7    SSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLH  186
            S  PP +   P KQL+GF +V +  NE    VF +D CKHL V ++ G R + LG+HVL 
Sbjct  726  SKMPPVISGVPEKQLIGFDRVHVRSNEVIETVFMIDPCKHLIVANDVGKRVIPLGIHVLF  785

Query  187  IGH-LKHSLTVEI  222
            +G  L+HSL+VE+
Sbjct  786  LGDLLQHSLSVEL  798



>gb|KDP27887.1| hypothetical protein JCGZ_18967 [Jatropha curcas]
Length=775

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP    +  KQL+GF+K+ L     + V  N+ VCKHLSVVD  G R++ +G H LHI
Sbjct  698  SSPPEGKWSSNKQLIGFEKIHLVAGSQKQVRINIHVCKHLSVVDRFGIRRIPIGKHHLHI  757

Query  190  GHLKHSLTVE  219
            G LKHS++++
Sbjct  758  GDLKHSISLQ  767



>ref|XP_003591420.1| Beta xylosidase [Medicago truncatula]
 gb|AES61671.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=765

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = +1

Query  10   SSPPAL--HNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVL  183
            S PP    H AP+KQLV F+KV +     + V  N+ VCK LSVVD++G R++ +G H +
Sbjct  685  SVPPTGNGHWAPQKQLVAFEKVYVPAKAQQRVRINIHVCKLLSVVDKSGTRRIPMGAHSI  744

Query  184  HIGHLKHSLTVE  219
            HIG +KH ++++
Sbjct  745  HIGDVKHFVSLQ  756



>ref|XP_010491733.1| PREDICTED: probable beta-D-xylosidase 6 [Camelina sativa]
Length=800

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = +1

Query  7    SSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLH  186
            S  PP +   P KQL+GF +V +  NE    VF +D CKHL V ++ G R + LG+HVL 
Sbjct  728  SKMPPVISGVPEKQLIGFDRVHVHSNEMIETVFVIDPCKHLIVANDVGKRVIPLGIHVLF  787

Query  187  IGH-LKHSLTVEI  222
            +G  L+HSL+VE+
Sbjct  788  LGDLLQHSLSVEL  800



>ref|XP_007138975.1| hypothetical protein PHAVU_009G254300g [Phaseolus vulgaris]
 gb|ESW10969.1| hypothetical protein PHAVU_009G254300g [Phaseolus vulgaris]
Length=772

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S PP    +  KQLV FQK+ +     + V   V VCKHLSVVD+ G R++  G H LHI
Sbjct  696  SKPPPGKWSQIKQLVNFQKIHVPAGSTQRVTVGVHVCKHLSVVDQFGIRRIPSGEHELHI  755

Query  190  GHLKHSLTVE  219
            G LKHS++V+
Sbjct  756  GDLKHSISVQ  765



>emb|CDX97026.1| BnaC09g45990D [Brassica napus]
Length=751

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +1

Query  7    SSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLH  186
            S  P  L   P +QL+GF++V +  +E     F +D CKHLSV ++ G R + LG+H L 
Sbjct  680  SRMPRVLSGVPERQLIGFERVHVRSSEMVEAEFVIDPCKHLSVANDVGKRVIPLGVHDLV  739

Query  187  IGHLKHSLTVE  219
            +G LKHSL++E
Sbjct  740  LGDLKHSLSLE  750



>emb|CDY15255.1| BnaC05g01340D [Brassica napus]
Length=762

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP+   APRKQLV F +V ++  E + V  N+ VCK+LSVVD AG R++ +G H +HI
Sbjct  684  SAPPSGEWAPRKQLVAFTRVHVATGESKRVQVNIHVCKYLSVVDRAGIRRIPIGDHGIHI  743

Query  190  GHLKHSLTVE  219
            G   H+++++
Sbjct  744  GDESHTVSLQ  753



>ref|XP_006287090.1| hypothetical protein CARUB_v10000252mg, partial [Capsella rubella]
 gb|EOA19988.1| hypothetical protein CARUB_v10000252mg, partial [Capsella rubella]
Length=803

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +1

Query  7    SSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLH  186
            S  P  +   P KQL+GF +V +   E    V  +D CKHL V ++ G R + LG+HVL 
Sbjct  732  SKMPQVISGVPEKQLIGFDRVHVRSKEMIETVLVIDPCKHLIVANDVGKRVIPLGIHVLS  791

Query  187  IGHLKHSLTVE  219
            +G L+HSL++E
Sbjct  792  LGDLQHSLSLE  802



>ref|XP_009119616.1| PREDICTED: probable beta-D-xylosidase 2 [Brassica rapa]
Length=767

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            S+PP+   APRKQLV F +V ++  E++ V  N+ VCK+LSVVD AG R++ +G H +HI
Sbjct  689  SAPPSGEWAPRKQLVAFTRVHVAAGENKRVQVNIHVCKYLSVVDRAGIRRIPIGDHGIHI  748

Query  190  GHLKHSLTVE  219
            G   H+++++
Sbjct  749  GDESHTVSLQ  758



>ref|XP_009111875.1| PREDICTED: beta-D-xylosidase 1-like [Brassica rapa]
Length=787

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  43   KQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  219
            KQL+ F+KV ++      V  +VD CKHL VVDE G R++ +G H LHIG LKH++ V+
Sbjct  726  KQLIAFEKVHVTAGAKRTVQVDVDACKHLGVVDEYGKRRIPMGEHKLHIGDLKHTILVQ  784



>emb|CDY49607.1| BnaA09g03310D [Brassica napus]
Length=788

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  43   KQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  219
            KQL+ F+KV ++      V  +VD CKHL VVDE G R++ +G H LHIG LKH++ V+
Sbjct  727  KQLIAFEKVHVTAGAKRTVQVDVDACKHLGVVDEYGKRRIPMGEHKLHIGDLKHTILVQ  785



>ref|XP_006280043.1| hypothetical protein CARUB_v10025920mg [Capsella rubella]
 gb|EOA12941.1| hypothetical protein CARUB_v10025920mg [Capsella rubella]
Length=776

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  43   KQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  219
            KQLV F+KV ++    + V  NVD CKHL VVDE G R++ +G H LHIG LKH++ V+
Sbjct  715  KQLVTFEKVHVTAGAKQTVQINVDACKHLGVVDEYGKRRIPMGEHKLHIGDLKHTILVQ  773



>ref|XP_004295104.1| PREDICTED: putative beta-D-xylosidase [Fragaria vesca subsp. 
vesca]
Length=772

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHI  189
            SSPP+   A  KQLVGF KV +     + V F+V VCKHLSVVD+ G +++ +G H L I
Sbjct  695  SSPPSGKWAVNKQLVGFHKVHIVAGSQKRVKFDVHVCKHLSVVDQFGIQRIPIGEHKLQI  754

Query  190  GHLKHSLTVE  219
            G L+H ++VE
Sbjct  755  GDLEHHISVE  764



>emb|CDX85405.1| BnaC07g27160D [Brassica napus]
Length=772

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  43   KQLVGFQKVRLSPnedevvvfnvdvCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  219
            KQL+ F+KV ++      V  +VD CKHL VVDE G R++ +G H LHIG LKH++ V+
Sbjct  711  KQLIAFEKVHVTAGAKRTVQVDVDACKHLGVVDEYGRRRIPMGEHKLHIGDLKHTILVQ  769



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566299029105