BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS047C04

Length=642
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001234317.1|  TBG6 protein precursor                             243   4e-71   Solanum lycopersicum
ref|XP_006340680.1|  PREDICTED: beta-galactosidase 3-like               242   5e-71   Solanum tuberosum [potatoes]
gb|ADO34791.1|  beta-galactosidase STBG6                                241   1e-70   Solanum lycopersicum
gb|EYU24087.1|  hypothetical protein MIMGU_mgv1a001258mg                241   2e-70   Erythranthe guttata [common monkey flower]
ref|XP_009628690.1|  PREDICTED: beta-galactosidase 3                    238   2e-69   Nicotiana tomentosiformis
ref|XP_009789452.1|  PREDICTED: beta-galactosidase 3                    238   2e-69   Nicotiana sylvestris
gb|KHF97862.1|  Beta-galactosidase 3                                    228   8e-68   Gossypium arboreum [tree cotton]
gb|KJB43420.1|  hypothetical protein B456_007G198900                    228   4e-67   Gossypium raimondii
gb|KJB43418.1|  hypothetical protein B456_007G198900                    228   1e-66   Gossypium raimondii
gb|EYU31167.1|  hypothetical protein MIMGU_mgv1a001956mg                228   4e-66   Erythranthe guttata [common monkey flower]
gb|KJB43423.1|  hypothetical protein B456_007G198900                    228   6e-66   Gossypium raimondii
gb|KJB43422.1|  hypothetical protein B456_007G198900                    228   6e-66   Gossypium raimondii
gb|KJB43424.1|  hypothetical protein B456_007G198900                    228   6e-66   Gossypium raimondii
gb|KJB43419.1|  hypothetical protein B456_007G198900                    228   7e-66   Gossypium raimondii
ref|XP_010649088.1|  PREDICTED: beta-galactosidase 3                    228   1e-65   Vitis vinifera
ref|XP_010113483.1|  Beta-galactosidase 3                               227   1e-65   Morus notabilis
ref|XP_007046795.1|  Beta-galactosidase 3 isoform 2                     224   3e-65   
ref|XP_007046794.1|  Beta-galactosidase 3 isoform 1                     225   1e-64   
ref|XP_004287850.1|  PREDICTED: beta-galactosidase 3                    224   1e-64   Fragaria vesca subsp. vesca
ref|XP_007158612.1|  hypothetical protein PHAVU_002G1672000g            214   4e-64   Phaseolus vulgaris [French bean]
ref|XP_006380782.1|  hypothetical protein POPTR_0007s13540g             220   7e-64   
ref|XP_007204246.1|  hypothetical protein PRUPE_ppa002271mg             221   8e-64   
gb|KDO71054.1|  hypothetical protein CISIN_1g003044mg                   219   1e-63   Citrus sinensis [apfelsine]
gb|EPS70273.1|  beta-galactosidase                                      218   2e-63   Genlisea aurea
gb|AAW47739.1|  beta-galactosidase                                      221   3e-63   Prunus persica
gb|KGN48881.1|  hypothetical protein Csa_6G504610                       220   3e-63   Cucumis sativus [cucumbers]
ref|XP_011100972.1|  PREDICTED: beta-galactosidase 3-like               220   5e-63   Sesamum indicum [beniseed]
ref|XP_002310279.2|  beta-galactosidase family protein                  219   8e-63   
ref|XP_004149980.1|  PREDICTED: beta-galactosidase 3-like               219   8e-63   Cucumis sativus [cucumbers]
ref|XP_011025878.1|  PREDICTED: beta-galactosidase 3                    219   9e-63   Populus euphratica
ref|XP_008241765.1|  PREDICTED: beta-galactosidase 3                    219   9e-63   Prunus mume [ume]
ref|XP_008440778.1|  PREDICTED: beta-galactosidase 3                    219   9e-63   Cucumis melo [Oriental melon]
gb|KDO71053.1|  hypothetical protein CISIN_1g003044mg                   219   1e-62   Citrus sinensis [apfelsine]
gb|KDO71052.1|  hypothetical protein CISIN_1g003044mg                   219   1e-62   Citrus sinensis [apfelsine]
ref|XP_002263382.2|  PREDICTED: beta-galactosidase 3                    219   1e-62   Vitis vinifera
ref|XP_004158882.1|  PREDICTED: beta-galactosidase 3-like               218   3e-62   
gb|KJB17716.1|  hypothetical protein B456_003G011900                    218   3e-62   Gossypium raimondii
ref|XP_006425593.1|  hypothetical protein CICLE_v10024881mg             218   4e-62   Citrus clementina [clementine]
gb|KJB58183.1|  hypothetical protein B456_009G198100                    214   5e-62   Gossypium raimondii
ref|XP_010029731.1|  PREDICTED: beta-galactosidase 3                    218   5e-62   Eucalyptus grandis [rose gum]
ref|XP_007160714.1|  hypothetical protein PHAVU_001G010900g             216   7e-62   Phaseolus vulgaris [French bean]
ref|XP_010254673.1|  PREDICTED: beta-galactosidase 3-like               216   2e-61   Nelumbo nucifera [Indian lotus]
ref|NP_849506.1|  beta-galactosidase 3                                  216   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568001.1|  beta-galactosidase 3                                  216   2e-61   Arabidopsis thaliana [mouse-ear cress]
emb|CAA18137.1|  beta-galactosidase like protein                        216   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001268162.1|  beta-galactosidase BG1-like precursor              215   3e-61   Vitis vinifera
emb|CBI19767.3|  unnamed protein product                                215   3e-61   Vitis vinifera
emb|CAN78072.1|  hypothetical protein VITISV_013292                     215   3e-61   Vitis vinifera
ref|XP_010275526.1|  PREDICTED: beta-galactosidase 3-like               215   3e-61   Nelumbo nucifera [Indian lotus]
ref|XP_003538867.1|  PREDICTED: beta-galactosidase 3-like               214   6e-61   Glycine max [soybeans]
gb|KHN41933.1|  Beta-galactosidase 3                                    214   6e-61   Glycine soja [wild soybean]
gb|KJB58182.1|  hypothetical protein B456_009G198100                    213   6e-61   Gossypium raimondii
ref|XP_002510455.1|  beta-galactosidase, putative                       214   7e-61   Ricinus communis
gb|KHG23756.1|  Beta-galactosidase 5 -like protein                      213   8e-61   Gossypium arboreum [tree cotton]
ref|XP_011037170.1|  PREDICTED: beta-galactosidase 5-like               213   1e-60   Populus euphratica
emb|CDP01954.1|  unnamed protein product                                213   2e-60   Coffea canephora [robusta coffee]
emb|CDO97013.1|  unnamed protein product                                212   2e-60   Coffea canephora [robusta coffee]
ref|XP_006283100.1|  hypothetical protein CARUB_v10004117mg             213   2e-60   
dbj|BAD91082.1|  beta-D-galactosidase                                   213   2e-60   Pyrus pyrifolia [sha li]
ref|XP_007042084.1|  Beta-galactosidase 3 isoform 2                     210   2e-60   
gb|KHN36067.1|  Beta-galactosidase 3                                    213   2e-60   Glycine soja [wild soybean]
emb|CAB16852.1|  beta-galactosidase like protein                        213   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003517202.1|  PREDICTED: beta-galactosidase 3-like               213   3e-60   
ref|XP_002305449.1|  beta-galactosidase family protein                  212   3e-60   Populus trichocarpa [western balsam poplar]
ref|XP_006283101.1|  hypothetical protein CARUB_v10004117mg             213   3e-60   Capsella rubella
ref|XP_003520277.1|  PREDICTED: beta-galactosidase 3-like               212   3e-60   Glycine max [soybeans]
ref|XP_010679814.1|  PREDICTED: beta-galactosidase 3                    212   3e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011083163.1|  PREDICTED: beta-galactosidase 3                    212   3e-60   Sesamum indicum [beniseed]
gb|KDP38567.1|  hypothetical protein JCGZ_04492                         212   3e-60   Jatropha curcas
ref|XP_010437358.1|  PREDICTED: beta-galactosidase 3-like               212   3e-60   Camelina sativa [gold-of-pleasure]
gb|KHN27041.1|  Beta-galactosidase 3                                    212   4e-60   Glycine soja [wild soybean]
ref|XP_010446807.1|  PREDICTED: beta-galactosidase 3                    212   4e-60   Camelina sativa [gold-of-pleasure]
gb|KDO49473.1|  hypothetical protein CISIN_1g0051602mg                  205   5e-60   Citrus sinensis [apfelsine]
ref|XP_003548865.1|  PREDICTED: beta-galactosidase 3-like               212   5e-60   Glycine max [soybeans]
ref|XP_010432182.1|  PREDICTED: beta-galactosidase 3-like               212   5e-60   Camelina sativa [gold-of-pleasure]
ref|XP_002306893.1|  beta-galactosidase family protein                  212   5e-60   Populus trichocarpa [western balsam poplar]
ref|XP_008338023.1|  PREDICTED: beta-galactosidase 3-like               211   6e-60   
ref|XP_009761050.1|  PREDICTED: beta-galactosidase 5                    211   7e-60   Nicotiana sylvestris
gb|AAF67342.1|  beta galactosidase                                      211   8e-60   Vigna radiata [mung bean]
gb|KHN12675.1|  Beta-galactosidase 5                                    210   8e-60   Glycine soja [wild soybean]
ref|XP_009145073.1|  PREDICTED: beta-galactosidase 3                    211   9e-60   Brassica rapa
ref|XP_007199661.1|  hypothetical protein PRUPE_ppa001363mg             211   1e-59   Prunus persica
ref|XP_007042083.1|  Beta-galactosidase 3 isoform 1                     210   1e-59   Theobroma cacao [chocolate]
ref|XP_004509327.1|  PREDICTED: beta-galactosidase 3-like               211   1e-59   
ref|XP_008337843.1|  PREDICTED: beta-galactosidase 3                    211   1e-59   
ref|XP_008236954.1|  PREDICTED: beta-galactosidase 3-like               211   1e-59   Prunus mume [ume]
emb|CDX75569.1|  BnaA01g01330D                                          211   1e-59   
ref|XP_007156097.1|  hypothetical protein PHAVU_003G258300g             211   1e-59   Phaseolus vulgaris [French bean]
ref|XP_009603021.1|  PREDICTED: beta-galactosidase 5                    209   1e-59   Nicotiana tomentosiformis
ref|XP_004512085.1|  PREDICTED: beta-galactosidase 3-like               210   3e-59   Cicer arietinum [garbanzo]
gb|KHN00504.1|  Beta-galactosidase 3                                    210   3e-59   Glycine soja [wild soybean]
gb|KJB63588.1|  hypothetical protein B456_010G007300                    206   3e-59   Gossypium raimondii
ref|XP_009107461.1|  PREDICTED: beta-galactosidase 5-like isoform X1    208   4e-59   
ref|XP_010552493.1|  PREDICTED: beta-galactosidase 5                    208   4e-59   Tarenaya hassleriana [spider flower]
emb|CDX69219.1|  BnaC01g02340D                                          209   4e-59   
gb|KDO84692.1|  hypothetical protein CISIN_1g003076mg                   207   4e-59   Citrus sinensis [apfelsine]
ref|XP_006412010.1|  hypothetical protein EUTSA_v10024387mg             207   5e-59   
dbj|BAF31234.1|  beta-D-galactosidase                                   209   5e-59   Persea americana
ref|XP_010315322.1|  PREDICTED: beta-galactosidase 3-like               208   7e-59   Solanum lycopersicum
ref|XP_003589339.1|  Beta-galactosidase                                 207   8e-59   Medicago truncatula
ref|NP_001265904.1|  beta-galactosidase 5-like precursor                207   9e-59   Cicer arietinum [garbanzo]
ref|XP_002867020.1|  hypothetical protein ARALYDRAFT_491000             208   1e-58   
gb|KJB63586.1|  hypothetical protein B456_010G007300                    204   1e-58   Gossypium raimondii
ref|XP_006342225.1|  PREDICTED: beta-galactosidase 3-like               207   1e-58   
ref|XP_011048837.1|  PREDICTED: beta-galactosidase 5                    208   1e-58   Populus euphratica
gb|KHN20946.1|  Beta-galactosidase 5                                    207   1e-58   Glycine soja [wild soybean]
ref|XP_011083609.1|  PREDICTED: beta-galactosidase 3-like               207   2e-58   Sesamum indicum [beniseed]
gb|KCW64027.1|  hypothetical protein EUGRSUZ_G01704                     204   2e-58   Eucalyptus grandis [rose gum]
gb|KJB32548.1|  hypothetical protein B456_005G246600                    204   2e-58   Gossypium raimondii
dbj|BAD91085.1|  beta-D-galactosidase                                   207   2e-58   Pyrus pyrifolia [sha li]
ref|XP_010531064.1|  PREDICTED: beta-galactosidase 3                    207   2e-58   Tarenaya hassleriana [spider flower]
ref|XP_006362025.1|  PREDICTED: beta-galactosidase 3-like               206   2e-58   Solanum tuberosum [potatoes]
ref|XP_009614464.1|  PREDICTED: beta-galactosidase 3-like               206   2e-58   Nicotiana tomentosiformis
dbj|BAJ34544.1|  unnamed protein product                                207   2e-58   Eutrema halophilum
ref|XP_006412011.1|  hypothetical protein EUTSA_v10024387mg             207   2e-58   Eutrema salsugineum [saltwater cress]
gb|KDO84689.1|  hypothetical protein CISIN_1g003076mg                   207   3e-58   Citrus sinensis [apfelsine]
gb|KDO84691.1|  hypothetical protein CISIN_1g003076mg                   206   3e-58   Citrus sinensis [apfelsine]
gb|KDO84690.1|  hypothetical protein CISIN_1g003076mg                   207   3e-58   Citrus sinensis [apfelsine]
gb|KDO84688.1|  hypothetical protein CISIN_1g003076mg                   207   3e-58   Citrus sinensis [apfelsine]
ref|XP_006473573.1|  PREDICTED: beta-galactosidase 3-like               207   3e-58   Citrus sinensis [apfelsine]
gb|KFK30264.1|  hypothetical protein AALP_AA7G238600                    207   3e-58   Arabis alpina [alpine rockcress]
ref|XP_006435076.1|  hypothetical protein CICLE_v10000260mg             206   3e-58   Citrus clementina [clementine]
gb|KJB63587.1|  hypothetical protein B456_010G007300                    206   3e-58   Gossypium raimondii
ref|XP_010110010.1|  Beta-galactosidase 3                               206   4e-58   
gb|KJB63585.1|  hypothetical protein B456_010G007300                    206   4e-58   Gossypium raimondii
ref|XP_004238611.1|  PREDICTED: beta-galactosidase 5                    206   4e-58   Solanum lycopersicum
ref|XP_006487343.1|  PREDICTED: beta-galactosidase 3-like               206   4e-58   Citrus sinensis [apfelsine]
ref|XP_009777047.1|  PREDICTED: beta-galactosidase 3-like               206   4e-58   Nicotiana sylvestris
ref|XP_006393673.1|  hypothetical protein EUTSA_v10011265mg             206   4e-58   Eutrema salsugineum [saltwater cress]
ref|XP_009129554.1|  PREDICTED: beta-galactosidase 5                    206   5e-58   Brassica rapa
ref|XP_006423393.1|  hypothetical protein CICLE_v10030257mg             205   6e-58   
gb|KHG11061.1|  Beta-galactosidase 5 -like protein                      205   7e-58   Gossypium arboreum [tree cotton]
ref|XP_010066194.1|  PREDICTED: beta-galactosidase 5-like isoform X3    204   1e-57   
gb|AGR44466.1|  beta-D-galactosidase 7                                  205   1e-57   Pyrus x bretschneideri [bai li]
gb|KJB32549.1|  hypothetical protein B456_005G246600                    204   1e-57   Gossypium raimondii
ref|XP_008377189.1|  PREDICTED: beta-galactosidase 5-like               205   2e-57   
ref|XP_008221339.1|  PREDICTED: beta-galactosidase 5                    204   2e-57   Prunus mume [ume]
dbj|BAD91084.1|  beta-D-galactosidase                                   204   2e-57   Pyrus pyrifolia [sha li]
gb|KJB32547.1|  hypothetical protein B456_005G246600                    204   2e-57   Gossypium raimondii
emb|CDY47949.1|  BnaA10g28210D                                          204   2e-57   Brassica napus [oilseed rape]
emb|CDY53959.1|  BnaCnng25850D                                          204   2e-57   Brassica napus [oilseed rape]
emb|CDP11590.1|  unnamed protein product                                191   2e-57   Coffea canephora [robusta coffee]
ref|XP_010066193.1|  PREDICTED: beta-galactosidase 5-like isoform X2    203   3e-57   Eucalyptus grandis [rose gum]
gb|KHG20820.1|  Beta-galactosidase 3                                    202   3e-57   Gossypium arboreum [tree cotton]
ref|XP_010066191.1|  PREDICTED: beta-galactosidase 5-like isoform X1    203   3e-57   Eucalyptus grandis [rose gum]
ref|XP_003612092.1|  Beta-galactosidase                                 204   3e-57   Medicago truncatula
ref|XP_002891311.1|  hypothetical protein ARALYDRAFT_473836             203   3e-57   
emb|CDY36028.1|  BnaA08g04330D                                          203   3e-57   Brassica napus [oilseed rape]
ref|XP_007225291.1|  hypothetical protein PRUPE_ppa001334mg             204   3e-57   Prunus persica
emb|CAB64741.1|  putative beta-galactosidase                            203   4e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175127.1|  beta-galactosidase 5                                  203   4e-57   Arabidopsis thaliana [mouse-ear cress]
gb|AAL24206.1|  At1g45130/F27F5_20                                      203   5e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CDY59693.1|  BnaC07g51120D                                          203   5e-57   Brassica napus [oilseed rape]
ref|XP_008799994.1|  PREDICTED: beta-galactosidase 5-like               203   5e-57   Phoenix dactylifera
ref|XP_004146490.1|  PREDICTED: beta-galactosidase 3-like               203   7e-57   Cucumis sativus [cucumbers]
gb|KFK36177.1|  hypothetical protein AALP_AA4G088200                    202   7e-57   Arabis alpina [alpine rockcress]
ref|XP_008382310.1|  PREDICTED: beta-galactosidase 5-like               203   7e-57   
ref|XP_002512959.1|  beta-galactosidase, putative                       202   8e-57   Ricinus communis
ref|XP_006306871.1|  hypothetical protein CARUB_v10008424mg             202   8e-57   Capsella rubella
ref|XP_011092826.1|  PREDICTED: beta-galactosidase 3                    202   1e-56   Sesamum indicum [beniseed]
ref|XP_010061261.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    201   2e-56   Eucalyptus grandis [rose gum]
ref|XP_003523710.1|  PREDICTED: beta-galactosidase 3-like isoform 1     201   2e-56   Glycine max [soybeans]
gb|KHN45883.1|  Beta-galactosidase 5                                    201   2e-56   Glycine soja [wild soybean]
ref|XP_010917686.1|  PREDICTED: beta-galactosidase 5-like               201   2e-56   Elaeis guineensis
emb|CDP07463.1|  unnamed protein product                                201   2e-56   Coffea canephora [robusta coffee]
ref|XP_010049745.1|  PREDICTED: beta-galactosidase-like                 200   4e-56   Eucalyptus grandis [rose gum]
ref|NP_001049068.1|  Os03g0165400                                       201   4e-56   
gb|EEE58382.1|  hypothetical protein OsJ_09539                          201   4e-56   Oryza sativa Japonica Group [Japonica rice]
gb|AAM22973.1|AF499737_1  beta-galactosidase                            201   4e-56   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74580.1|  hypothetical protein OsI_10152                          201   4e-56   Oryza sativa Indica Group [Indian rice]
gb|ABF94150.1|  Beta-galactosidase precursor, putative, expressed       201   4e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004291830.1|  PREDICTED: beta-galactosidase 5                    200   5e-56   Fragaria vesca subsp. vesca
gb|KGN59998.1|  hypothetical protein Csa_3G865330                       200   5e-56   Cucumis sativus [cucumbers]
ref|XP_008466519.1|  PREDICTED: beta-galactosidase 5-like               200   6e-56   Cucumis melo [Oriental melon]
ref|XP_008452119.1|  PREDICTED: beta-galactosidase 3-like               200   6e-56   Cucumis melo [Oriental melon]
ref|XP_009396354.1|  PREDICTED: beta-galactosidase 5-like               200   7e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008388000.1|  PREDICTED: beta-galactosidase 5                    200   7e-56   
ref|XP_003558743.1|  PREDICTED: beta-galactosidase 5                    200   8e-56   Brachypodium distachyon [annual false brome]
ref|XP_004147848.1|  PREDICTED: beta-galactosidase 3-like               199   1e-55   Cucumis sativus [cucumbers]
ref|XP_008809207.1|  PREDICTED: beta-galactosidase 5-like               199   1e-55   Phoenix dactylifera
ref|XP_007136038.1|  hypothetical protein PHAVU_009G012700g             199   1e-55   Phaseolus vulgaris [French bean]
gb|ABR16628.1|  unknown                                                 199   1e-55   Picea sitchensis
gb|EMT10014.1|  Beta-galactosidase 5                                    199   2e-55   
dbj|BAJ96054.1|  predicted protein                                      199   2e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK07157.1|  predicted protein                                      198   2e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH36209.1|  beta-galactosidase-like protein                         198   3e-55   Medicago truncatula
ref|XP_011457728.1|  PREDICTED: beta-galactosidase 3-like               198   3e-55   Fragaria vesca subsp. vesca
ref|XP_010932916.1|  PREDICTED: beta-galactosidase 5-like               198   4e-55   Elaeis guineensis
ref|XP_006649450.1|  PREDICTED: beta-galactosidase 5-like               197   1e-54   Oryza brachyantha
gb|EYU32887.1|  hypothetical protein MIMGU_mgv1a001295mg                197   1e-54   Erythranthe guttata [common monkey flower]
ref|XP_008660537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    196   1e-54   Zea mays [maize]
ref|XP_010049746.1|  PREDICTED: beta-galactosidase-like                 196   1e-54   Eucalyptus grandis [rose gum]
gb|KJB65165.1|  hypothetical protein B456_010G082900                    194   2e-54   Gossypium raimondii
gb|EYU45189.1|  hypothetical protein MIMGU_mgv1a003101mg                194   3e-54   Erythranthe guttata [common monkey flower]
ref|XP_009335672.1|  PREDICTED: beta-galactosidase 5                    196   3e-54   Pyrus x bretschneideri [bai li]
ref|XP_004174126.1|  PREDICTED: beta-galactosidase-like                 182   3e-54   
ref|XP_004500970.1|  PREDICTED: beta-galactosidase 5-like isoform X2    194   3e-54   
ref|XP_010107841.1|  Beta-galactosidase 3                               195   4e-54   Morus notabilis
ref|XP_009395554.1|  PREDICTED: beta-galactosidase 5                    195   5e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006838689.1|  hypothetical protein AMTR_s00002p00246870          195   5e-54   Amborella trichopoda
ref|XP_010545349.1|  PREDICTED: beta-galactosidase 12-like isofor...    192   7e-54   Tarenaya hassleriana [spider flower]
gb|KJB65166.1|  hypothetical protein B456_010G082900                    194   7e-54   Gossypium raimondii
emb|CDX76255.1|  BnaA04g05190D                                          180   1e-53   
ref|NP_194344.2|  beta-galactosidase 12                                 192   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006353531.1|  PREDICTED: beta-galactosidase-like                 193   1e-53   Solanum tuberosum [potatoes]
ref|XP_004500969.1|  PREDICTED: beta-galactosidase 5-like isoform X1    193   1e-53   Cicer arietinum [garbanzo]
gb|EYU42595.1|  hypothetical protein MIMGU_mgv1a001990mg                193   1e-53   Erythranthe guttata [common monkey flower]
ref|XP_010242207.1|  PREDICTED: beta-galactosidase                      194   1e-53   Nelumbo nucifera [Indian lotus]
gb|KCW82506.1|  hypothetical protein EUGRSUZ_C03898                     193   1e-53   Eucalyptus grandis [rose gum]
ref|XP_010049744.1|  PREDICTED: beta-galactosidase-like                 193   1e-53   
gb|KJB65169.1|  hypothetical protein B456_010G082900                    193   2e-53   Gossypium raimondii
emb|CDX88594.1|  BnaA03g10550D                                          186   2e-53   
gb|KHN32687.1|  Beta-galactosidase 1                                    193   2e-53   Glycine soja [wild soybean]
gb|KJB65167.1|  hypothetical protein B456_010G082900                    193   2e-53   Gossypium raimondii
gb|KGN59822.1|  hypothetical protein Csa_3G848310                       192   2e-53   Cucumis sativus [cucumbers]
ref|XP_003546676.1|  PREDICTED: beta-galactosidase 1-like               193   2e-53   Glycine max [soybeans]
gb|KJB65170.1|  hypothetical protein B456_010G082900                    193   2e-53   Gossypium raimondii
ref|XP_010041868.1|  PREDICTED: beta-galactosidase 12-like              179   2e-53   
ref|XP_011077976.1|  PREDICTED: beta-galactosidase-like                 192   2e-53   Sesamum indicum [beniseed]
ref|NP_849553.1|  beta-galactosidase 12                                 192   3e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CAB39679.1|  putative beta-galactosidase                            192   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008805774.1|  PREDICTED: beta-galactosidase-like isoform X2      192   3e-53   Phoenix dactylifera
ref|XP_008447606.1|  PREDICTED: beta-galactosidase 1                    192   3e-53   Cucumis melo [Oriental melon]
ref|XP_004146823.1|  PREDICTED: beta-galactosidase 1-like               192   3e-53   Cucumis sativus [cucumbers]
gb|KCW69753.1|  hypothetical protein EUGRSUZ_F031302                    189   3e-53   Eucalyptus grandis [rose gum]
ref|XP_008805772.1|  PREDICTED: beta-galactosidase-like isoform X1      192   3e-53   Phoenix dactylifera
ref|XP_010545348.1|  PREDICTED: beta-galactosidase 12-like isofor...    192   3e-53   Tarenaya hassleriana [spider flower]
ref|XP_007138730.1|  hypothetical protein PHAVU_009G232500g             192   4e-53   Phaseolus vulgaris [French bean]
ref|XP_009418405.1|  PREDICTED: beta-galactosidase 5-like isoform X2    192   4e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003531618.1|  PREDICTED: beta-galactosidase 1-like               192   4e-53   Glycine max [soybeans]
ref|XP_003543598.1|  PREDICTED: beta-galactosidase 1-like               192   4e-53   Glycine max [soybeans]
ref|XP_010438795.1|  PREDICTED: beta-galactosidase 12 isoform X1        191   4e-53   Camelina sativa [gold-of-pleasure]
ref|XP_009418404.1|  PREDICTED: beta-galactosidase 5-like isoform X1    192   4e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010438797.1|  PREDICTED: beta-galactosidase 12 isoform X2        191   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010448320.1|  PREDICTED: beta-galactosidase 12-like isofor...    191   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010448319.1|  PREDICTED: beta-galactosidase 12-like isofor...    191   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010051543.1|  PREDICTED: beta-galactosidase                      192   5e-53   
ref|NP_001266133.1|  beta-galactosidase-like                            191   5e-53   Cicer arietinum [garbanzo]
gb|KCW69752.1|  hypothetical protein EUGRSUZ_F031302                    189   6e-53   Eucalyptus grandis [rose gum]
ref|XP_008450853.1|  PREDICTED: beta-galactosidase-like                 191   6e-53   Cucumis melo [Oriental melon]
ref|XP_004985588.1|  PREDICTED: beta-galactosidase 5-like isoform X1    191   8e-53   Setaria italica
ref|XP_002308268.2|  hypothetical protein POPTR_0006s14680g             191   8e-53   Populus trichocarpa [western balsam poplar]
gb|KJB07253.1|  hypothetical protein B456_001G011600                    190   9e-53   Gossypium raimondii
ref|XP_011045966.1|  PREDICTED: beta-galactosidase-like isoform X2      191   9e-53   Populus euphratica
ref|XP_009137581.1|  PREDICTED: beta-galactosidase 12-like              191   9e-53   Brassica rapa
ref|XP_010536861.1|  PREDICTED: beta-galactosidase 12                   191   9e-53   Tarenaya hassleriana [spider flower]
gb|AHL69742.1|  beta-galactosidase                                      191   1e-52   Hylocereus undatus [dragon fruit]
gb|AAF67341.1|  beta galactosidase                                      191   1e-52   Vigna radiata [mung bean]
gb|KDO57768.1|  hypothetical protein CISIN_1g004219mg                   189   1e-52   Citrus sinensis [apfelsine]
gb|KDO57767.1|  hypothetical protein CISIN_1g004219mg                   189   1e-52   Citrus sinensis [apfelsine]
gb|KDO57766.1|  hypothetical protein CISIN_1g004219mg                   190   1e-52   Citrus sinensis [apfelsine]
gb|KJB07254.1|  hypothetical protein B456_001G011600                    190   1e-52   Gossypium raimondii
ref|XP_009762312.1|  PREDICTED: beta-galactosidase-like                 190   1e-52   Nicotiana sylvestris
dbj|BAF31233.1|  beta-D-galactosidase                                   191   1e-52   Persea americana
gb|KJB07252.1|  hypothetical protein B456_001G011600                    190   1e-52   Gossypium raimondii
gb|AAC25984.1|  beta-galactosidase                                      190   2e-52   Solanum lycopersicum
ref|XP_004135820.1|  PREDICTED: beta-galactosidase-like                 187   2e-52   
gb|KCW82245.1|  hypothetical protein EUGRSUZ_C03662                     190   2e-52   Eucalyptus grandis [rose gum]
gb|ADO34789.1|  beta-galactosidase STBG4                                190   2e-52   Solanum lycopersicum
dbj|BAC10578.2|  beta-galactosidase                                     190   2e-52   Capsicum annuum
gb|AAK40304.1|  beta-galactosidase                                      190   2e-52   Capsicum annuum
gb|KCW53602.1|  hypothetical protein EUGRSUZ_J02867                     189   2e-52   Eucalyptus grandis [rose gum]
gb|ACC78255.1|  beta-galactosidase                                      189   2e-52   Carica papaya [mamon]
gb|KDO57765.1|  hypothetical protein CISIN_1g004219mg                   189   2e-52   Citrus sinensis [apfelsine]
ref|XP_010262132.1|  PREDICTED: beta-galactosidase isoform X2           190   2e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010262131.1|  PREDICTED: beta-galactosidase isoform X1           190   2e-52   Nelumbo nucifera [Indian lotus]
ref|XP_004158444.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    189   2e-52   
ref|XP_006413222.1|  hypothetical protein EUTSA_v10024511mg             189   3e-52   Eutrema salsugineum [saltwater cress]
gb|KJB18554.1|  hypothetical protein B456_003G0595001                   176   3e-52   Gossypium raimondii
gb|KDP40776.1|  hypothetical protein JCGZ_24775                         187   3e-52   Jatropha curcas
gb|KGN66238.1|  hypothetical protein Csa_1G587980                       189   3e-52   Cucumis sativus [cucumbers]
gb|KHN30042.1|  Beta-galactosidase 1                                    190   3e-52   Glycine soja [wild soybean]
pdb|3W5F|A  Chain A, Crystal Structure Of Tomato Beta-galactosida...    189   3e-52   Solanum lycopersicum
ref|XP_007017651.1|  Beta-galactosidase 5 isoform 1                     189   3e-52   
ref|XP_008643999.1|  PREDICTED: uncharacterized protein LOC100382...    190   3e-52   Zea mays [maize]
dbj|BAB83260.1|  beta-D-galactosidase                                   189   3e-52   Persea americana
ref|XP_009599425.1|  PREDICTED: beta-galactosidase-like                 189   3e-52   Nicotiana tomentosiformis
gb|KDP33829.1|  hypothetical protein JCGZ_07400                         190   3e-52   Jatropha curcas
gb|KCW53601.1|  hypothetical protein EUGRSUZ_J02867                     189   3e-52   Eucalyptus grandis [rose gum]
ref|XP_002465807.1|  hypothetical protein SORBIDRAFT_01g046160          189   4e-52   
gb|KJB56892.1|  hypothetical protein B456_009G140800                    189   4e-52   
ref|XP_009407297.1|  PREDICTED: beta-galactosidase 2                    189   4e-52   
gb|KDO57764.1|  hypothetical protein CISIN_1g004219mg                   189   4e-52   
gb|KEH18344.1|  beta-galactosidase                                      189   5e-52   
gb|KDO57763.1|  hypothetical protein CISIN_1g004219mg                   189   5e-52   
ref|XP_009768469.1|  PREDICTED: beta-galactosidase-like                 189   5e-52   
gb|KDO57762.1|  hypothetical protein CISIN_1g004219mg                   189   5e-52   
ref|XP_002867577.1|  beta-galactosidase 12                              189   5e-52   
ref|XP_010106660.1|  Beta-galactosidase 1                               189   6e-52   
ref|XP_010062625.1|  PREDICTED: beta-galactosidase 1                    189   6e-52   
ref|XP_007024475.1|  Beta galactosidase 1                               189   6e-52   
ref|XP_006451459.1|  hypothetical protein CICLE_v10007531mg             188   6e-52   
gb|KFK27244.1|  hypothetical protein AALP_AA8G356800                    188   7e-52   
ref|NP_001275845.1|  beta-galactosidase                                 188   7e-52   
ref|XP_010033786.1|  PREDICTED: beta-galactosidase 1-like               189   7e-52   
ref|XP_007012844.1|  Beta-galactosidase                                 189   7e-52   
ref|XP_006451461.1|  hypothetical protein CICLE_v10007531mg             188   8e-52   
ref|XP_006451460.1|  hypothetical protein CICLE_v10007531mg             188   8e-52   
gb|KEH39519.1|  beta-galactosidase                                      187   9e-52   
ref|XP_010433544.1|  PREDICTED: beta-galactosidase 12-like isofor...    188   1e-51   
ref|XP_010433545.1|  PREDICTED: beta-galactosidase 12-like isofor...    187   1e-51   
ref|XP_009402923.1|  PREDICTED: beta-galactosidase-like                 187   1e-51   
ref|XP_007217146.1|  hypothetical protein PRUPE_ppa001382mg             188   1e-51   
gb|ABV32545.1|  beta-galactosidase protein 2                            188   1e-51   
gb|AIU34464.1|  putative beta-galactosidase 1 precursor                 184   1e-51   
gb|AAN60229.1|  unknown                                                 186   1e-51   
ref|XP_002514108.1|  beta-galactosidase, putative                       188   1e-51   
ref|XP_009148743.1|  PREDICTED: beta-galactosidase 2 isoform X1         187   1e-51   
gb|AAC77377.1|  beta-galactosidase precursor                            187   1e-51   
ref|NP_001234842.1|  ss-galactosidase precursor                         187   1e-51   
gb|ADV41669.1|  beta-D-galactosidase                                    187   1e-51   
gb|KGN66239.1|  hypothetical protein Csa_1G587990                       186   2e-51   
gb|EPS69033.1|  beta-galactosidase                                      187   2e-51   
ref|XP_011080179.1|  PREDICTED: beta-galactosidase-like                 187   2e-51   
ref|XP_003550633.1|  PREDICTED: beta-galactosidase-like                 187   2e-51   
ref|XP_008450854.1|  PREDICTED: beta-galactosidase-like                 187   2e-51   
ref|XP_010911412.1|  PREDICTED: beta-galactosidase-like                 185   3e-51   
ref|XP_010418820.1|  PREDICTED: beta-galactosidase 8-like               177   3e-51   
emb|CDY32919.1|  BnaC02g12030D                                          186   3e-51   
gb|KHG01120.1|  Beta-galactosidase                                      187   3e-51   
ref|XP_009126921.1|  PREDICTED: beta-galactosidase 4-like               186   3e-51   
emb|CDY20708.1|  BnaA02g08480D                                          186   3e-51   
ref|XP_002864484.1|  predicted protein                                  186   3e-51   
ref|XP_011072510.1|  PREDICTED: beta-galactosidase-like                 187   3e-51   
gb|ACP18874.1|  beta-galactosidase pBG(b)                               184   3e-51   
ref|XP_008228300.1|  PREDICTED: beta-galactosidase 1                    187   3e-51   
ref|XP_002882842.1|  hypothetical protein ARALYDRAFT_897617             187   3e-51   
ref|XP_009132166.1|  PREDICTED: beta-galactosidase 4                    186   3e-51   
emb|CDX94367.1|  BnaC01g18170D                                          186   3e-51   
ref|XP_006285652.1|  hypothetical protein CARUB_v10007108mg             186   3e-51   
emb|CDY11899.1|  BnaC03g13250D                                          186   4e-51   
gb|KJB70253.1|  hypothetical protein B456_011G065300                    186   4e-51   
ref|XP_007154660.1|  hypothetical protein PHAVU_003G137000g             186   4e-51   
ref|XP_007150529.1|  hypothetical protein PHAVU_005G160000g             186   5e-51   
ref|XP_004150073.1|  PREDICTED: beta-galactosidase 3-like               186   5e-51   
emb|CAB86888.1|  beta-galactosidase precursor-like protein              186   5e-51   
emb|CDX95380.1|  BnaC04g27780D                                          186   5e-51   
ref|NP_190852.2|  beta-galactosidase 2                                  186   6e-51   
emb|CDX89360.1|  BnaA01g15330D                                          185   6e-51   
gb|KDO73223.1|  hypothetical protein CISIN_1g003095mg                   183   6e-51   
gb|ACJ86256.1|  unknown                                                 177   6e-51   
ref|XP_003566806.1|  PREDICTED: beta-galactosidase 2                    186   7e-51   
sp|P45582.1|BGAL_ASPOF  RecName: Full=Beta-galactosidase; Short=L...    186   7e-51   
ref|XP_009388558.1|  PREDICTED: beta-galactosidase-like                 185   7e-51   
ref|XP_010915229.1|  PREDICTED: beta-galactosidase isoform X2           186   8e-51   
ref|XP_009367552.1|  PREDICTED: beta-galactosidase 1                    186   8e-51   
ref|XP_010915228.1|  PREDICTED: beta-galactosidase isoform X1           186   8e-51   
ref|NP_200498.1|  beta-galactosidase 4                                  185   8e-51   
ref|XP_006401275.1|  hypothetical protein EUTSA_v10012847mg             185   8e-51   
ref|XP_004135712.1|  PREDICTED: beta-galactosidase-like                 185   8e-51   
gb|AAK96780.1|  beta-galactosidase                                      185   8e-51   
gb|ACJ86220.1|  unknown                                                 175   8e-51   
ref|XP_006300095.1|  hypothetical protein CARUB_v10016323mg             186   8e-51   
ref|XP_003597608.1|  Beta-galactosidase                                 186   9e-51   
ref|XP_004144120.1|  PREDICTED: beta-galactosidase-like                 185   9e-51   
ref|XP_009408846.1|  PREDICTED: beta-galactosidase-like                 185   9e-51   
ref|XP_011093727.1|  PREDICTED: beta-galactosidase-like                 185   9e-51   
ref|XP_009757670.1|  PREDICTED: beta-galactosidase-like isoform X1      186   9e-51   
ref|XP_008451151.1|  PREDICTED: beta-galactosidase-like                 184   9e-51   
ref|XP_009409593.1|  PREDICTED: beta-galactosidase-like                 185   9e-51   
ref|XP_003595163.1|  Beta-galactosidase                                 184   9e-51   
gb|KHG25378.1|  Beta-galactosidase 1 -like protein                      186   1e-50   
ref|XP_009757671.1|  PREDICTED: beta-galactosidase-like isoform X2      186   1e-50   
ref|XP_004486826.1|  PREDICTED: beta-galactosidase 1-like               186   1e-50   
gb|KJB70252.1|  hypothetical protein B456_011G065300                    186   1e-50   
gb|KJB70251.1|  hypothetical protein B456_011G065300                    186   1e-50   
emb|CAA09467.1|  exo galactanase                                        185   1e-50   
gb|AAB61470.1|  beta-D-galactosidase                                    184   1e-50   
gb|KHF98342.1|  Beta-galactosidase 1 -like protein                      186   1e-50   
ref|XP_009409595.1|  PREDICTED: beta-galactosidase-like                 185   1e-50   
ref|XP_008450855.1|  PREDICTED: beta-galactosidase-like                 185   1e-50   
gb|KHN39301.1|  Beta-galactosidase 1                                    185   1e-50   
ref|XP_003529875.1|  PREDICTED: beta-galactosidase 1-like               186   1e-50   
gb|AHG94613.1|  beta-galactosidase                                      185   1e-50   
ref|XP_010090042.1|  Beta-galactosidase 1                               185   1e-50   
ref|XP_009352652.1|  PREDICTED: beta-galactosidase                      184   1e-50   
gb|KEH37473.1|  beta-like galactosidase                                 184   1e-50   
ref|XP_010654522.1|  PREDICTED: beta-galactosidase 1                    185   1e-50   
dbj|BAB21492.1|  beta-D-galactosidase                                   184   1e-50   
gb|AES65414.2|  beta-like galactosidase                                 184   1e-50   
ref|XP_009133878.1|  PREDICTED: beta-galactosidase 8-like               185   1e-50   
dbj|BAE72073.1|  pear beta-galactosidase1                               184   1e-50   
ref|XP_002876169.1|  AT3g52840/F8J2_10                                  184   1e-50   
sp|P48981.1|BGAL_MALDO  RecName: Full=Beta-galactosidase; AltName...    184   1e-50   
emb|CBI35944.3|  unnamed protein product                                185   2e-50   
ref|XP_006385360.1|  beta-galactosidase 1 family protein                185   2e-50   
gb|ABK96254.1|  unknown                                                 185   2e-50   
gb|KDO73222.1|  hypothetical protein CISIN_1g003095mg                   184   2e-50   
emb|CAC44500.1|  beta-galactosidase                                     185   2e-50   
ref|XP_011463326.1|  PREDICTED: beta-galactosidase 1                    185   2e-50   
gb|EPS63795.1|  beta-galactosidase                                      171   2e-50   
ref|XP_002282132.1|  PREDICTED: beta-galactosidase                      185   2e-50   
ref|XP_009117469.1|  PREDICTED: beta-galactosidase 1-like               185   2e-50   
emb|CBI27912.3|  unnamed protein product                                185   2e-50   
emb|CDY51738.1|  BnaA01g37210D                                          185   2e-50   
ref|XP_003595162.1|  Beta-galactosidase                                 184   2e-50   
ref|NP_001266102.1|  beta-galactosidase 1-like precursor                185   2e-50   
gb|EYU28411.1|  hypothetical protein MIMGU_mgv1a024117mg                184   2e-50   
emb|CAH18936.1|  beta-galactosidase                                     184   2e-50   
ref|XP_006587007.1|  PREDICTED: beta-galactosidase-like                 183   2e-50   
ref|XP_010501131.1|  PREDICTED: beta-galactosidase 1-like               184   3e-50   
ref|XP_009627536.1|  PREDICTED: beta-galactosidase                      184   3e-50   
ref|XP_004241849.1|  PREDICTED: beta-galactosidase-like                 184   3e-50   
ref|XP_009409594.1|  PREDICTED: beta-galactosidase-like                 184   3e-50   
ref|XP_010487145.1|  PREDICTED: beta-galactosidase 1-like               184   3e-50   
ref|XP_009760184.1|  PREDICTED: beta-galactosidase-like isoform X1      184   3e-50   
ref|XP_009760186.1|  PREDICTED: beta-galactosidase-like isoform X3      184   3e-50   
ref|NP_001280755.1|  beta-galactosidase precursor                       184   3e-50   
ref|NP_187988.1|  beta galactosidase 1                                  184   3e-50   
ref|XP_009760187.1|  PREDICTED: beta-galactosidase-like isoform X4      184   3e-50   
ref|XP_010465236.1|  PREDICTED: beta-galactosidase 1                    184   3e-50   
ref|XP_010451557.1|  PREDICTED: beta-galactosidase 4-like               184   3e-50   
gb|AAM13196.1|  galactosidase, putative                                 184   3e-50   
gb|KFK34528.1|  hypothetical protein AALP_AA5G157800                    183   3e-50   
ref|XP_009760185.1|  PREDICTED: beta-galactosidase-like isoform X2      184   3e-50   
emb|CAC44502.1|  beta-galactosidase                                     184   3e-50   
ref|XP_010939579.1|  PREDICTED: beta-galactosidase 2-like               184   3e-50   
ref|XP_010667155.1|  PREDICTED: putative beta-galactosidase             183   3e-50   
ref|XP_010686091.1|  PREDICTED: beta-galactosidase 1                    184   4e-50   
ref|XP_010470077.1|  PREDICTED: beta-galactosidase 8-like               184   4e-50   
ref|XP_008391326.1|  PREDICTED: beta-galactosidase 1                    184   4e-50   
ref|XP_003546457.1|  PREDICTED: beta-galactosidase-like isoform X1      183   5e-50   
ref|XP_010515757.1|  PREDICTED: beta-galactosidase 2 isoform X1         183   5e-50   
ref|XP_010510620.1|  PREDICTED: beta-galactosidase 8-like               184   5e-50   
ref|XP_006357461.1|  PREDICTED: beta-galactosidase-like                 184   5e-50   
ref|XP_010483173.1|  PREDICTED: beta-galactosidase 4                    183   5e-50   
gb|ACP18875.1|  beta-galactosidase pBG(a)                               184   5e-50   
gb|AES59331.2|  beta-like galactosidase                                 183   5e-50   
ref|XP_009139949.1|  PREDICTED: beta-galactosidase 12 isoform X2        183   6e-50   
ref|XP_002527409.1|  beta-galactosidase, putative                       184   6e-50   
ref|XP_009139943.1|  PREDICTED: beta-galactosidase 12 isoform X1        183   6e-50   
gb|KDO73221.1|  hypothetical protein CISIN_1g003095mg                   183   6e-50   
gb|AEG76892.1|  putative beta-galactosidase                             182   7e-50   
gb|KDO73220.1|  hypothetical protein CISIN_1g003095mg                   183   7e-50   
ref|XP_008460995.1|  PREDICTED: beta-galactosidase 5-like               183   7e-50   
ref|XP_004158465.1|  PREDICTED: beta-galactosidase-like                 185   7e-50   
ref|XP_004287559.1|  PREDICTED: beta-galactosidase isoform X5           182   7e-50   
emb|CDO97918.1|  unnamed protein product                                183   7e-50   
gb|KGN53283.1|  hypothetical protein Csa_4G044980                       171   7e-50   
gb|ACF22882.1|  beta-galactosidase                                      182   8e-50   
ref|XP_011460037.1|  PREDICTED: beta-galactosidase isoform X4           182   8e-50   
ref|XP_006424599.1|  hypothetical protein CICLE_v10027805mg             183   8e-50   
emb|CDY37486.1|  BnaC01g37460D                                          183   8e-50   
ref|XP_006280080.1|  hypothetical protein CARUB_v10025963mg             182   8e-50   
gb|KCW79522.1|  hypothetical protein EUGRSUZ_C00898                     181   8e-50   
gb|AHG94611.1|  beta-galactosidase                                      183   8e-50   
ref|XP_011010891.1|  PREDICTED: beta-galactosidase 1-like               183   9e-50   
ref|XP_008775429.1|  PREDICTED: beta-galactosidase 2-like               183   9e-50   
gb|KHN24609.1|  Beta-galactosidase                                      182   1e-49   
ref|XP_010090040.1|  hypothetical protein L484_027271                   182   1e-49   
ref|XP_009611026.1|  PREDICTED: beta-galactosidase-like isoform X1      182   1e-49   
ref|XP_008793242.1|  PREDICTED: beta-galactosidase                      182   1e-49   
ref|XP_010672619.1|  PREDICTED: beta-galactosidase 5                    182   1e-49   
ref|XP_004287560.2|  PREDICTED: beta-galactosidase isoform X1           182   1e-49   
ref|XP_009611028.1|  PREDICTED: beta-galactosidase-like isoform X2      182   1e-49   
ref|XP_006403764.1|  hypothetical protein EUTSA_v10010152mg             182   1e-49   
ref|XP_011460028.1|  PREDICTED: beta-galactosidase isoform X2           182   1e-49   
ref|XP_011460033.1|  PREDICTED: beta-galactosidase isoform X3           182   1e-49   
ref|XP_006426535.1|  hypothetical protein CICLE_v10024886mg             182   1e-49   
ref|XP_006426534.1|  hypothetical protein CICLE_v10024886mg             182   1e-49   
ref|XP_004969419.1|  PREDICTED: beta-galactosidase 2-like               182   2e-49   
ref|XP_010443345.1|  PREDICTED: beta-galactosidase 4-like               181   2e-49   
gb|ABY71826.1|  beta-galactosidase                                      182   2e-49   
gb|EEC70952.1|  hypothetical protein OsI_02561                          182   2e-49   
gb|EPS62826.1|  beta-galactosidase                                      181   2e-49   
ref|XP_003533125.1|  PREDICTED: beta-galactosidase-like                 182   2e-49   
ref|XP_006366152.1|  PREDICTED: beta-galactosidase-like                 182   2e-49   
gb|KHN27597.1|  Beta-galactosidase                                      182   2e-49   
ref|XP_011077977.1|  PREDICTED: beta-galactosidase-like                 181   2e-49   
ref|NP_001043405.1|  Os01g0580200                                       182   2e-49   
ref|XP_006296187.1|  hypothetical protein CARUB_v10025350mg             182   3e-49   
gb|KDO65278.1|  hypothetical protein CISIN_1g002867mg                   181   3e-49   
ref|XP_006646030.1|  PREDICTED: beta-galactosidase 2-like               181   3e-49   
ref|XP_002879094.1|  beta-glactosidase 8                                181   3e-49   
ref|XP_007204656.1|  hypothetical protein PRUPE_ppa001412mg             181   3e-49   
gb|AAQ21369.1|  beta-galactosidase                                      181   3e-49   
gb|ABV32546.1|  beta-galactosidase protein 1                            181   3e-49   
gb|KFK32294.1|  hypothetical protein AALP_AA6G223900                    181   3e-49   
ref|XP_008242341.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    181   3e-49   
gb|EPS72701.1|  beta-galactosidase                                      174   4e-49   
ref|XP_010504030.1|  PREDICTED: beta-galactosidase 2-like               181   4e-49   
ref|NP_001234465.1|  beta-galactosidase precursor                       181   4e-49   
gb|KDP33831.1|  hypothetical protein JCGZ_07402                         181   5e-49   
gb|ACR35908.1|  unknown                                                 174   5e-49   
ref|NP_001140495.1|  hypothetical protein precursor                     174   5e-49   
ref|XP_010047575.1|  PREDICTED: beta-galactosidase-like                 181   5e-49   
tpg|DAA58690.1|  TPA: hypothetical protein ZEAMMB73_223728              174   5e-49   
ref|XP_010542431.1|  PREDICTED: beta-galactosidase 1-like               181   5e-49   
ref|XP_009398591.1|  PREDICTED: beta-galactosidase 6-like               181   5e-49   
ref|XP_007217046.1|  hypothetical protein PRUPE_ppa001415mg             181   6e-49   
gb|KJB55482.1|  hypothetical protein B456_009G078400                    181   6e-49   
ref|XP_008230925.1|  PREDICTED: beta-galactosidase-like                 180   6e-49   
ref|XP_011000791.1|  PREDICTED: beta-galactosidase 1-like               181   6e-49   
emb|CDY15749.1|  BnaC04g15750D                                          181   7e-49   
gb|KHG08626.1|  Beta-galactosidase 8 -like protein                      181   7e-49   
gb|KJB55481.1|  hypothetical protein B456_009G078400                    181   7e-49   
gb|KDO65277.1|  hypothetical protein CISIN_1g002867mg                   180   7e-49   
ref|XP_011044378.1|  PREDICTED: beta-galactosidase 8                    181   7e-49   
ref|NP_001289260.1|  beta-galactosidase precursor                       180   7e-49   
ref|XP_006466038.1|  PREDICTED: beta-galactosidase 1-like               181   7e-49   



>ref|NP_001234317.1| TBG6 protein precursor [Solanum lycopersicum]
 gb|AAF70825.1|AF154424_1 putative beta-galactosidase [Solanum lycopersicum]
Length=845

 Score =   243 bits (619),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            +++KWVL+ C+V F+SSGL  C V+YDRKAIVINGQRR+LFSGSIHYPRST EMWEDLI+
Sbjct  5    SLQKWVLLWCIVLFISSGLVHCDVTYDRKAIVINGQRRLLFSGSIHYPRSTPEMWEDLIN  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAKEGG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EW
Sbjct  65   KAKEGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>ref|XP_006340680.1| PREDICTED: beta-galactosidase 3-like [Solanum tuberosum]
Length=845

 Score =   242 bits (618),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            +++KWVL+ C+V F+SSGL  C V+YDRKAIVINGQRR+LFSGSIHYPRST EMWEDLI+
Sbjct  5    SVQKWVLLWCIVLFISSGLVHCDVTYDRKAIVINGQRRLLFSGSIHYPRSTPEMWEDLIN  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAKEGG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EW
Sbjct  65   KAKEGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>gb|ADO34791.1| beta-galactosidase STBG6 [Solanum lycopersicum]
Length=845

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            +++KWVL+ C+V F+SSGL  C V+YDR+AIVINGQRR+LFSGSIHYPRST EMWEDLI+
Sbjct  5    SLQKWVLLWCIVLFISSGLVHCDVTYDREAIVINGQRRLLFSGSIHYPRSTPEMWEDLIN  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAKEGG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EW
Sbjct  65   KAKEGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>gb|EYU24087.1| hypothetical protein MIMGU_mgv1a001258mg [Erythranthe guttata]
Length=851

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  266  RKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKA  445
            +KWVL  CMV ++ SG  QCSV+YDRKAI+INGQRR+LFSGSIHYPRST EMWEDLI+KA
Sbjct  14   KKWVLWACMVVYIGSGYVQCSVTYDRKAILINGQRRILFSGSIHYPRSTPEMWEDLINKA  73

Query  446  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  625
            KEGGVDVIETYVFWNVHEPSPGNY+FEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNF
Sbjct  74   KEGGVDVIETYVFWNVHEPSPGNYDFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNF  133

Query  626  GGFPV  640
            GGFPV
Sbjct  134  GGFPV  138



>ref|XP_009628690.1| PREDICTED: beta-galactosidase 3 [Nicotiana tomentosiformis]
Length=844

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            +++KWV++ C+V F+S  L QC V+YDRKAIVINGQRR+LFSGSIHYPRST EMWEDLI+
Sbjct  5    SVQKWVMLWCIVLFISCELIQCDVTYDRKAIVINGQRRLLFSGSIHYPRSTPEMWEDLIN  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAKEGG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EW
Sbjct  65   KAKEGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>ref|XP_009789452.1| PREDICTED: beta-galactosidase 3 [Nicotiana sylvestris]
Length=844

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            +++KWV++ C+V F+S  L QC V+YDRKAIVINGQRR+LFSGSIHYPRST EMWEDLI+
Sbjct  5    SVQKWVMLWCIVLFISCELIQCDVTYDRKAIVINGQRRLLFSGSIHYPRSTPEMWEDLIN  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAKEGG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EW
Sbjct  65   KAKEGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>gb|KHF97862.1| Beta-galactosidase 3 [Gossypium arboreum]
 gb|KHF97863.1| Beta-galactosidase 3 [Gossypium arboreum]
Length=515

 Score =   228 bits (580),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            +  ++++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRST EMWEDLI 
Sbjct  5    SFSRFLIVFCFAVCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQ  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAH+RIGPY+C EW
Sbjct  65   KAKDGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHVRIGPYVCAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>gb|KJB43420.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
 gb|KJB43421.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=608

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            ++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRST EMWEDLI KAK+G
Sbjct  10   LIVFCFALCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQKAKDG  69

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAHLRIGPY+C EWNFGGF
Sbjct  70   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHLRIGPYVCAEWNFGGF  129

Query  635  PV  640
            PV
Sbjct  130  PV  131



>gb|KJB43418.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=693

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            ++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRST EMWEDLI KAK+G
Sbjct  10   LIVFCFALCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQKAKDG  69

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAHLRIGPY+C EWNFGGF
Sbjct  70   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHLRIGPYVCAEWNFGGF  129

Query  635  PV  640
            PV
Sbjct  130  PV  131



>gb|EYU31167.1| hypothetical protein MIMGU_mgv1a001956mg [Erythranthe guttata]
Length=734

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 117/133 (88%), Gaps = 2/133 (2%)
 Frame = +2

Query  248  LRGGAMRKWVLVLCM--VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEM  421
            ++  ++ KWV  +CM  V FL  G+ Q  ++YDRKA++INGQRR+L SGSIHYPRST EM
Sbjct  1    MKNNSVSKWVFSVCMAVVVFLECGVVQSRITYDRKALIINGQRRILISGSIHYPRSTPEM  60

Query  422  WEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGP  601
            WEDLI+KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTI+KAGLYA+LRIGP
Sbjct  61   WEDLINKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIKKAGLYANLRIGP  120

Query  602  YICGEWNFGGFPV  640
            YIC EWNFGGFPV
Sbjct  121  YICAEWNFGGFPV  133



>gb|KJB43423.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=807

 Score =   228 bits (581),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            ++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRST EMWEDLI KAK+G
Sbjct  10   LIVFCFALCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQKAKDG  69

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAHLRIGPY+C EWNFGGF
Sbjct  70   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHLRIGPYVCAEWNFGGF  129

Query  635  PV  640
            PV
Sbjct  130  PV  131



>gb|KJB43422.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=850

 Score =   228 bits (582),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            ++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRST EMWEDLI KAK+G
Sbjct  10   LIVFCFALCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQKAKDG  69

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAHLRIGPY+C EWNFGGF
Sbjct  70   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHLRIGPYVCAEWNFGGF  129

Query  635  PV  640
            PV
Sbjct  130  PV  131



>gb|KJB43424.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=854

 Score =   228 bits (582),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            ++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRST EMWEDLI KAK+G
Sbjct  10   LIVFCFALCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQKAKDG  69

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAHLRIGPY+C EWNFGGF
Sbjct  70   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHLRIGPYVCAEWNFGGF  129

Query  635  PV  640
            PV
Sbjct  130  PV  131



>gb|KJB43419.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=859

 Score =   228 bits (582),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            ++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRST EMWEDLI KAK+G
Sbjct  10   LIVFCFALCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQKAKDG  69

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAHLRIGPY+C EWNFGGF
Sbjct  70   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHLRIGPYVCAEWNFGGF  129

Query  635  PV  640
            PV
Sbjct  130  PV  131



>ref|XP_010649088.1| PREDICTED: beta-galactosidase 3 [Vitis vinifera]
 emb|CBI17431.3| unnamed protein product [Vitis vinifera]
Length=845

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWE  427
            +   ++ K  LVLCMV  L S L QCSV+YDRKAIVINGQRR+L SGSIHYPRST +MWE
Sbjct  1    MEANSVSKLFLVLCMVLQLGSQLIQCSVTYDRKAIVINGQRRILISGSIHYPRSTPDMWE  60

Query  428  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  607
            D+I KAK+GG+DV+ETYVFWNVHEPSPG+YNFEGRYDLVRF++T+QKAGLYAHLRIGPY+
Sbjct  61   DIIQKAKDGGLDVVETYVFWNVHEPSPGSYNFEGRYDLVRFIRTVQKAGLYAHLRIGPYV  120

Query  608  CGEWNFGGFPV  640
            C EWNFGGFPV
Sbjct  121  CAEWNFGGFPV  131



>ref|XP_010113483.1| Beta-galactosidase 3 [Morus notabilis]
 gb|EXC35510.1| Beta-galactosidase 3 [Morus notabilis]
Length=847

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            ++RK+ L +C+V  + S L QC+V+YDRKAIVINGQRR+LFSGSIHYPRST EMWEDLI 
Sbjct  4    SVRKFWLFICLVLVVGSELIQCNVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQ  63

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+K IQ+AGLYAHLRIGPY+C EW
Sbjct  64   KAKDGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFIKLIQRAGLYAHLRIGPYVCAEW  123

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  124  NFGGFPV  130



>ref|XP_007046795.1| Beta-galactosidase 3 isoform 2 [Theobroma cacao]
 gb|EOX90952.1| Beta-galactosidase 3 isoform 2 [Theobroma cacao]
Length=702

 Score =   224 bits (572),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            ++  C+   L   +TQCSV+YDRKA+VINGQRR+LFSGSIHYPRST +MWEDLI KAK+G
Sbjct  10   LIAFCLALCLGCQVTQCSVTYDRKAVVINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDG  69

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQ+AGLYAHLRIGPY+C EWNFGGF
Sbjct  70   GLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFMKTIQRAGLYAHLRIGPYVCAEWNFGGF  129

Query  635  PV  640
            PV
Sbjct  130  PV  131



>ref|XP_007046794.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
 gb|EOX90951.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
Length=854

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            ++  C+   L   +TQCSV+YDRKA+VINGQRR+LFSGSIHYPRST +MWEDLI KAK+G
Sbjct  10   LIAFCLALCLGCQVTQCSVTYDRKAVVINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDG  69

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQ+AGLYAHLRIGPY+C EWNFGGF
Sbjct  70   GLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFMKTIQRAGLYAHLRIGPYVCAEWNFGGF  129

Query  635  PV  640
            PV
Sbjct  130  PV  131



>ref|XP_004287850.1| PREDICTED: beta-galactosidase 3 [Fragaria vesca subsp. vesca]
Length=853

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWE  427
            + G ++ K  L L +V+FL   L QC+V+YDRKAIVINGQRR+L SGSIHYPRST EMWE
Sbjct  1    MEGNSVSKLCLFLGLVWFLGFQLVQCTVTYDRKAIVINGQRRILISGSIHYPRSTPEMWE  60

Query  428  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  607
            DLI KAK+GG+DV+ETYVFWN HEPSPGNYNFEGRYDLVRF+KT+QKAGLYAHLRIGPY+
Sbjct  61   DLIQKAKDGGLDVVETYVFWNGHEPSPGNYNFEGRYDLVRFLKTVQKAGLYAHLRIGPYV  120

Query  608  CGEWNFGGFPV  640
            C EWNFGGFPV
Sbjct  121  CAEWNFGGFPV  131



>ref|XP_007158612.1| hypothetical protein PHAVU_002G1672000g, partial [Phaseolus vulgaris]
 gb|ESW30606.1| hypothetical protein PHAVU_002G1672000g, partial [Phaseolus vulgaris]
Length=365

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 109/122 (89%), Gaps = 2/122 (2%)
 Frame = +2

Query  281  VLCMVFFLSSGL--TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            + C+  +L   L    C+V+YDRKAI+INGQRR+LFSGSIHYPRST +MWEDLI KAKEG
Sbjct  13   LFCLALWLGVQLEWVHCTVTYDRKAILINGQRRLLFSGSIHYPRSTPDMWEDLIYKAKEG  72

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DVIETYVFWNVHEPSPGN+NFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGF
Sbjct  73   GLDVIETYVFWNVHEPSPGNFNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGF  132

Query  635  PV  640
            PV
Sbjct  133  PV  134



>ref|XP_006380782.1| hypothetical protein POPTR_0007s13540g [Populus trichocarpa]
 gb|ERP58579.1| hypothetical protein POPTR_0007s13540g [Populus trichocarpa]
Length=626

 Score =   220 bits (560),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  278  LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGG  457
            LV  +VF   S L QCSV+YDRKAI+INGQRR+LFSGSIHYPRST +MWEDLI KAK+GG
Sbjct  12   LVFLVVFLGCSELIQCSVTYDRKAIMINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGG  71

Query  458  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  637
            +DVIETYVFWNVHEP+PGNY+FEGRYD+VRF+KTIQ+AGLYAHLRIGPY+C EWNFGGFP
Sbjct  72   IDVIETYVFWNVHEPTPGNYHFEGRYDIVRFMKTIQRAGLYAHLRIGPYVCAEWNFGGFP  131

Query  638  V  640
            V
Sbjct  132  V  132



>ref|XP_007204246.1| hypothetical protein PRUPE_ppa002271mg [Prunus persica]
 gb|EMJ05445.1| hypothetical protein PRUPE_ppa002271mg [Prunus persica]
Length=693

 Score =   221 bits (562),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            ++ K  L L +V FL   L QC+V+YDR+AIVINGQRR+L SGSIHYPRST EMWEDLI 
Sbjct  5    SVSKLCLFLGLVCFLGFQLVQCTVTYDRRAIVINGQRRILISGSIHYPRSTPEMWEDLIQ  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+DV+ETYVFWNVHEPSPGNYNF+GRYDLVRF+KTIQKAGLYAHLRIGPY+C EW
Sbjct  65   KAKDGGLDVVETYVFWNVHEPSPGNYNFKGRYDLVRFLKTIQKAGLYAHLRIGPYVCAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>gb|KDO71054.1| hypothetical protein CISIN_1g003044mg [Citrus sinensis]
Length=626

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            ++V C+   L      CSV+YDRKA++INGQRR+LFSGSIHYPRST +MWEDLI KAK+G
Sbjct  10   LIVFCLSLCLCCHHIHCSVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDG  69

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFGGF
Sbjct  70   GLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFGGF  129

Query  635  PV  640
            PV
Sbjct  130  PV  131



>gb|EPS70273.1| beta-galactosidase, partial [Genlisea aurea]
Length=634

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  LCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVD  463
            +C+V FL   L QCSV+YDRKAIVING+RR+L SGSIHYPRST EMWEDL++KAKEGG+D
Sbjct  2    VCIVVFLGGSLVQCSVTYDRKAIVINGERRILISGSIHYPRSTPEMWEDLMNKAKEGGLD  61

Query  464  VIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            VI+TYVFWNVHEPS G+YNFEGRYDLVRFVKT QK+GLY HLRIGPYICGEWNFGGFPV
Sbjct  62   VIDTYVFWNVHEPSQGHYNFEGRYDLVRFVKTAQKSGLYVHLRIGPYICGEWNFGGFPV  120



>gb|AAW47739.1| beta-galactosidase [Prunus persica]
Length=853

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWE  427
            +   ++ K  L L +V FL   L QC+V+YDR+AIVINGQRR+L SGSIHYPRST EMWE
Sbjct  1    METNSVSKLCLFLGLVCFLGFQLVQCTVTYDRRAIVINGQRRILISGSIHYPRSTPEMWE  60

Query  428  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  607
            DLI KAK+GG+DV+ETYVFWNVHEPSPGNYNF+GRYDLVRF+KTIQKAGLYAHLRIGPY+
Sbjct  61   DLIQKAKDGGLDVVETYVFWNVHEPSPGNYNFKGRYDLVRFLKTIQKAGLYAHLRIGPYV  120

Query  608  CGEWNFGGFPV  640
            C EWNFGGFPV
Sbjct  121  CAEWNFGGFPV  131



>gb|KGN48881.1| hypothetical protein Csa_6G504610 [Cucumis sativus]
Length=750

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            +LVL + + L     QCSV+YDRKAI+INGQRRVLFSGSIHYPRST EMWE LI KAKEG
Sbjct  11   MLVLGLFWLLGVQFVQCSVTYDRKAILINGQRRVLFSGSIHYPRSTPEMWEGLIQKAKEG  70

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYA+LRIGPY+C EWNFGGF
Sbjct  71   GLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYANLRIGPYVCAEWNFGGF  130

Query  635  PV  640
            PV
Sbjct  131  PV  132



>ref|XP_011100972.1| PREDICTED: beta-galactosidase 3-like [Sesamum indicum]
Length=848

 Score =   220 bits (561),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  311  GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWN  490
            GL QCSV+YD+KA+VINGQRR+L SGSIHYPRST EMWEDLI+KAKEGG+DVIETYVFWN
Sbjct  22   GLVQCSVTYDKKAMVINGQRRILISGSIHYPRSTPEMWEDLINKAKEGGLDVIETYVFWN  81

Query  491  VHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            VHEPSPGNYNFEGRYDLVRF+KTIQ+AGLYAHLRIGPY+C EWNFGGFPV
Sbjct  82   VHEPSPGNYNFEGRYDLVRFIKTIQRAGLYAHLRIGPYVCAEWNFGGFPV  131



>ref|XP_002310279.2| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE90729.2| beta-galactosidase family protein [Populus trichocarpa]
Length=847

 Score =   219 bits (559),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  278  LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGG  457
            LV  +VF   S L QCSV+YDRKAI+INGQRR+LFSGSIHYPRST +MWEDLI KAK+GG
Sbjct  12   LVFLVVFLGCSELIQCSVTYDRKAIMINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGG  71

Query  458  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  637
            +DVIETYVFWNVHEP+PGNY+FEGRYD+VRF+KTIQ+AGLYAHLRIGPY+C EWNFGGFP
Sbjct  72   IDVIETYVFWNVHEPTPGNYHFEGRYDIVRFMKTIQRAGLYAHLRIGPYVCAEWNFGGFP  131

Query  638  V  640
            V
Sbjct  132  V  132



>ref|XP_004149980.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=854

 Score =   219 bits (559),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            +LVL + + L     QCSV+YDRKAI+INGQRRVLFSGSIHYPRST EMWE LI KAKEG
Sbjct  11   MLVLGLFWLLGVQFVQCSVTYDRKAILINGQRRVLFSGSIHYPRSTPEMWEGLIQKAKEG  70

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYA+LRIGPY+C EWNFGGF
Sbjct  71   GLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYANLRIGPYVCAEWNFGGF  130

Query  635  PV  640
            PV
Sbjct  131  PV  132



>ref|XP_011025878.1| PREDICTED: beta-galactosidase 3 [Populus euphratica]
Length=847

 Score =   219 bits (559),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
              VL +VF   S L QCSV+YDRKAI+INGQRR+LFSGSIHYPRST +MWEDLI KAK+G
Sbjct  11   CFVLLVVFLGCSELIQCSVTYDRKAIMINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDG  70

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DVIETYVFWNVHEP+PGNY+FEGRYD+VRF+KTIQ+AGLYAHLRIGPY+C EWNFGGF
Sbjct  71   GIDVIETYVFWNVHEPTPGNYHFEGRYDIVRFMKTIQRAGLYAHLRIGPYVCAEWNFGGF  130

Query  635  PV  640
            PV
Sbjct  131  PV  132



>ref|XP_008241765.1| PREDICTED: beta-galactosidase 3 [Prunus mume]
Length=853

 Score =   219 bits (559),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWE  427
            +   ++ K  L L +V FL   L QC+V+YDR+AIVINGQRR+L SGSIHYPRST EMWE
Sbjct  1    METNSVSKLCLFLGLVCFLGFQLVQCTVTYDRRAIVINGQRRILISGSIHYPRSTPEMWE  60

Query  428  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  607
            DLI KAK+GG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKA LYAHLRIGPY+
Sbjct  61   DLIQKAKDGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFLKTIQKARLYAHLRIGPYV  120

Query  608  CGEWNFGGFPV  640
            C EWNFGGFPV
Sbjct  121  CAEWNFGGFPV  131



>ref|XP_008440778.1| PREDICTED: beta-galactosidase 3 [Cucumis melo]
Length=854

 Score =   219 bits (559),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            +LVL + + L     QCSV+YDRKAI+INGQRRVLFSGSIHYPRST EMWE LI KAKEG
Sbjct  11   MLVLGLFWLLGVQFVQCSVTYDRKAILINGQRRVLFSGSIHYPRSTPEMWEGLIQKAKEG  70

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYA+LRIGPY+C EWNFGGF
Sbjct  71   GLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYANLRIGPYVCAEWNFGGF  130

Query  635  PV  640
            PV
Sbjct  131  PV  132



>gb|KDO71053.1| hypothetical protein CISIN_1g003044mg [Citrus sinensis]
Length=816

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            ++V C+   L      CSV+YDRKA++INGQRR+LFSGSIHYPRST +MWEDLI KAK+G
Sbjct  10   LIVFCLSLCLCCHHIHCSVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDG  69

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFGGF
Sbjct  70   GLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFGGF  129

Query  635  PV  640
            PV
Sbjct  130  PV  131



>gb|KDO71052.1| hypothetical protein CISIN_1g003044mg [Citrus sinensis]
Length=854

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            ++V C+   L      CSV+YDRKA++INGQRR+LFSGSIHYPRST +MWEDLI KAK+G
Sbjct  10   LIVFCLSLCLCCHHIHCSVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDG  69

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFGGF
Sbjct  70   GLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFGGF  129

Query  635  PV  640
            PV
Sbjct  130  PV  131



>ref|XP_002263382.2| PREDICTED: beta-galactosidase 3 [Vitis vinifera]
 emb|CBI38026.3| unnamed protein product [Vitis vinifera]
Length=846

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 109/124 (88%), Gaps = 1/124 (1%)
 Frame = +2

Query  269  KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAK  448
            KW L LCM  FL   LTQCSV+YDRKA++INGQRR+LFSGSIHYPRST +MWE LI KAK
Sbjct  8    KWFL-LCMWVFLCIQLTQCSVTYDRKALIINGQRRILFSGSIHYPRSTPQMWEGLIQKAK  66

Query  449  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  628
            +GG+D I+TYVFWN+HEPSPG YNFEGRYDLVRF+K IQKAGLY HLRIGPYIC EWNFG
Sbjct  67   DGGLDAIDTYVFWNLHEPSPGKYNFEGRYDLVRFIKLIQKAGLYVHLRIGPYICAEWNFG  126

Query  629  GFPV  640
            GFPV
Sbjct  127  GFPV  130



>ref|XP_004158882.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=854

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            +LVL + + L     QCSV+YDRKAI+INGQRRVLFSGSIHYPRST EMWE LI KAKEG
Sbjct  11   MLVLGLFWLLGVQFVQCSVTYDRKAILINGQRRVLFSGSIHYPRSTPEMWEGLIQKAKEG  70

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DV+ETYVFWNVHEPSPGNYNFEGRYDL RF+KTIQKAGLYA+LRIGPY+C EWNFGGF
Sbjct  71   GLDVVETYVFWNVHEPSPGNYNFEGRYDLARFIKTIQKAGLYANLRIGPYVCAEWNFGGF  130

Query  635  PV  640
            PV
Sbjct  131  PV  132



>gb|KJB17716.1| hypothetical protein B456_003G011900 [Gossypium raimondii]
Length=854

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +2

Query  299  FLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETY  478
            +LS  L Q SV+YD+KAIVINGQRR+LFSGSIHYPRST +MWEDLI KAK+GG+DVIETY
Sbjct  19   YLSPQLVQTSVTYDKKAIVINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGGLDVIETY  78

Query  479  VFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            VFWNVHEPSPGNYNFEGRYDLVRF+KT+QKAGLYAHLRIGPY+C EWNFGGFPV
Sbjct  79   VFWNVHEPSPGNYNFEGRYDLVRFIKTVQKAGLYAHLRIGPYVCAEWNFGGFPV  132



>ref|XP_006425593.1| hypothetical protein CICLE_v10024881mg [Citrus clementina]
 ref|XP_006466876.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
 gb|ESR38833.1| hypothetical protein CICLE_v10024881mg [Citrus clementina]
Length=854

 Score =   218 bits (554),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            ++V C+   L      CSV+YDRKA++INGQRR+LFSGSIHYPRST +MWEDLI KAK+G
Sbjct  10   LIVFCLSLCLCCHHIHCSVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDG  69

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTI+KAGLYAHLRIGPY+C EWNFGGF
Sbjct  70   GLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIKKAGLYAHLRIGPYVCAEWNFGGF  129

Query  635  PV  640
            PV
Sbjct  130  PV  131



>gb|KJB58183.1| hypothetical protein B456_009G198100 [Gossypium raimondii]
Length=590

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWE  427
            +   ++ K ++     F  SS L QCS++YD+KAI+INGQRR+L SGSIHYPRST EMWE
Sbjct  1    METSSVSKLLIFFFTAFLASSKLIQCSITYDKKAILINGQRRILISGSIHYPRSTPEMWE  60

Query  428  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  607
            DLI KAK+GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPYI
Sbjct  61   DLIKKAKDGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKLGLYVHLRIGPYI  120

Query  608  CGEWNFGGFPV  640
            C EWNFGGFPV
Sbjct  121  CAEWNFGGFPV  131



>ref|XP_010029731.1| PREDICTED: beta-galactosidase 3 [Eucalyptus grandis]
 gb|KCW56689.1| hypothetical protein EUGRSUZ_I02384 [Eucalyptus grandis]
Length=849

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +2

Query  314  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNV  493
            L QCSVSYDRKA+VI+GQRR+LFSGSIHYPRST +MWEDLI KAK+GG+DV+ETYVFWNV
Sbjct  25   LIQCSVSYDRKALVIDGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGGLDVVETYVFWNV  84

Query  494  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            HEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFGGFPV
Sbjct  85   HEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFGGFPV  133



>ref|XP_007160714.1| hypothetical protein PHAVU_001G010900g [Phaseolus vulgaris]
 gb|ESW32708.1| hypothetical protein PHAVU_001G010900g [Phaseolus vulgaris]
Length=739

 Score =   216 bits (550),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWE  427
            +   ++ K +L++  +FF+ S L  CSV+YDRKAI+INGQRR+L SGSIHYPRS  EMWE
Sbjct  1    METNSVSKLLLLVFTIFFVGSELIHCSVTYDRKAIIINGQRRILISGSIHYPRSAPEMWE  60

Query  428  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  607
            DLI KAK+GG+D I+TYVFWNVHEPSPGNYNFEGRYDLVRF+KT+Q+ GLY HLRIGPY+
Sbjct  61   DLIRKAKDGGLDAIDTYVFWNVHEPSPGNYNFEGRYDLVRFIKTVQRVGLYVHLRIGPYV  120

Query  608  CGEWNFGGFPV  640
            C EWNFGGFPV
Sbjct  121  CAEWNFGGFPV  131



>ref|XP_010254673.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  320  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHE  499
            +CSV+YDRKAI+INGQRR+LFSGSIHYPRST EMW DLI KAKEGG+DVI+TYVFWNVHE
Sbjct  24   ECSVTYDRKAIIINGQRRILFSGSIHYPRSTPEMWGDLIQKAKEGGLDVIQTYVFWNVHE  83

Query  500  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            PSPGNYNFEGRYDLVRF+KT+QKAGLY HLRIGPYICGEWNFGGFPV
Sbjct  84   PSPGNYNFEGRYDLVRFIKTVQKAGLYVHLRIGPYICGEWNFGGFPV  130



>ref|NP_849506.1| beta-galactosidase 3 [Arabidopsis thaliana]
 gb|AEE86647.1| beta-galactosidase 3 [Arabidopsis thaliana]
Length=855

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 113/136 (83%), Gaps = 1/136 (1%)
 Frame = +2

Query  236  LREKLRGGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRST  412
            +RE   G +  + +L  C+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST
Sbjct  1    MREMGTGDSASRLILWFCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRST  60

Query  413  LEMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLR  592
             +MWEDLI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLR
Sbjct  61   PDMWEDLIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLR  120

Query  593  IGPYICGEWNFGGFPV  640
            IGPY+C EWNFGGFPV
Sbjct  121  IGPYVCAEWNFGGFPV  136



>ref|NP_568001.1| beta-galactosidase 3 [Arabidopsis thaliana]
 sp|Q9SCV9.1|BGAL3_ARATH RecName: Full=Beta-galactosidase 3; Short=Lactase 3; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB64739.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAL07134.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAM14371.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEE86646.1| beta-galactosidase 3 [Arabidopsis thaliana]
Length=856

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 113/136 (83%), Gaps = 1/136 (1%)
 Frame = +2

Query  236  LREKLRGGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRST  412
            +RE   G +  + +L  C+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST
Sbjct  1    MREMGTGDSASRLILWFCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRST  60

Query  413  LEMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLR  592
             +MWEDLI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLR
Sbjct  61   PDMWEDLIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLR  120

Query  593  IGPYICGEWNFGGFPV  640
            IGPY+C EWNFGGFPV
Sbjct  121  IGPYVCAEWNFGGFPV  136



>emb|CAA18137.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=853

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 113/136 (83%), Gaps = 1/136 (1%)
 Frame = +2

Query  236  LREKLRGGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRST  412
            +RE   G +  + +L  C+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST
Sbjct  1    MREMGTGDSASRLILWFCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRST  60

Query  413  LEMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLR  592
             +MWEDLI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLR
Sbjct  61   PDMWEDLIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLR  120

Query  593  IGPYICGEWNFGGFPV  640
            IGPY+C EWNFGGFPV
Sbjct  121  IGPYVCAEWNFGGFPV  136



>ref|NP_001268162.1| beta-galactosidase BG1-like precursor [Vitis vinifera]
 gb|AAK81874.1| putative beta-galactosidase BG1 [Vitis vinifera]
Length=854

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  293  VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIE  472
            + FL S L QCSV+YD+KAIVINGQRR+L SGSIHYPRST +MWEDLI KAK+GG+DVI+
Sbjct  17   LMFLHSQLIQCSVTYDKKAIVINGQRRILISGSIHYPRSTPDMWEDLIRKAKDGGLDVID  76

Query  473  TYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            TY+FWNVHEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPV
Sbjct  77   TYIFWNVHEPSPGNYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPV  132



>emb|CBI19767.3| unnamed protein product [Vitis vinifera]
Length=854

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  293  VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIE  472
            + FL S L QCSV+YD+KAIVINGQRR+L SGSIHYPRST +MWEDLI KAK+GG+DVI+
Sbjct  17   LMFLHSQLIQCSVTYDKKAIVINGQRRILISGSIHYPRSTPDMWEDLIRKAKDGGLDVID  76

Query  473  TYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            TY+FWNVHEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPV
Sbjct  77   TYIFWNVHEPSPGNYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPV  132



>emb|CAN78072.1| hypothetical protein VITISV_013292 [Vitis vinifera]
Length=854

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  293  VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIE  472
            + FL S L QCSV+YD+KAIVINGQRR+L SGSIHYPRST +MWEDLI KAK+GG+DVI+
Sbjct  17   LMFLHSQLIQCSVTYDKKAIVINGQRRILISGSIHYPRSTPDMWEDLIRKAKDGGLDVID  76

Query  473  TYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            TY+FWNVHEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPV
Sbjct  77   TYIFWNVHEPSPGNYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPV  132



>ref|XP_010275526.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            + V  +V  +S     C+V+YDRKAI+INGQRR+L SGSIHYPRST EMWEDLI KAKEG
Sbjct  9    LFVFFLVLSVSFQWILCTVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIQKAKEG  68

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DVI+TYVFWNVHEPSPGNYNFEGRYDLVRF+KT+QKAGLY HLRIGPYICGEWNFGGF
Sbjct  69   GLDVIQTYVFWNVHEPSPGNYNFEGRYDLVRFIKTVQKAGLYVHLRIGPYICGEWNFGGF  128

Query  635  PV  640
            PV
Sbjct  129  PV  130



>ref|XP_003538867.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=853

 Score =   214 bits (546),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 108/121 (89%), Gaps = 2/121 (2%)
 Frame = +2

Query  284  LCMVFFLSSGLTQ--CSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGG  457
             C+  +L   L Q  CSV+YDRKAI+INGQRR+LFSGSIHYPRST +MWEDLI KAKEGG
Sbjct  15   FCLALWLGFQLEQVHCSVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGG  74

Query  458  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  637
            +DVIETY+FWNVHEPS GNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFP
Sbjct  75   LDVIETYIFWNVHEPSRGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFP  134

Query  638  V  640
            V
Sbjct  135  V  135



>gb|KHN41933.1| Beta-galactosidase 3 [Glycine soja]
Length=862

 Score =   214 bits (546),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 108/121 (89%), Gaps = 2/121 (2%)
 Frame = +2

Query  284  LCMVFFLSSGLTQ--CSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGG  457
             C+  +L   L Q  CSV+YDRKAI+INGQRR+LFSGSIHYPRST +MWEDLI KAKEGG
Sbjct  15   FCLALWLGFQLEQVHCSVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGG  74

Query  458  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  637
            +DVIETY+FWNVHEPS GNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFP
Sbjct  75   LDVIETYIFWNVHEPSRGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFP  134

Query  638  V  640
            V
Sbjct  135  V  135



>gb|KJB58182.1| hypothetical protein B456_009G198100 [Gossypium raimondii]
Length=733

 Score =   213 bits (543),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            ++ K ++     F  SS L QCS++YD+KAI+INGQRR+L SGSIHYPRST EMWEDLI 
Sbjct  5    SVSKLLIFFFTAFLASSKLIQCSITYDKKAILINGQRRILISGSIHYPRSTPEMWEDLIK  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPYIC EW
Sbjct  65   KAKDGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKLGLYVHLRIGPYICAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>ref|XP_002510455.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF52642.1| beta-galactosidase, putative [Ricinus communis]
Length=846

 Score =   214 bits (545),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWE  427
            +   ++ K +    MV  + S L QC+V+YD+KAI+INGQRR+L SGSIHYPRST EMWE
Sbjct  1    METNSVSKLLTFFLMVLLMGSKLVQCTVTYDKKAIIINGQRRILISGSIHYPRSTPEMWE  60

Query  428  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  607
            DLI KAK+GG+DVI+TYVFW+VHE SPGNYNF+GRYDLVRF+KT+QK GLYAHLRIGPY+
Sbjct  61   DLIQKAKDGGLDVIDTYVFWDVHETSPGNYNFDGRYDLVRFIKTVQKVGLYAHLRIGPYV  120

Query  608  CGEWNFGGFPV  640
            C EWNFGGFPV
Sbjct  121  CAEWNFGGFPV  131



>gb|KHG23756.1| Beta-galactosidase 5 -like protein [Gossypium arboreum]
Length=741

 Score =   213 bits (543),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            ++ K ++     F  SS L QCS++YD+KAI+INGQRR+L SGSIHYPRST EMWEDLI 
Sbjct  5    SVSKLLIFFFSAFLASSKLIQCSITYDKKAILINGQRRILISGSIHYPRSTPEMWEDLIK  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPYIC EW
Sbjct  65   KAKDGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKLGLYVHLRIGPYICAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>ref|XP_011037170.1| PREDICTED: beta-galactosidase 5-like [Populus euphratica]
Length=789

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = +2

Query  239  REKLRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLE  418
             EK+   +  KW+  L +V      L QC+V+YD+KA++INGQR+VLFSGSIHYPRST E
Sbjct  56   EEKMVANSTTKWLFSLSVVLLTGLQLIQCNVTYDKKALIINGQRKVLFSGSIHYPRSTPE  115

Query  419  MWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIG  598
            MWE LI KAK+GG+DVI+TYVFWN+HEPSPGNYNF+GRYDLVRF+K + +AGLY HLRIG
Sbjct  116  MWEGLIQKAKDGGLDVIDTYVFWNLHEPSPGNYNFDGRYDLVRFIKLVHEAGLYVHLRIG  175

Query  599  PYICGEWNFGGFPV  640
            PYIC EWNFGGFPV
Sbjct  176  PYICAEWNFGGFPV  189



>emb|CDP01954.1| unnamed protein product [Coffea canephora]
Length=851

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +2

Query  269  KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAK  448
            KWVLVLCMV  L +   Q SVSYDRKA+VIN QRR+L SGSIHYPRST EMWEDLI+KAK
Sbjct  8    KWVLVLCMVVVLGAEFVQSSVSYDRKAVVINEQRRILISGSIHYPRSTPEMWEDLINKAK  67

Query  449  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  628
            +GG+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFG
Sbjct  68   DGGLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFG  127

Query  629  GFPV  640
            GFPV
Sbjct  128  GFPV  131



>emb|CDO97013.1| unnamed protein product [Coffea canephora]
Length=730

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 110/127 (87%), Gaps = 1/127 (1%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            A  KW L  CM+  L++ +  CSV+YDRKA++I+GQRR+LFSGSIHYPRST +MWE LI 
Sbjct  6    ASSKWFL-HCMLLILAAQVAHCSVTYDRKALIIDGQRRILFSGSIHYPRSTPDMWEGLIQ  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+D I+TYVFWN+HEPSPGN+NFEGRYDLVRF+K +QKAGLY HLRIGPY+C EW
Sbjct  65   KAKDGGLDAIDTYVFWNIHEPSPGNFNFEGRYDLVRFIKLVQKAGLYVHLRIGPYVCAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>ref|XP_006283100.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
 gb|EOA15998.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
Length=813

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 110/130 (85%), Gaps = 1/130 (1%)
 Frame = +2

Query  254  GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWED  430
            G +  + VL LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST +MWE 
Sbjct  7    GDSSSRLVLWLCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWES  66

Query  431  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  610
            LI KAK+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  67   LIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  126

Query  611  GEWNFGGFPV  640
             EWNFGGFPV
Sbjct  127  AEWNFGGFPV  136



>dbj|BAD91082.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=854

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  320  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHE  499
             C+V+YDRKAIVINGQRR+L SGSIHYPRST EMWEDLI KAK+GG+DV+ETYVFWNVHE
Sbjct  25   HCAVTYDRKAIVINGQRRILISGSIHYPRSTPEMWEDLIQKAKDGGLDVVETYVFWNVHE  84

Query  500  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            P+PGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFGGFPV
Sbjct  85   PTPGNYNFEGRYDLVRFLKTIQKAGLYAHLRIGPYVCAEWNFGGFPV  131



>ref|XP_007042084.1| Beta-galactosidase 3 isoform 2 [Theobroma cacao]
 gb|EOX97915.1| Beta-galactosidase 3 isoform 2 [Theobroma cacao]
Length=627

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 110/129 (85%), Gaps = 1/129 (1%)
 Frame = +2

Query  257  GAMRKWVLVLCMVF-FLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDL  433
            GA       LC+   FLS  +TQCSVSYDRKA++I+GQRR+L SGSIHYPRST +MWE L
Sbjct  2    GATSASQFFLCIAMVFLSVKVTQCSVSYDRKALIIDGQRRILLSGSIHYPRSTPQMWEGL  61

Query  434  ISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICG  613
            I KAK+GG+D I+TYVFWN+HEPSPGNYNFEGRYDLVRF+K ++KAGLY +LRIGPYICG
Sbjct  62   IQKAKDGGLDAIDTYVFWNLHEPSPGNYNFEGRYDLVRFIKLVKKAGLYVNLRIGPYICG  121

Query  614  EWNFGGFPV  640
            EWNFGGFPV
Sbjct  122  EWNFGGFPV  130



>gb|KHN36067.1| Beta-galactosidase 3 [Glycine soja]
Length=849

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 108/121 (89%), Gaps = 2/121 (2%)
 Frame = +2

Query  284  LCMVFFLSSGLTQ--CSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGG  457
             C+  +L   L Q  CSV+YDRKAI+INGQRR+LFSGSIHYPRST +MWEDLI KAKEGG
Sbjct  15   FCLALWLGFQLEQVHCSVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGG  74

Query  458  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  637
            +DVIETYVFWNVHEPS GNYNFEGRYDLVRFVKTIQKAGLYA+LRIGPY+C EWNFGGFP
Sbjct  75   LDVIETYVFWNVHEPSRGNYNFEGRYDLVRFVKTIQKAGLYANLRIGPYVCAEWNFGGFP  134

Query  638  V  640
            V
Sbjct  135  V  135



>emb|CAB16852.1| beta-galactosidase like protein [Arabidopsis thaliana]
 emb|CAB80302.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=853

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 110/130 (85%), Gaps = 1/130 (1%)
 Frame = +2

Query  254  GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWED  430
            G +  + +L  C+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST +MWED
Sbjct  4    GDSASRLILWFCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWED  63

Query  431  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  610
            LI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  64   LIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  123

Query  611  GEWNFGGFPV  640
             EWNFGGFPV
Sbjct  124  AEWNFGGFPV  133



>ref|XP_003517202.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=849

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 108/121 (89%), Gaps = 2/121 (2%)
 Frame = +2

Query  284  LCMVFFLSSGLTQ--CSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGG  457
             C+  +L   L Q  CSV+YDRKAI+INGQRR+LFSGSIHYPRST +MWEDLI KAKEGG
Sbjct  15   FCLALWLGFQLEQVHCSVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGG  74

Query  458  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  637
            +DVIETYVFWNVHEPS GNYNFEGRYDLVRFVKTIQKAGLYA+LRIGPY+C EWNFGGFP
Sbjct  75   LDVIETYVFWNVHEPSRGNYNFEGRYDLVRFVKTIQKAGLYANLRIGPYVCAEWNFGGFP  134

Query  638  V  640
            V
Sbjct  135  V  135



>ref|XP_002305449.1| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE85960.1| beta-galactosidase family protein [Populus trichocarpa]
Length=731

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWE  427
            +   +  KW+  L +V   S  L QC+V+YD+KA++INGQR+VLFSGSIHYPRST EMWE
Sbjct  1    MAANSTTKWLFSLSVVLLTSLQLIQCNVTYDKKALIINGQRKVLFSGSIHYPRSTPEMWE  60

Query  428  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  607
             LI KAK+GG+DVI+TYVFWN+HEPSPGNYNF+GRYDLVRF+K + +AGLY HLRIGPYI
Sbjct  61   GLIQKAKDGGLDVIDTYVFWNLHEPSPGNYNFDGRYDLVRFIKLVHEAGLYVHLRIGPYI  120

Query  608  CGEWNFGGFPV  640
            C EWNFGGFPV
Sbjct  121  CAEWNFGGFPV  131



>ref|XP_006283101.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
 gb|EOA15999.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
Length=856

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 110/130 (85%), Gaps = 1/130 (1%)
 Frame = +2

Query  254  GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWED  430
            G +  + VL LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST +MWE 
Sbjct  7    GDSSSRLVLWLCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWES  66

Query  431  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  610
            LI KAK+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  67   LIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  126

Query  611  GEWNFGGFPV  640
             EWNFGGFPV
Sbjct  127  AEWNFGGFPV  136



>ref|XP_003520277.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=848

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +2

Query  308  SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFW  487
            S + + SV+YDRKA++INGQRR+LFSGSIHYPRST +MWEDLI KAKEGG+DV+ETYVFW
Sbjct  20   SHVARASVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLILKAKEGGIDVVETYVFW  79

Query  488  NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFPV
Sbjct  80   NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPV  130



>ref|XP_010679814.1| PREDICTED: beta-galactosidase 3 [Beta vulgaris subsp. vulgaris]
Length=853

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  263  MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISK  442
            M+  +L   ++ FL+    QCSVSYDRKA++I+GQRR+L SGSIHYPRST +MWEDLI K
Sbjct  1    MKSLMLFWVLMLFLNCKFMQCSVSYDRKALLIDGQRRILMSGSIHYPRSTPDMWEDLIMK  60

Query  443  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  622
            AK GG+D I+TYVFWNVHEPSPGNYNFEGRYD+V+F+K IQKAGLYAHLRIGPY+C EWN
Sbjct  61   AKNGGLDAIDTYVFWNVHEPSPGNYNFEGRYDIVKFLKIIQKAGLYAHLRIGPYVCAEWN  120

Query  623  FGGFPV  640
            FGGFPV
Sbjct  121  FGGFPV  126



>ref|XP_011083163.1| PREDICTED: beta-galactosidase 3 [Sesamum indicum]
Length=845

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  320  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHE  499
            +CSV+YDRKA++INGQRR+L SGSIHYPRST EMWEDLI+KAKEGG+DVI+TYVFWNVHE
Sbjct  26   ECSVTYDRKALIINGQRRILISGSIHYPRSTPEMWEDLINKAKEGGLDVIDTYVFWNVHE  85

Query  500  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            PSPGNYNFEGRYDLV+FVKTIQKAGLYAHLRIGPY+C EWNFGG PV
Sbjct  86   PSPGNYNFEGRYDLVKFVKTIQKAGLYAHLRIGPYVCAEWNFGGLPV  132



>gb|KDP38567.1| hypothetical protein JCGZ_04492 [Jatropha curcas]
Length=853

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            + +  MV  + S L Q SV+YD+KAI+INGQRR+L SGSIHYPRST EMWEDLI KAK+G
Sbjct  10   LTIYLMVLLMGSELIQGSVTYDKKAIIINGQRRILISGSIHYPRSTPEMWEDLIQKAKDG  69

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+D I+TYVFW+VHEPSPGNYNFEGRYDLVRF+KTIQK GLYAHLRIGPY+C EWNFGG+
Sbjct  70   GLDAIDTYVFWDVHEPSPGNYNFEGRYDLVRFIKTIQKVGLYAHLRIGPYVCAEWNFGGY  129

Query  635  PV  640
            PV
Sbjct  130  PV  131



>ref|XP_010437358.1| PREDICTED: beta-galactosidase 3-like [Camelina sativa]
Length=856

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 110/130 (85%), Gaps = 1/130 (1%)
 Frame = +2

Query  254  GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWED  430
            G +  + +L LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST +MWE 
Sbjct  7    GDSASRMILWLCLGFLILDVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  431  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  610
            LI KAK+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  67   LIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  126

Query  611  GEWNFGGFPV  640
             EWNFGGFPV
Sbjct  127  AEWNFGGFPV  136



>gb|KHN27041.1| Beta-galactosidase 3 [Glycine soja]
Length=848

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +2

Query  317  TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVH  496
            +  SV+YDRKAI+INGQRR+LFSGSIHYPRST +MWEDLI KAKEGG+DV+ETYVFWNVH
Sbjct  23   SHASVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLILKAKEGGLDVVETYVFWNVH  82

Query  497  EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFPV
Sbjct  83   EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPV  130



>ref|XP_010446807.1| PREDICTED: beta-galactosidase 3 [Camelina sativa]
Length=856

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 110/130 (85%), Gaps = 1/130 (1%)
 Frame = +2

Query  254  GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWED  430
            G +  + +L LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST +MWE 
Sbjct  7    GDSASRMILWLCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  431  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  610
            LI KAK+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  67   LIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  126

Query  611  GEWNFGGFPV  640
             EWNFGGFPV
Sbjct  127  AEWNFGGFPV  136



>gb|KDO49473.1| hypothetical protein CISIN_1g0051602mg, partial [Citrus sinensis]
Length=416

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +2

Query  278  LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGG  457
            + + +V  L   LT  SV+YD KA++INGQRR+LFSGSIHYPRS+ EMWE LI KAK+GG
Sbjct  10   IFMSIVLSLCLHLTLSSVTYDSKALIINGQRRILFSGSIHYPRSSHEMWEGLIQKAKDGG  69

Query  458  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  637
            +DVI+TYVFWNVHEPSPGNYNFEGRYDLVRF+K +QKAGLY HLRIGPYIC EWNFGGFP
Sbjct  70   LDVIDTYVFWNVHEPSPGNYNFEGRYDLVRFIKLVQKAGLYVHLRIGPYICAEWNFGGFP  129

Query  638  V  640
            V
Sbjct  130  V  130



>ref|XP_003548865.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=848

 Score =   212 bits (539),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +2

Query  317  TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVH  496
            +  SV+YDRKAI+INGQRR+LFSGSIHYPRST +MWEDLI KAKEGG+DV+ETYVFWNVH
Sbjct  23   SHASVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLILKAKEGGLDVVETYVFWNVH  82

Query  497  EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFPV
Sbjct  83   EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPV  130



>ref|XP_010432182.1| PREDICTED: beta-galactosidase 3-like [Camelina sativa]
Length=856

 Score =   212 bits (539),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = +2

Query  254  GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWED  430
            G ++ + +L LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST +MWE 
Sbjct  7    GDSVSRMILWLCLGFLILVVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  431  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  610
            LI KAK+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  67   LIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  126

Query  611  GEWNFGGFPV  640
             EWNFGGFPV
Sbjct  127  AEWNFGGFPV  136



>ref|XP_002306893.1| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE93889.1| beta-galactosidase family protein [Populus trichocarpa]
Length=853

 Score =   212 bits (539),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            ++ K++ +  MV  + S L  C+V+YD+KAI+I+GQRR+L SGSIHYPRST +MWEDL+ 
Sbjct  5    SVSKFLTLFLMVLIVGSKLIHCTVTYDKKAIIIDGQRRILISGSIHYPRSTPDMWEDLVQ  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+DVI+TYVFWNVHEPSPGNYNFEGR+DLVRF+KT+QK GLY HLRIGPY+C EW
Sbjct  65   KAKDGGLDVIDTYVFWNVHEPSPGNYNFEGRFDLVRFIKTVQKGGLYVHLRIGPYVCAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>ref|XP_008338023.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
 ref|XP_008367947.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
Length=853

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  314  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNV  493
            L  C+V+YDRKAIVINGQRR+L SGSIHYPRST E WEDLI KAK+GG+DV+ETYVFWNV
Sbjct  23   LVHCAVTYDRKAIVINGQRRILISGSIHYPRSTPEXWEDLIQKAKDGGLDVVETYVFWNV  82

Query  494  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            HEP+PGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFGGFPV
Sbjct  83   HEPTPGNYNFEGRYDLVRFLKTIQKAGLYAHLRIGPYVCAEWNFGGFPV  131



>ref|XP_009761050.1| PREDICTED: beta-galactosidase 5 [Nicotiana sylvestris]
Length=729

 Score =   211 bits (536),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWE  427
            +   ++ K+ +V  +   + + L  C V+YD+KAI+INGQRR+L SGSIHYPRST EMWE
Sbjct  1    METSSVSKFFIVYTISLLMVAQLIWCKVTYDKKAIIINGQRRILLSGSIHYPRSTPEMWE  60

Query  428  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  607
            DLI+KAK+  +DVIETYVFWN+HEPSPGNY+FEGRYDLVRF+KT+QKAGLYAHLRIGPY+
Sbjct  61   DLINKAKDANLDVIETYVFWNIHEPSPGNYDFEGRYDLVRFIKTVQKAGLYAHLRIGPYV  120

Query  608  CGEWNFGGFPV  640
            C EWNFGGFPV
Sbjct  121  CAEWNFGGFPV  131



>gb|AAF67342.1| beta galactosidase [Vigna radiata]
Length=739

 Score =   211 bits (536),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            ++ K ++++  + FL S L  CSV+YDRKAI+INGQRR+L SGSIHYPRST EMWEDLI 
Sbjct  5    SVSKLLVLVFTILFLGSELIHCSVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIR  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK GG+D I+TYVFWNVHEPSPG YNFEGRYDLVRF+KT+Q+ GLY HLRIGPY+C EW
Sbjct  65   KAKGGGLDAIDTYVFWNVHEPSPGIYNFEGRYDLVRFIKTVQRVGLYVHLRIGPYVCAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>gb|KHN12675.1| Beta-galactosidase 5 [Glycine soja]
Length=732

 Score =   210 bits (535),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  308  SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFW  487
            S L  CSV+YDRKAI+INGQRR+L SGSIHYPRST EMWEDLI KAK+GG+DVI+TYVFW
Sbjct  21   SELIHCSVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIGKAKDGGLDVIDTYVFW  80

Query  488  NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            NVHEPSPGNYNFEGRYDLVRF+KT+Q+ GLY HLRIGPY+C EWNFGGFPV
Sbjct  81   NVHEPSPGNYNFEGRYDLVRFIKTVQRVGLYVHLRIGPYVCAEWNFGGFPV  131



>ref|XP_009145073.1| PREDICTED: beta-galactosidase 3 [Brassica rapa]
Length=856

 Score =   211 bits (537),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +2

Query  254  GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWED  430
            G    + +L LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST +MWE 
Sbjct  7    GDTAPRLILWLCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  431  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  610
            LI KAK+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  67   LIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  126

Query  611  GEWNFGGFPV  640
             EWNFGGFPV
Sbjct  127  AEWNFGGFPV  136



>ref|XP_007199661.1| hypothetical protein PRUPE_ppa001363mg [Prunus persica]
 gb|EMJ00860.1| hypothetical protein PRUPE_ppa001363mg [Prunus persica]
Length=844

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = +2

Query  254  GGAMRKWVLVL-CMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWE  427
            G A   W  VL C+V++ LS  L QC+V YDRKA++I+GQRR+LFSGSIHYPRST EMWE
Sbjct  2    GAASSAWSWVLLCIVWWSLSLELAQCNVVYDRKALIIDGQRRILFSGSIHYPRSTPEMWE  61

Query  428  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  607
             LI KAK+GG+D I+TYVFWN+HEPSPGNYNFEGRYDL RF+KT+ KAGLY HLRIGPYI
Sbjct  62   GLIQKAKDGGLDAIDTYVFWNLHEPSPGNYNFEGRYDLARFIKTVHKAGLYVHLRIGPYI  121

Query  608  CGEWNFGGFPV  640
            C EWNFGGFPV
Sbjct  122  CSEWNFGGFPV  132



>ref|XP_007042083.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
 gb|EOX97914.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
Length=730

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 110/129 (85%), Gaps = 1/129 (1%)
 Frame = +2

Query  257  GAMRKWVLVLCMVF-FLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDL  433
            GA       LC+   FLS  +TQCSVSYDRKA++I+GQRR+L SGSIHYPRST +MWE L
Sbjct  2    GATSASQFFLCIAMVFLSVKVTQCSVSYDRKALIIDGQRRILLSGSIHYPRSTPQMWEGL  61

Query  434  ISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICG  613
            I KAK+GG+D I+TYVFWN+HEPSPGNYNFEGRYDLVRF+K ++KAGLY +LRIGPYICG
Sbjct  62   IQKAKDGGLDAIDTYVFWNLHEPSPGNYNFEGRYDLVRFIKLVKKAGLYVNLRIGPYICG  121

Query  614  EWNFGGFPV  640
            EWNFGGFPV
Sbjct  122  EWNFGGFPV  130



>ref|XP_004509327.1| PREDICTED: beta-galactosidase 3-like [Cicer arietinum]
Length=851

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +2

Query  302  LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYV  481
            L S +   +V+YDRKAI+INGQRR+LFSGSIHYPRST +MWEDLI KAKEGG+DVIETYV
Sbjct  19   LVSHIIHSTVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIQKAKEGGLDVIETYV  78

Query  482  FWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            FWNVHEPSPGN+NFEGRYDLV+F+KTIQKAGLYAHLRIGPY+C EWNFGGFPV
Sbjct  79   FWNVHEPSPGNFNFEGRYDLVKFIKTIQKAGLYAHLRIGPYVCAEWNFGGFPV  131



>ref|XP_008337843.1| PREDICTED: beta-galactosidase 3 [Malus domestica]
 ref|XP_008363095.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
Length=853

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  314  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNV  493
            L  C+V+YDRKAIVINGQRR+L SGSIHYPRST EMWEDLI KAKEGG+DV+ETYVFWNV
Sbjct  23   LVHCTVTYDRKAIVINGQRRILISGSIHYPRSTPEMWEDLIQKAKEGGLDVVETYVFWNV  82

Query  494  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            HEP+PGNYNFEGRYDLVRF+KTIQ AGLYAHLRIGPY+C EWN GGFPV
Sbjct  83   HEPTPGNYNFEGRYDLVRFLKTIQNAGLYAHLRIGPYVCAEWNNGGFPV  131



>ref|XP_008236954.1| PREDICTED: beta-galactosidase 3-like [Prunus mume]
Length=844

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 110/124 (89%), Gaps = 2/124 (2%)
 Frame = +2

Query  272  WVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAK  448
            WVL LC+V++ LS  L QC+V YDRKA++I+GQRR+LFSGSIHYPRST EMWE LI KAK
Sbjct  10   WVL-LCIVWWSLSLELAQCNVVYDRKALIIDGQRRILFSGSIHYPRSTPEMWEGLIQKAK  68

Query  449  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  628
            +GG+D I+TYVFWN+HEPSPGNYNFEGRYDL RF+KT+ KAGLY HLRIGPYIC EWNFG
Sbjct  69   DGGLDAIDTYVFWNLHEPSPGNYNFEGRYDLARFIKTVHKAGLYVHLRIGPYICSEWNFG  128

Query  629  GFPV  640
            GFPV
Sbjct  129  GFPV  132



>emb|CDX75569.1| BnaA01g01330D [Brassica napus]
Length=827

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 107/123 (87%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  VLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKE  451
            +L LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST +MWE LI KAK+
Sbjct  14   ILWLCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEGLIQKAKD  73

Query  452  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  631
            GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C EWNFGG
Sbjct  74   GGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVCAEWNFGG  133

Query  632  FPV  640
            FPV
Sbjct  134  FPV  136



>ref|XP_007156097.1| hypothetical protein PHAVU_003G258300g [Phaseolus vulgaris]
 gb|ESW28091.1| hypothetical protein PHAVU_003G258300g [Phaseolus vulgaris]
Length=847

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = +2

Query  326  SVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHEPS  505
            +V+YDRKAI+INGQRR+LFSGSIHYPRST +MWEDLI KAKEGG+DV+ETYVFWNVHEPS
Sbjct  25   AVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIFKAKEGGLDVVETYVFWNVHEPS  84

Query  506  PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFPV
Sbjct  85   PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPV  129



>ref|XP_009603021.1| PREDICTED: beta-galactosidase 5 [Nicotiana tomentosiformis]
Length=729

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWE  427
            +   ++ K+ +V      + + L  C V+YD+KAI+INGQRR+L SGSIHYPRST EMWE
Sbjct  1    METSSISKFFIVYAFSLLMVAQLICCKVTYDKKAIIINGQRRILLSGSIHYPRSTPEMWE  60

Query  428  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  607
            DLI KAK+  +DVIETYVFWN+HEPSPGNY+FEGRYDLVRF+KT+QKAGLYAHLRIGPY+
Sbjct  61   DLIKKAKDANLDVIETYVFWNIHEPSPGNYDFEGRYDLVRFIKTVQKAGLYAHLRIGPYV  120

Query  608  CGEWNFGGFPV  640
            C EWNFGGFPV
Sbjct  121  CAEWNFGGFPV  131



>ref|XP_004512085.1| PREDICTED: beta-galactosidase 3-like [Cicer arietinum]
Length=847

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +2

Query  329  VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHEPSP  508
            V+YDRKAI+INGQRR+LFSGSIHYPRST +MWEDLI KAKEGG+DVIETYVFWNVHEPSP
Sbjct  26   VTYDRKAIIINGQRRILFSGSIHYPRSTPDMWEDLIQKAKEGGLDVIETYVFWNVHEPSP  85

Query  509  GNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            GNYNFEGR DLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFPV
Sbjct  86   GNYNFEGRNDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPV  129



>gb|KHN00504.1| Beta-galactosidase 3 [Glycine soja]
Length=848

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +2

Query  329  VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHEPSP  508
            V+YDRKA++INGQRR+LFSGSIHYPRST +MWEDLI KAKEGG+DV+ETYVFWNVHEPSP
Sbjct  27   VTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLILKAKEGGIDVVETYVFWNVHEPSP  86

Query  509  GNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            GNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFPV
Sbjct  87   GNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPV  130



>gb|KJB63588.1| hypothetical protein B456_010G007300 [Gossypium raimondii]
Length=586

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            ++ K++       F+S  L  C+++YD+K+IVINGQRR+L SGSIHYPRST +MWE LI 
Sbjct  5    SVPKFIFFFITAMFMSFNLIHCTITYDKKSIVINGQRRILISGSIHYPRSTPDMWESLIK  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EW
Sbjct  65   KAKNGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKMGLYVHLRIGPYVCAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>ref|XP_009107461.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Brassica rapa]
 ref|XP_009107462.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Brassica rapa]
Length=729

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 108/128 (84%), Gaps = 5/128 (4%)
 Frame = +2

Query  272  WVLVLCMVFFLS-----SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLI  436
            WVL   + FFL+     S + QCSV+YD+KAIV+NG RR+L SGSIHYPRST EMWEDLI
Sbjct  5    WVLSKIVTFFLTAMLIGSSIIQCSVTYDKKAIVVNGHRRILLSGSIHYPRSTPEMWEDLI  64

Query  437  SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  616
             KAK+GG+DVI+TYVFWN HEPSPG YNFEGRYDLVRF+KT+Q+ GLY HLRIGPY+C E
Sbjct  65   KKAKDGGLDVIDTYVFWNGHEPSPGIYNFEGRYDLVRFIKTVQEVGLYVHLRIGPYVCAE  124

Query  617  WNFGGFPV  640
            WNFGGFPV
Sbjct  125  WNFGGFPV  132



>ref|XP_010552493.1| PREDICTED: beta-galactosidase 5 [Tarenaya hassleriana]
Length=731

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +2

Query  263  MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISK  442
            + K +  L     +SS + QC V+YD+K+IVING+RR+L SGSIHYPRST EMWEDLI+K
Sbjct  6    VSKILTFLLTTILVSSAVIQCGVTYDKKSIVINGRRRILLSGSIHYPRSTPEMWEDLITK  65

Query  443  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  622
            AK+GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+Q+ GLY HLRIGPY+C EWN
Sbjct  66   AKDGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQRVGLYVHLRIGPYVCAEWN  125

Query  623  FGGFPV  640
            FGGFPV
Sbjct  126  FGGFPV  131



>emb|CDX69219.1| BnaC01g02340D [Brassica napus]
Length=824

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 108/130 (83%), Gaps = 1/130 (1%)
 Frame = +2

Query  254  GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWED  430
            G    + +L LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST +MWE 
Sbjct  4    GDTAPRLILWLCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  63

Query  431  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  610
            LI KAK+GGVDVIETYVFWN+HEPSPG Y+ EGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  64   LIQKAKDGGVDVIETYVFWNLHEPSPGKYDLEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  123

Query  611  GEWNFGGFPV  640
             EWNFGGFPV
Sbjct  124  AEWNFGGFPV  133



>gb|KDO84692.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=637

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLI  436
            ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRST EMWEDLI
Sbjct  5    SVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMWEDLI  64

Query  437  SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  616
             KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY+C E
Sbjct  65   RKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPYVCAE  124

Query  617  WNFGGFPV  640
            WNFGGFPV
Sbjct  125  WNFGGFPV  132



>ref|XP_006412010.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
 gb|ESQ53463.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
Length=626

 Score =   207 bits (526),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 108/130 (83%), Gaps = 1/130 (1%)
 Frame = +2

Query  254  GGAMRKWVLVLCM-VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWED  430
            G +  + +L  C+ +  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST +MWE 
Sbjct  7    GDSASRLILWCCLGLLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  431  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  610
            LI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVK I KAGLYAHLRIGPY+C
Sbjct  67   LIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKAIHKAGLYAHLRIGPYVC  126

Query  611  GEWNFGGFPV  640
             EWNFGGFPV
Sbjct  127  AEWNFGGFPV  136



>dbj|BAF31234.1| beta-D-galactosidase [Persea americana]
Length=849

 Score =   209 bits (531),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  314  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNV  493
            L QCSV+YDRKAI+INGQR++L SGSIHYPRST +MWE L+ KAK+GG+DVI+TYVFWNV
Sbjct  25   LIQCSVTYDRKAIIINGQRKILISGSIHYPRSTPDMWEGLMQKAKDGGLDVIQTYVFWNV  84

Query  494  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            HEPSPGNYNFEGRYDLVRFVKT+QKAGLY HLRIGPY+C EWNFGGFPV
Sbjct  85   HEPSPGNYNFEGRYDLVRFVKTVQKAGLYMHLRIGPYVCAEWNFGGFPV  133



>ref|XP_010315322.1| PREDICTED: beta-galactosidase 3-like [Solanum lycopersicum]
Length=727

 Score =   208 bits (529),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 110/128 (86%), Gaps = 1/128 (1%)
 Frame = +2

Query  257  GAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLI  436
            G   KW L+  ++ F  S +  CSVSYD+K+++INGQR++LFSGS+HYPRST +MWE +I
Sbjct  2    GINTKWFLIFFVLIF-GSKICYCSVSYDKKSLIINGQRKILFSGSVHYPRSTPDMWEGII  60

Query  437  SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  616
             KAK+GG+DVIETYVFWN+HEPSPGNYNFEGR DLVRF+K IQKAGLY HLRIGPYICGE
Sbjct  61   QKAKDGGLDVIETYVFWNLHEPSPGNYNFEGRNDLVRFIKLIQKAGLYMHLRIGPYICGE  120

Query  617  WNFGGFPV  640
            WNFGGFPV
Sbjct  121  WNFGGFPV  128



>ref|XP_003589339.1| Beta-galactosidase [Medicago truncatula]
 gb|AES59590.1| beta-like galactosidase [Medicago truncatula]
Length=745

 Score =   207 bits (528),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  308  SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFW  487
            S +  C+V+YDRKAI+INGQRR+L SGSIHYPRST EMWEDLI KAK+GG+DVI+TYVFW
Sbjct  22   SEVIHCTVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIQKAKDGGLDVIDTYVFW  81

Query  488  NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            NVHEPSPGNYNFEGRYDLV+F+KT+QK GLY HLRIGPY+C EWNFGGFPV
Sbjct  82   NVHEPSPGNYNFEGRYDLVQFIKTVQKKGLYVHLRIGPYVCAEWNFGGFPV  132



>ref|NP_001265904.1| beta-galactosidase 5-like precursor [Cicer arietinum]
 emb|CAA10128.1| beta-galactosidase [Cicer arietinum]
Length=745

 Score =   207 bits (528),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  302  LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYV  481
            + S L  CSV+YDRKAI+INGQRR+L SGSIHYPRST EMWEDLI KAK GG+DVI+TYV
Sbjct  19   VCSQLIHCSVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIQKAKVGGLDVIDTYV  78

Query  482  FWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            FWNVHEPSP NYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPV
Sbjct  79   FWNVHEPSPSNYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPV  131



>ref|XP_002867020.1| hypothetical protein ARALYDRAFT_491000 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43279.1| hypothetical protein ARALYDRAFT_491000 [Arabidopsis lyrata subsp. 
lyrata]
Length=853

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +2

Query  254  GGAMRKWVLVLCM-VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWED  430
            G +  + +L  C+ +  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST +MWE 
Sbjct  4    GDSASRLILWFCLGLLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  63

Query  431  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  610
            LI KAK+GG+DVIETYVFWN+HEP+PG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  64   LIQKAKDGGIDVIETYVFWNLHEPTPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  123

Query  611  GEWNFGGFPV  640
             EWNFGGFPV
Sbjct  124  AEWNFGGFPV  133



>gb|KJB63586.1| hypothetical protein B456_010G007300 [Gossypium raimondii]
Length=538

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            ++ K++       F+S  L  C+++YD+K+IVINGQRR+L SGSIHYPRST +MWE LI 
Sbjct  5    SVPKFIFFFITAMFMSFNLIHCTITYDKKSIVINGQRRILISGSIHYPRSTPDMWESLIK  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EW
Sbjct  65   KAKNGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKMGLYVHLRIGPYVCAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>ref|XP_006342225.1| PREDICTED: beta-galactosidase 3-like [Solanum tuberosum]
Length=729

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +2

Query  263  MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISK  442
            + K++ V      +   L  C V+YD+KAI+INGQRR+L SGSIHYPRST EMWEDLI+K
Sbjct  6    VSKFLKVYTFYLLMVVQLVFCIVTYDKKAIIINGQRRILLSGSIHYPRSTPEMWEDLINK  65

Query  443  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  622
            AK+  +DVIETYVFWNVHEPSPGNYNF+GRYDLVRF+KT+QKAGLYAHLRIGPY+C EWN
Sbjct  66   AKDANLDVIETYVFWNVHEPSPGNYNFDGRYDLVRFIKTVQKAGLYAHLRIGPYVCAEWN  125

Query  623  FGGFPV  640
            FGGFPV
Sbjct  126  FGGFPV  131



>ref|XP_011048837.1| PREDICTED: beta-galactosidase 5 [Populus euphratica]
Length=853

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            ++ K++ +  MV  + S L  C+V+YD+KAI+I+G RR+L SGSIHYPRST +MWEDL+ 
Sbjct  5    SVSKFLTLFLMVLIVGSKLIHCTVTYDKKAIIIDGHRRILISGSIHYPRSTPDMWEDLVR  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK GG+DVI+TYVFWNVHEPSPGNYNFEGR+DLVRF+KT+QK GLY HLRIGPY+C EW
Sbjct  65   KAKHGGLDVIDTYVFWNVHEPSPGNYNFEGRFDLVRFIKTVQKEGLYVHLRIGPYVCAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>gb|KHN20946.1| Beta-galactosidase 5 [Glycine soja]
Length=732

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  308  SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFW  487
            S L  CSV+YDRKAI+INGQRR+L SGSIHYPRST EMWEDLI KAK+GG+DVI+TYVFW
Sbjct  21   SELIHCSVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIRKAKDGGLDVIDTYVFW  80

Query  488  NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            NVHEPSPGNYNFEGR DLVRF+KT+Q+ GLY HLRIGPY+C EWNFGGFPV
Sbjct  81   NVHEPSPGNYNFEGRNDLVRFIKTVQRVGLYVHLRIGPYVCAEWNFGGFPV  131



>ref|XP_011083609.1| PREDICTED: beta-galactosidase 3-like [Sesamum indicum]
Length=845

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            +L  C+   + S L   SV+YD KA++INGQRR+L SGSIHYPRST +MWEDLI KAK  
Sbjct  10   ILFFCIFLVMGSQLISGSVTYDNKAVIINGQRRILLSGSIHYPRSTPDMWEDLILKAKNA  69

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DVI+TYVFWNVHEPSPGNYNFEGRYDLVRFVKT+QK GLY HLRIGPY+C EWNFGGF
Sbjct  70   GLDVIDTYVFWNVHEPSPGNYNFEGRYDLVRFVKTVQKLGLYVHLRIGPYVCAEWNFGGF  129

Query  635  PV  640
            PV
Sbjct  130  PV  131



>gb|KCW64027.1| hypothetical protein EUGRSUZ_G01704 [Eucalyptus grandis]
Length=558

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 2/125 (2%)
 Frame = +2

Query  269  KWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKA  445
            KW L  C++   +  LT CS V+YD KA++INGQRR+LFSGSIHYPRST +MWE L+ KA
Sbjct  9    KWFLP-CVLLCATLSLTHCSSVTYDGKALIINGQRRILFSGSIHYPRSTPQMWEGLVHKA  67

Query  446  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  625
            KEGG+DV++TYVFWNVHEPSPGNYNFEG+YDLV+FVKT+QKAGLY HLRIGPY+C EWNF
Sbjct  68   KEGGLDVVDTYVFWNVHEPSPGNYNFEGQYDLVQFVKTVQKAGLYVHLRIGPYVCAEWNF  127

Query  626  GGFPV  640
            GG PV
Sbjct  128  GGLPV  132



>gb|KJB32548.1| hypothetical protein B456_005G246600 [Gossypium raimondii]
 gb|KJB32550.1| hypothetical protein B456_005G246600 [Gossypium raimondii]
Length=579

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  293  VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIE  472
            + FL   L  C+V+YDRKAI I+GQ+R+LFSGSIHYPRST EMWE LI KAK GG+DVI+
Sbjct  16   ILFLYLLLVHCNVTYDRKAIAIDGQKRILFSGSIHYPRSTPEMWEGLIQKAKNGGLDVID  75

Query  473  TYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            TYVFWN+HEPSPGNYNFEGRYDLV+F+K ++KAGLY HLRIGPYICGEWNFGGFPV
Sbjct  76   TYVFWNLHEPSPGNYNFEGRYDLVQFIKLVKKAGLYVHLRIGPYICGEWNFGGFPV  131



>dbj|BAD91085.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=848

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 2/125 (2%)
 Frame = +2

Query  272  WVLVLCMVFFLSS--GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKA  445
            WVL+ C + + S    +T+C+V YDRKA+VI+GQRR+LFSGSIHYPRST EMWE LI KA
Sbjct  10   WVLLCCCIVWSSVYVEVTKCNVVYDRKALVIDGQRRLLFSGSIHYPRSTPEMWEGLIQKA  69

Query  446  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  625
            K+GG+D I+TYVFWN+HEPSPGNYNFEGR DLVRF+KT+ KAGLY HLRIGPYIC EWNF
Sbjct  70   KDGGLDAIDTYVFWNLHEPSPGNYNFEGRNDLVRFIKTVHKAGLYVHLRIGPYICSEWNF  129

Query  626  GGFPV  640
            GGFPV
Sbjct  130  GGFPV  134



>ref|XP_010531064.1| PREDICTED: beta-galactosidase 3 [Tarenaya hassleriana]
Length=855

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = +2

Query  236  LREKLRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTL  415
            + E   G  +R +V  L     L S + QCSV+YDRKA+VINGQRR+LFSGSIHYPRST 
Sbjct  1    MGEMGAGFTVRMFVWFLLGFLLLGSEIVQCSVTYDRKALVINGQRRILFSGSIHYPRSTP  60

Query  416  EMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRI  595
            +MWE LI KAK+GG+DVIETYVFWN+HEP+PG Y+FEGR DLVRFVKT+QKAGLYAHLRI
Sbjct  61   DMWEGLIQKAKDGGIDVIETYVFWNLHEPTPGKYDFEGRNDLVRFVKTVQKAGLYAHLRI  120

Query  596  GPYICGEWNFGGFPV  640
            GPY+C EWNFGGFPV
Sbjct  121  GPYVCAEWNFGGFPV  135



>ref|XP_006362025.1| PREDICTED: beta-galactosidase 3-like [Solanum tuberosum]
Length=727

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 109/124 (88%), Gaps = 1/124 (1%)
 Frame = +2

Query  269  KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAK  448
            KW L+  ++ F  S +  CSV+YD+K+++INGQR++LFSGS+HYPRST +MWE +I KAK
Sbjct  6    KWFLIFFVLIF-GSKICYCSVTYDKKSLIINGQRKILFSGSVHYPRSTPDMWEGIIQKAK  64

Query  449  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  628
            +GG+DVIETYVFWN+HEPSPGNYNFEGR DLVRF+K IQKAGLY HLRIGPYICGEWNFG
Sbjct  65   DGGLDVIETYVFWNLHEPSPGNYNFEGRNDLVRFIKLIQKAGLYMHLRIGPYICGEWNFG  124

Query  629  GFPV  640
            GFPV
Sbjct  125  GFPV  128



>ref|XP_009614464.1| PREDICTED: beta-galactosidase 3-like [Nicotiana tomentosiformis]
Length=727

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  269  KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAK  448
            KW L+  ++    +    CSV+YD+K+++INGQR++LFSGSIHYPRST +MWE +I KAK
Sbjct  4    KWFLLCSLLLIFVTEFGYCSVTYDKKSLIINGQRKILFSGSIHYPRSTPDMWEGIIQKAK  63

Query  449  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  628
            +GG+DVIETYVFWN+HEPSPGNYNFEGR DLVRF+K +QKAGLY HLRIGPYICGEWNFG
Sbjct  64   DGGLDVIETYVFWNLHEPSPGNYNFEGRNDLVRFIKLVQKAGLYMHLRIGPYICGEWNFG  123

Query  629  GFPV  640
            GFPV
Sbjct  124  GFPV  127



>dbj|BAJ34544.1| unnamed protein product [Thellungiella halophila]
Length=856

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 108/130 (83%), Gaps = 1/130 (1%)
 Frame = +2

Query  254  GGAMRKWVLVLCM-VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWED  430
            G +  + +L  C+ +  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST +MWE 
Sbjct  7    GDSASRLILWCCLGLLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  431  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  610
            LI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVK I KAGLYAHLRIGPY+C
Sbjct  67   LIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKAIHKAGLYAHLRIGPYVC  126

Query  611  GEWNFGGFPV  640
             EWNFGGFPV
Sbjct  127  AEWNFGGFPV  136



>ref|XP_006412011.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
 gb|ESQ53464.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
Length=856

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 108/130 (83%), Gaps = 1/130 (1%)
 Frame = +2

Query  254  GGAMRKWVLVLCM-VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWED  430
            G +  + +L  C+ +  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST +MWE 
Sbjct  7    GDSASRLILWCCLGLLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  431  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  610
            LI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVK I KAGLYAHLRIGPY+C
Sbjct  67   LIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKAIHKAGLYAHLRIGPYVC  126

Query  611  GEWNFGGFPV  640
             EWNFGGFPV
Sbjct  127  AEWNFGGFPV  136



>gb|KDO84689.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=805

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLI  436
            ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRST EMWEDLI
Sbjct  5    SVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMWEDLI  64

Query  437  SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  616
             KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY+C E
Sbjct  65   RKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPYVCAE  124

Query  617  WNFGGFPV  640
            WNFGGFPV
Sbjct  125  WNFGGFPV  132



>gb|KDO84691.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=731

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLI  436
            ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRST EMWEDLI
Sbjct  5    SVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMWEDLI  64

Query  437  SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  616
             KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY+C E
Sbjct  65   RKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPYVCAE  124

Query  617  WNFGGFPV  640
            WNFGGFPV
Sbjct  125  WNFGGFPV  132



>gb|KDO84690.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=809

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLI  436
            ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRST EMWEDLI
Sbjct  5    SVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMWEDLI  64

Query  437  SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  616
             KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY+C E
Sbjct  65   RKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPYVCAE  124

Query  617  WNFGGFPV  640
            WNFGGFPV
Sbjct  125  WNFGGFPV  132



>gb|KDO84688.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=850

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLI  436
            ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRST EMWEDLI
Sbjct  5    SVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMWEDLI  64

Query  437  SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  616
             KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY+C E
Sbjct  65   RKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPYVCAE  124

Query  617  WNFGGFPV  640
            WNFGGFPV
Sbjct  125  WNFGGFPV  132



>ref|XP_006473573.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
Length=850

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLI  436
            ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRST EMWEDLI
Sbjct  5    SVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMWEDLI  64

Query  437  SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  616
             KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY+C E
Sbjct  65   RKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPYVCAE  124

Query  617  WNFGGFPV  640
            WNFGGFPV
Sbjct  125  WNFGGFPV  132



>gb|KFK30264.1| hypothetical protein AALP_AA7G238600 [Arabis alpina]
Length=849

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  311  GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWN  490
            G  QCSV+YDRKA++INGQRR+LFSGSIHYPRST +MWE LI KAK+GGVDVIETYVFWN
Sbjct  20   GFVQCSVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGVDVIETYVFWN  79

Query  491  VHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            +HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C EWNFGGFPV
Sbjct  80   LHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVCAEWNFGGFPV  129



>ref|XP_006435076.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
 gb|ESR48316.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
Length=850

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLI  436
            ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRST EMWEDLI
Sbjct  5    SVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMWEDLI  64

Query  437  SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  616
             KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY+C E
Sbjct  65   RKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPYVCAE  124

Query  617  WNFGGFPV  640
            WNFGGFPV
Sbjct  125  WNFGGFPV  132



>gb|KJB63587.1| hypothetical protein B456_010G007300 [Gossypium raimondii]
Length=732

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            ++ K++       F+S  L  C+++YD+K+IVINGQRR+L SGSIHYPRST +MWE LI 
Sbjct  5    SVPKFIFFFITAMFMSFNLIHCTITYDKKSIVINGQRRILISGSIHYPRSTPDMWESLIK  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EW
Sbjct  65   KAKNGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKMGLYVHLRIGPYVCAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>ref|XP_010110010.1| Beta-galactosidase 3 [Morus notabilis]
 gb|EXC25028.1| Beta-galactosidase 3 [Morus notabilis]
Length=821

 Score =   206 bits (525),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  314  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNV  493
            L  C+VSYDRKA++INGQRR+L SGSIHYPRST EMWEDLI KAK+GG+DVI+TYVFWNV
Sbjct  23   LMNCTVSYDRKALLINGQRRILISGSIHYPRSTPEMWEDLIQKAKDGGLDVIDTYVFWNV  82

Query  494  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            HEPSPG YNF+GRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPV
Sbjct  83   HEPSPGKYNFDGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPV  131



>gb|KJB63585.1| hypothetical protein B456_010G007300 [Gossypium raimondii]
Length=734

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            ++ K++       F+S  L  C+++YD+K+IVINGQRR+L SGSIHYPRST +MWE LI 
Sbjct  5    SVPKFIFFFITAMFMSFNLIHCTITYDKKSIVINGQRRILISGSIHYPRSTPDMWESLIK  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EW
Sbjct  65   KAKNGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKMGLYVHLRIGPYVCAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>ref|XP_004238611.1| PREDICTED: beta-galactosidase 5 [Solanum lycopersicum]
Length=729

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +2

Query  263  MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISK  442
            + K++ V      +   L  C V+YD+KAI+INGQRR+L SGSIHYPRST EMW+DLI+K
Sbjct  6    VSKFLKVYIFSLLMVVQLVFCIVTYDKKAIIINGQRRILLSGSIHYPRSTPEMWQDLINK  65

Query  443  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  622
            AK+  +DVIETYVFWNVHEPSPGNYNF+GRYDLVRF+KT+QKAGLYAHLRIGPY+C EWN
Sbjct  66   AKDANLDVIETYVFWNVHEPSPGNYNFDGRYDLVRFIKTVQKAGLYAHLRIGPYVCAEWN  125

Query  623  FGGFPV  640
            FGGFPV
Sbjct  126  FGGFPV  131



>ref|XP_006487343.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
Length=719

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +2

Query  278  LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGG  457
            + + +V  L   LT  SV+YD KA++INGQRR+LFSGSIHYPRS+ EMWE LI KAK+GG
Sbjct  10   IFMSIVLSLCLHLTLSSVTYDNKALIINGQRRILFSGSIHYPRSSHEMWEGLIQKAKDGG  69

Query  458  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  637
            +DVI+TYVFWNVHEPSPGNYNFEGRYDLVRF+K +QKAGLY HLRIGPYIC EWNFGGFP
Sbjct  70   LDVIDTYVFWNVHEPSPGNYNFEGRYDLVRFIKLVQKAGLYVHLRIGPYICAEWNFGGFP  129

Query  638  V  640
            V
Sbjct  130  V  130



>ref|XP_009777047.1| PREDICTED: beta-galactosidase 3-like [Nicotiana sylvestris]
Length=726

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 109/124 (88%), Gaps = 1/124 (1%)
 Frame = +2

Query  269  KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAK  448
            KW+L+  ++ F S     CSV+YD+K+++INGQR++LFSGSIHYPRST +MWE +I KAK
Sbjct  4    KWLLLFFVLIFASE-FGYCSVTYDKKSLIINGQRKILFSGSIHYPRSTPDMWEGIIQKAK  62

Query  449  EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  628
            +GG+DVIETYVFWN+HEPSPGNYNFEGR DLVRF+K +QKAGLY HLRIGPYICGEWNFG
Sbjct  63   DGGLDVIETYVFWNLHEPSPGNYNFEGRNDLVRFIKLVQKAGLYMHLRIGPYICGEWNFG  122

Query  629  GFPV  640
            GFPV
Sbjct  123  GFPV  126



>ref|XP_006393673.1| hypothetical protein EUTSA_v10011265mg [Eutrema salsugineum]
 gb|ESQ30959.1| hypothetical protein EUTSA_v10011265mg [Eutrema salsugineum]
Length=726

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  263  MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISK  442
            + K +  L     + S + QCSV+YD+KAIVING RR+L SGSIHYPRST EMWEDLI K
Sbjct  3    LSKILSFLLTTMLIGSAMIQCSVTYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIKK  62

Query  443  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  622
            AK+GG+DVI+TYVFWN HEPSPG YNF+GRYDLVRF+KT+Q+ GLY HLRIGPY+C EWN
Sbjct  63   AKDGGLDVIDTYVFWNGHEPSPGTYNFKGRYDLVRFIKTVQEVGLYVHLRIGPYVCAEWN  122

Query  623  FGGFPV  640
            FGGFPV
Sbjct  123  FGGFPV  128



>ref|XP_009129554.1| PREDICTED: beta-galactosidase 5 [Brassica rapa]
Length=730

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +2

Query  263  MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISK  442
            + K +  L +   + S + QCS++YD+KAIVING RR+L SGSIHYPRST EMWEDLI K
Sbjct  7    LTKILCFLLITMVIGSAMIQCSITYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIKK  66

Query  443  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  622
            AK+GG+DVI+TYVFWN HEPSPG YNF+GRYDLVRF+KT+Q+ GLY HLRIGPY+C EWN
Sbjct  67   AKDGGLDVIDTYVFWNGHEPSPGTYNFKGRYDLVRFIKTVQEVGLYVHLRIGPYVCAEWN  126

Query  623  FGGFPV  640
            FGGFPV
Sbjct  127  FGGFPV  132



>ref|XP_006423393.1| hypothetical protein CICLE_v10030257mg, partial [Citrus clementina]
 gb|ESR36633.1| hypothetical protein CICLE_v10030257mg, partial [Citrus clementina]
Length=728

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +2

Query  278  LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGG  457
            + + +V  L   LT  SV+YD KA++INGQRR+LFSGSIHYPRS+ EMWE LI KAK+GG
Sbjct  10   IFMSIVLSLCLHLTLSSVTYDSKALIINGQRRILFSGSIHYPRSSHEMWEGLIQKAKDGG  69

Query  458  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  637
            +DVI+TYVFWNVHEPSPGNYNFEGRYDLVRF+K +QKAGLY HLRIGPYIC EWNFGGFP
Sbjct  70   LDVIDTYVFWNVHEPSPGNYNFEGRYDLVRFIKLVQKAGLYVHLRIGPYICAEWNFGGFP  129

Query  638  V  640
            V
Sbjct  130  V  130



>gb|KHG11061.1| Beta-galactosidase 5 -like protein [Gossypium arboreum]
Length=734

 Score =   205 bits (522),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  260  AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            ++ K++       F+S  L  C+++YD+K+IVINGQRR+L SGSIHYPRST +MWE LI 
Sbjct  5    SVPKFIFFFITAMFMSFNLIHCTITYDKKSIVINGQRRILISGSIHYPRSTPDMWESLIK  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK GG+DVI+TY+FWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EW
Sbjct  65   KAKNGGLDVIDTYIFWNGHEPSPGNYNFEGRYDLVRFIKTVQKLGLYVHLRIGPYVCAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>ref|XP_010066194.1| PREDICTED: beta-galactosidase 5-like isoform X3 [Eucalyptus grandis]
Length=699

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 2/125 (2%)
 Frame = +2

Query  269  KWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKA  445
            KW L  C++   +  LT CS V+YD KA++INGQRR+LFSGSIHYPRST +MWE L+ KA
Sbjct  9    KWFLP-CVLLCATLSLTHCSSVTYDGKALIINGQRRILFSGSIHYPRSTPQMWEGLVHKA  67

Query  446  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  625
            KEGG+DV++TYVFWNVHEPSPGNYNFEG+YDLV+FVKT+QKAGLY HLRIGPY+C EWNF
Sbjct  68   KEGGLDVVDTYVFWNVHEPSPGNYNFEGQYDLVQFVKTVQKAGLYVHLRIGPYVCAEWNF  127

Query  626  GGFPV  640
            GG PV
Sbjct  128  GGLPV  132



>gb|AGR44466.1| beta-D-galactosidase 7 [Pyrus x bretschneideri]
Length=852

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 107/123 (87%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKE  451
            VL L M  F++S L  C+ V+YD+KAI+INGQRR+L SGSIHYPRST EMWE LI KAK+
Sbjct  11   VLFLTMTLFMASELIHCTTVTYDKKAILINGQRRLLISGSIHYPRSTPEMWEGLIQKAKD  70

Query  452  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  631
            GG+DVI+TYVFWN HEPSPGNY FEGRYDLVRF+KT+QKAGL+ HLRIGPY+C EWNFGG
Sbjct  71   GGLDVIDTYVFWNGHEPSPGNYYFEGRYDLVRFIKTVQKAGLFLHLRIGPYVCAEWNFGG  130

Query  632  FPV  640
            FPV
Sbjct  131  FPV  133



>gb|KJB32549.1| hypothetical protein B456_005G246600 [Gossypium raimondii]
Length=693

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  293  VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIE  472
            + FL   L  C+V+YDRKAI I+GQ+R+LFSGSIHYPRST EMWE LI KAK GG+DVI+
Sbjct  16   ILFLYLLLVHCNVTYDRKAIAIDGQKRILFSGSIHYPRSTPEMWEGLIQKAKNGGLDVID  75

Query  473  TYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            TYVFWN+HEPSPGNYNFEGRYDLV+F+K ++KAGLY HLRIGPYICGEWNFGGFPV
Sbjct  76   TYVFWNLHEPSPGNYNFEGRYDLVQFIKLVKKAGLYVHLRIGPYICGEWNFGGFPV  131



>ref|XP_008377189.1| PREDICTED: beta-galactosidase 5-like [Malus domestica]
Length=852

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 107/123 (87%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKE  451
            VL L M  F++S L  C+ V+YD+KAI+INGQRR+L SGSIHYPRST EMWE LI KAK+
Sbjct  11   VLFLTMTLFIASELIHCTTVTYDKKAILINGQRRLLISGSIHYPRSTPEMWEGLIQKAKD  70

Query  452  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  631
            GG+DVI+TYVFWN HEPSPGNY FEGRYDLVRF+KT+QKAGL+ HLRIGPY+C EWNFGG
Sbjct  71   GGLDVIDTYVFWNGHEPSPGNYYFEGRYDLVRFIKTVQKAGLFLHLRIGPYVCAEWNFGG  130

Query  632  FPV  640
            FPV
Sbjct  131  FPV  133



>ref|XP_008221339.1| PREDICTED: beta-galactosidase 5 [Prunus mume]
Length=851

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 1/114 (1%)
 Frame = +2

Query  302  LSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETY  478
            +SS L QC+ V+YD+KAI+INGQRR+L SGSIHYPRST EMWE LI KAK+GG+DVI+TY
Sbjct  19   ISSELIQCTTVTYDKKAIIINGQRRLLISGSIHYPRSTPEMWEGLIQKAKDGGLDVIDTY  78

Query  479  VFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            VFWN HEPSPGNYNFEGRYDLVRF+KT+QKAGLY HLRIGPY+C EWNFGGFPV
Sbjct  79   VFWNGHEPSPGNYNFEGRYDLVRFIKTVQKAGLYLHLRIGPYVCAEWNFGGFPV  132



>dbj|BAD91084.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=852

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 107/123 (87%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKE  451
            VL L M  F++S L  C+ V+YD+KAI+INGQRR+L SGSIHYPRST EMWE LI KAK+
Sbjct  11   VLFLTMTLFMASELIHCTTVTYDKKAILINGQRRLLISGSIHYPRSTPEMWEGLIQKAKD  70

Query  452  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  631
            GG+DVI+TYVFWN HEPSPGNY FEGRYDLVRF+KT+QKAGL+ HLRIGPY+C EWNFGG
Sbjct  71   GGLDVIDTYVFWNGHEPSPGNYYFEGRYDLVRFIKTVQKAGLFLHLRIGPYVCAEWNFGG  130

Query  632  FPV  640
            FPV
Sbjct  131  FPV  133



>gb|KJB32547.1| hypothetical protein B456_005G246600 [Gossypium raimondii]
Length=732

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  293  VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIE  472
            + FL   L  C+V+YDRKAI I+GQ+R+LFSGSIHYPRST EMWE LI KAK GG+DVI+
Sbjct  16   ILFLYLLLVHCNVTYDRKAIAIDGQKRILFSGSIHYPRSTPEMWEGLIQKAKNGGLDVID  75

Query  473  TYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            TYVFWN+HEPSPGNYNFEGRYDLV+F+K ++KAGLY HLRIGPYICGEWNFGGFPV
Sbjct  76   TYVFWNLHEPSPGNYNFEGRYDLVQFIKLVKKAGLYVHLRIGPYICGEWNFGGFPV  131



>emb|CDY47949.1| BnaA10g28210D [Brassica napus]
Length=730

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +2

Query  263  MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISK  442
            + K +  L +   + S + QCS++YD+KAIVING RR+L SGSIHYPRST EMWEDLI K
Sbjct  7    LTKILCFLLITMVIGSAMIQCSITYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIKK  66

Query  443  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  622
            AK+GG+DVI+TYVFWN HEPSPG Y+F+GRYDLVRF+KT+Q+ GLY HLRIGPY+C EWN
Sbjct  67   AKDGGLDVIDTYVFWNGHEPSPGTYDFKGRYDLVRFIKTVQEVGLYVHLRIGPYVCAEWN  126

Query  623  FGGFPV  640
            FGGFPV
Sbjct  127  FGGFPV  132



>emb|CDY53959.1| BnaCnng25850D [Brassica napus]
Length=730

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +2

Query  263  MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISK  442
            + K +  L +   + S + QCS++YD+KAIVING RR+L SGSIHYPRST EMWEDLI K
Sbjct  7    LTKILCFLLITMVIGSAMIQCSITYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIKK  66

Query  443  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  622
            AK+GG+DVI+TYVFWN HEPSPG Y+F+GRYDLVRF+KT+Q+ GLY HLRIGPY+C EWN
Sbjct  67   AKDGGLDVIDTYVFWNGHEPSPGTYDFKGRYDLVRFIKTVQEVGLYVHLRIGPYVCAEWN  126

Query  623  FGGFPV  640
            FGGFPV
Sbjct  127  FGGFPV  132



>emb|CDP11590.1| unnamed protein product [Coffea canephora]
 emb|CDP03164.1| unnamed protein product [Coffea canephora]
Length=180

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            +L++ +V FLS    +  VSYD ++ +INGQR++L SGSIHYPRST EMW DLI KAK+G
Sbjct  8    LLIIVLVSFLSC-TVRAKVSYDGRSFIINGQRKILISGSIHYPRSTPEMWPDLIQKAKDG  66

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DVI+TYVFWNVHEPSPG YNFEGR D+VRF+K ++ AGLYAHLRIGPYIC EWNFGGF
Sbjct  67   GLDVIQTYVFWNVHEPSPGKYNFEGRGDIVRFLKLVKAAGLYAHLRIGPYICAEWNFGGF  126

Query  635  PV  640
            PV
Sbjct  127  PV  128



>ref|XP_010066193.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Eucalyptus grandis]
 gb|KCW64026.1| hypothetical protein EUGRSUZ_G01704 [Eucalyptus grandis]
Length=733

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 2/125 (2%)
 Frame = +2

Query  269  KWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKA  445
            KW L  C++   +  LT CS V+YD KA++INGQRR+LFSGSIHYPRST +MWE L+ KA
Sbjct  9    KWFLP-CVLLCATLSLTHCSSVTYDGKALIINGQRRILFSGSIHYPRSTPQMWEGLVHKA  67

Query  446  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  625
            KEGG+DV++TYVFWNVHEPSPGNYNFEG+YDLV+FVKT+QKAGLY HLRIGPY+C EWNF
Sbjct  68   KEGGLDVVDTYVFWNVHEPSPGNYNFEGQYDLVQFVKTVQKAGLYVHLRIGPYVCAEWNF  127

Query  626  GGFPV  640
            GG PV
Sbjct  128  GGLPV  132



>gb|KHG20820.1| Beta-galactosidase 3 [Gossypium arboreum]
Length=660

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  290  MVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVI  469
            ++ FL   L  C+V+YDRKAI I+GQ+R+LF+GSIHYPRST EMWE LI KAK GG+DVI
Sbjct  15   IMLFLYLQLIHCNVTYDRKAIAIDGQKRILFAGSIHYPRSTPEMWEGLIQKAKNGGLDVI  74

Query  470  ETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            +TYVFWN+HEPSPGNYNFEGRYDLV+F+K ++KAGLY HLRIGPYICGEWNFGGFPV
Sbjct  75   DTYVFWNLHEPSPGNYNFEGRYDLVQFIKLVKKAGLYVHLRIGPYICGEWNFGGFPV  131



>ref|XP_010066191.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Eucalyptus grandis]
 ref|XP_010066192.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Eucalyptus grandis]
Length=737

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 2/125 (2%)
 Frame = +2

Query  269  KWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKA  445
            KW L  C++   +  LT CS V+YD KA++INGQRR+LFSGSIHYPRST +MWE L+ KA
Sbjct  9    KWFLP-CVLLCATLSLTHCSSVTYDGKALIINGQRRILFSGSIHYPRSTPQMWEGLVHKA  67

Query  446  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  625
            KEGG+DV++TYVFWNVHEPSPGNYNFEG+YDLV+FVKT+QKAGLY HLRIGPY+C EWNF
Sbjct  68   KEGGLDVVDTYVFWNVHEPSPGNYNFEGQYDLVQFVKTVQKAGLYVHLRIGPYVCAEWNF  127

Query  626  GGFPV  640
            GG PV
Sbjct  128  GGLPV  132



>ref|XP_003612092.1| Beta-galactosidase [Medicago truncatula]
 gb|AES95050.1| beta-galactosidase [Medicago truncatula]
Length=843

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 105/121 (87%), Gaps = 3/121 (2%)
 Frame = +2

Query  278  LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGG  457
            L + +  FL+       V+YDRKAI+INGQRR+LFSGSIHYPRST +MWEDLI KAKEGG
Sbjct  12   LFVSLTLFLA---VYSDVTYDRKAIIINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGG  68

Query  458  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  637
            +DVIETYVFWNVHEPSPGNYNFEGR DLVRF++T+ KAGLYAHLRIGPY+C EWNFGGFP
Sbjct  69   LDVIETYVFWNVHEPSPGNYNFEGRNDLVRFIQTVHKAGLYAHLRIGPYVCAEWNFGGFP  128

Query  638  V  640
            V
Sbjct  129  V  129



>ref|XP_002891311.1| hypothetical protein ARALYDRAFT_473836 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67570.1| hypothetical protein ARALYDRAFT_473836 [Arabidopsis lyrata subsp. 
lyrata]
Length=732

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 105/127 (83%), Gaps = 1/127 (1%)
 Frame = +2

Query  263  MRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            + K +  L     + S + QCS V+YD+KAIVING RR+L SGSIHYPRST EMWEDLI 
Sbjct  8    LSKILTFLLTTMLIGSSMIQCSSVTYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIK  67

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+DVI+TYVFWN HEPSPG YNFEGRYDLVRF+KTIQ+ GLY HLRIGPY+C EW
Sbjct  68   KAKDGGLDVIDTYVFWNGHEPSPGTYNFEGRYDLVRFIKTIQEVGLYVHLRIGPYVCAEW  127

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  128  NFGGFPV  134



>emb|CDY36028.1| BnaA08g04330D [Brassica napus]
Length=712

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +2

Query  296  FFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIET  475
              + S + QCSV+YD+KAIV+NG RR+L SGSIHYPRST EMWEDLI KAK+GG+DVI+T
Sbjct  1    MLIGSSIIQCSVTYDKKAIVVNGHRRILLSGSIHYPRSTPEMWEDLIKKAKDGGLDVIDT  60

Query  476  YVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            YVFWN HEPSPG YNFEGRYDLVRF+KT+Q+ GLY HLRIGPY+C EWNFGGFPV
Sbjct  61   YVFWNGHEPSPGIYNFEGRYDLVRFIKTVQEVGLYVHLRIGPYVCAEWNFGGFPV  115



>ref|XP_007225291.1| hypothetical protein PRUPE_ppa001334mg [Prunus persica]
 gb|EMJ26490.1| hypothetical protein PRUPE_ppa001334mg [Prunus persica]
Length=851

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 103/113 (91%), Gaps = 1/113 (1%)
 Frame = +2

Query  305  SSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYV  481
            SS L QC+ V+YD+KAI+INGQRR+L SGSIHYPRST EMWE LI KAK+GG+DVI+TYV
Sbjct  20   SSELIQCTTVTYDKKAIIINGQRRLLISGSIHYPRSTPEMWEGLIQKAKDGGLDVIDTYV  79

Query  482  FWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            FWN HEPSPGNYNFEGRYDLVRF+KT+QKAGLY HLRIGPY+C EWNFGGFPV
Sbjct  80   FWNGHEPSPGNYNFEGRYDLVRFIKTVQKAGLYLHLRIGPYVCAEWNFGGFPV  132



>emb|CAB64741.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=732

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 105/127 (83%), Gaps = 1/127 (1%)
 Frame = +2

Query  263  MRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            + K +  L     + S + QCS V+YD+KAIVING RR+L SGSIHYPRST EMWEDLI 
Sbjct  8    LSKILTFLLTTMLIGSSVIQCSSVTYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIK  67

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+DVI+TYVFWN HEPSPG YNFEGRYDLVRF+KTIQ+ GLY HLRIGPY+C EW
Sbjct  68   KAKDGGLDVIDTYVFWNGHEPSPGTYNFEGRYDLVRFIKTIQEVGLYVHLRIGPYVCAEW  127

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  128  NFGGFPV  134



>ref|NP_175127.1| beta-galactosidase 5 [Arabidopsis thaliana]
 sp|Q9MAJ7.1|BGAL5_ARATH RecName: Full=Beta-galactosidase 5; Short=Lactase 5; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF69162.1|AC007915_14 F27F5.20 [Arabidopsis thaliana]
 gb|AAL47461.1| At1g45130/F27F5_20 [Arabidopsis thaliana]
 gb|AAM16238.1| At1g45130/F27F5_20 [Arabidopsis thaliana]
 gb|AEE32082.1| beta-galactosidase 5 [Arabidopsis thaliana]
Length=732

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 105/127 (83%), Gaps = 1/127 (1%)
 Frame = +2

Query  263  MRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            + K +  L     + S + QCS V+YD+KAIVING RR+L SGSIHYPRST EMWEDLI 
Sbjct  8    LSKILTFLLTTMLIGSSVIQCSSVTYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIK  67

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+DVI+TYVFWN HEPSPG YNFEGRYDLVRF+KTIQ+ GLY HLRIGPY+C EW
Sbjct  68   KAKDGGLDVIDTYVFWNGHEPSPGTYNFEGRYDLVRFIKTIQEVGLYVHLRIGPYVCAEW  127

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  128  NFGGFPV  134



>gb|AAL24206.1| At1g45130/F27F5_20 [Arabidopsis thaliana]
Length=732

 Score =   203 bits (516),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 105/127 (83%), Gaps = 1/127 (1%)
 Frame = +2

Query  263  MRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            + K +  L     + S + QCS V+YD+KAIVING RR+L SGSIHYPRST EMWEDLI 
Sbjct  8    LSKILTFLLTTMLIGSSVIQCSSVTYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIK  67

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+DVI+TYVFWN HEPSPG YNFEGRYDLVRF+KTIQ+ GLY HLRIGPY+C EW
Sbjct  68   KAKDGGLDVIDTYVFWNGHEPSPGTYNFEGRYDLVRFIKTIQEVGLYVHLRIGPYVCAEW  127

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  128  NFGGFPV  134



>emb|CDY59693.1| BnaC07g51120D [Brassica napus]
Length=856

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  311  GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWN  490
            G  QC V+YDRKA++INGQRR+LFSGSIHYPRST +MWE LI KAK+GGVDVIETYVFWN
Sbjct  27   GFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGVDVIETYVFWN  86

Query  491  VHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            +HEPSPG Y+F+GR DLVRFVKT+ KAGLYAHLRIGPY+C EWNFGGFPV
Sbjct  87   LHEPSPGKYDFDGRNDLVRFVKTVHKAGLYAHLRIGPYVCAEWNFGGFPV  136



>ref|XP_008799994.1| PREDICTED: beta-galactosidase 5-like [Phoenix dactylifera]
Length=845

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = +2

Query  317  TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVH  496
             QC VSYDRKAI+INGQRR+L SGSIHYPRST +MWE L+ KAK+GG+DVI+TY FWN H
Sbjct  20   AQCGVSYDRKAIIINGQRRILISGSIHYPRSTPDMWEGLLQKAKDGGLDVIQTYAFWNGH  79

Query  497  EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            EPSPGNYNFEGRYDLVRF+KT+ K GLY HLRIGPYICGEWNFGGFPV
Sbjct  80   EPSPGNYNFEGRYDLVRFIKTVHKVGLYVHLRIGPYICGEWNFGGFPV  127



>ref|XP_004146490.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
 ref|XP_004160975.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=846

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +2

Query  278  LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGG  457
            L L      +S L   +V+YDRKAI+INGQRR+LFSGSIHYPRST EMWEDLI KAK GG
Sbjct  10   LFLIAFLLANSHLIHSTVTYDRKAILINGQRRILFSGSIHYPRSTPEMWEDLILKAKNGG  69

Query  458  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  637
            +DV+ETYVFWNVHEP PG YNFEGR+DLVRF+KTIQKAGLYA+LRIGPY+C EWNFGGFP
Sbjct  70   LDVVETYVFWNVHEPYPGIYNFEGRFDLVRFIKTIQKAGLYANLRIGPYVCAEWNFGGFP  129

Query  638  V  640
            V
Sbjct  130  V  130



>gb|KFK36177.1| hypothetical protein AALP_AA4G088200 [Arabis alpina]
Length=713

 Score =   202 bits (514),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +2

Query  296  FFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIET  475
              + SG+ QCSV+YD++AI++NG RR+L SGSIHYPRST EMWEDLI KAK+GG+DVI+T
Sbjct  1    MLIGSGVIQCSVTYDKRAIIVNGHRRILLSGSIHYPRSTPEMWEDLIKKAKDGGLDVIDT  60

Query  476  YVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            YVFWN HEP+PG Y+FEGRYDLVRF+KT+Q+ GLY HLRIGPY+C EWNFGGFPV
Sbjct  61   YVFWNGHEPTPGTYDFEGRYDLVRFIKTVQEVGLYVHLRIGPYVCAEWNFGGFPV  115



>ref|XP_008382310.1| PREDICTED: beta-galactosidase 5-like [Malus domestica]
Length=848

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 107/125 (86%), Gaps = 2/125 (2%)
 Frame = +2

Query  272  WVLVLCMVFFLSSGL--TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKA  445
            WVL+ C + + S  +  T+C+V +DRKA+VI+GQRR+LFSGSIHYPRST EMWE LI  A
Sbjct  10   WVLLCCCIVWSSVYVEQTECNVVFDRKALVIDGQRRLLFSGSIHYPRSTPEMWEGLIQXA  69

Query  446  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  625
            K+GG+D I+TYVFWN+HEPSPGNYNFEGR DLVRF+KT+ KAGLY HLRIGPYIC EWNF
Sbjct  70   KDGGLDAIDTYVFWNLHEPSPGNYNFEGRNDLVRFIKTVHKAGLYVHLRIGPYICSEWNF  129

Query  626  GGFPV  640
            GGFPV
Sbjct  130  GGFPV  134



>ref|XP_002512959.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF49462.1| beta-galactosidase, putative [Ricinus communis]
Length=732

 Score =   202 bits (514),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWE  427
            + G +  KW+ +  ++  LSS + +C+V+YD+KA++INGQ+R+LFSGSIHYPRST +MWE
Sbjct  1    MEGNSATKWLSLCVVLLSLSSQIIECNVTYDKKALIINGQKRILFSGSIHYPRSTPQMWE  60

Query  428  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  607
             LI KAK+GG+DVI+TYVFWN+HEPSPGNYNFEGR DLV+F+K + KAGLY HLRIGPYI
Sbjct  61   GLIQKAKDGGLDVIDTYVFWNLHEPSPGNYNFEGRNDLVQFIKLVHKAGLYVHLRIGPYI  120

Query  608  CGEWNFGGFPV  640
            CGEWNFGGFPV
Sbjct  121  CGEWNFGGFPV  131



>ref|XP_006306871.1| hypothetical protein CARUB_v10008424mg [Capsella rubella]
 gb|EOA39769.1| hypothetical protein CARUB_v10008424mg [Capsella rubella]
Length=733

 Score =   202 bits (514),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 105/127 (83%), Gaps = 1/127 (1%)
 Frame = +2

Query  263  MRKWVLVLCMVFFLSSGLTQC-SVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            + K +  L     L S L QC SV+YD+KAI++NG RR+L SGSIHYPRST EMWEDLI 
Sbjct  9    LTKILSFLLTTMLLGSSLIQCTSVTYDKKAIIVNGHRRILLSGSIHYPRSTPEMWEDLIK  68

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+DVI+TYVFWN HEPSPG YNF+GRYDLVRF+KTIQ+ GLY HLRIGPY+C EW
Sbjct  69   KAKDGGLDVIDTYVFWNGHEPSPGTYNFKGRYDLVRFIKTIQEVGLYVHLRIGPYVCAEW  128

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  129  NFGGFPV  135



>ref|XP_011092826.1| PREDICTED: beta-galactosidase 3 [Sesamum indicum]
Length=732

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +2

Query  317  TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVH  496
            + CSVSYDRKA++INGQRR+LFSGSIHYPRST +MWE LI KAK+GG+D I+TYVFW++H
Sbjct  25   SHCSVSYDRKALIINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGLDAIDTYVFWDLH  84

Query  497  EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            EPSPG YNFEGRYDLVRFVK +QKAGLY HLRIGPYIC EWNFGGFPV
Sbjct  85   EPSPGTYNFEGRYDLVRFVKLVQKAGLYLHLRIGPYICAEWNFGGFPV  132



>ref|XP_010061261.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 5 [Eucalyptus 
grandis]
Length=730

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +2

Query  317  TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVH  496
            T+CSVSYDRK++ INGQRR+L SGSIHYPRST +MWEDLI KAK+GG+DVIETYVFWN H
Sbjct  25   TRCSVSYDRKSLNINGQRRILISGSIHYPRSTPDMWEDLIQKAKDGGLDVIETYVFWNGH  84

Query  497  EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            EPSPG YNF+ RYDLVRF+KT+QK GLYAHLRIGPY+C EWNFGGFPV
Sbjct  85   EPSPGKYNFDERYDLVRFIKTVQKVGLYAHLRIGPYVCAEWNFGGFPV  132



>ref|XP_003523710.1| PREDICTED: beta-galactosidase 3-like isoform 1 [Glycine max]
Length=736

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  308  SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFW  487
            S LT C+V+YDRK+++INGQRR+L SGSIHYPRST EMWEDLI KAK GG+DVI+TYVFW
Sbjct  23   SELTHCNVTYDRKSLLINGQRRILISGSIHYPRSTPEMWEDLIWKAKHGGLDVIDTYVFW  82

Query  488  NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            +VHEPSPGNY+FEGRYDLVRF+KT+QK GLYA+LRIGPY+C EWNFGG PV
Sbjct  83   DVHEPSPGNYDFEGRYDLVRFIKTVQKVGLYANLRIGPYVCAEWNFGGIPV  133



>gb|KHN45883.1| Beta-galactosidase 5 [Glycine soja]
Length=727

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  308  SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFW  487
            S LT C+V+YDRK+++INGQRR+L SGSIHYPRST EMWEDLI KAK GG+DVI+TYVFW
Sbjct  23   SELTHCNVTYDRKSLLINGQRRILISGSIHYPRSTPEMWEDLIWKAKHGGLDVIDTYVFW  82

Query  488  NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            +VHEPSPGNY+FEGRYDLVRF+KT+QK GLYA+LRIGPY+C EWNFGG PV
Sbjct  83   DVHEPSPGNYDFEGRYDLVRFIKTVQKVGLYANLRIGPYVCAEWNFGGIPV  133



>ref|XP_010917686.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=849

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +2

Query  317  TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVH  496
             QC V+YD KA++INGQRR+L SGSIHYPRST +MWE LI KAK+GG+DVI+TYVFWN H
Sbjct  24   AQCGVTYDSKAVIINGQRRILISGSIHYPRSTPDMWEGLIQKAKDGGLDVIQTYVFWNGH  83

Query  497  EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            EPSPG+YNFEGRYDLVRF+KT+QK GLY HLRIGPYICGEWNFGGFPV
Sbjct  84   EPSPGSYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYICGEWNFGGFPV  131



>emb|CDP07463.1| unnamed protein product [Coffea canephora]
Length=850

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            +    +   + + L QCSV+YD++AI+ING RR+L SGSIHYPRST EMWEDL+ KAK  
Sbjct  11   IFFFSIALLMGAQLIQCSVTYDKRAIIINGHRRILLSGSIHYPRSTPEMWEDLVIKAKNA  70

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DVI+TYVFWN+HEP+ GNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGF
Sbjct  71   GLDVIDTYVFWNIHEPTQGNYNFEGRYDLVRFLKTVQKVGLYVHLRIGPYVCAEWNFGGF  130

Query  635  PV  640
            PV
Sbjct  131  PV  132



>ref|XP_010049745.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
 gb|KCW82505.1| hypothetical protein EUGRSUZ_C03897 [Eucalyptus grandis]
Length=722

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  278  LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGG  457
            LVL ++    +    CSVSYDRKAI+I+G+RR+L SGSIHYPRST EMW DLI KAKEGG
Sbjct  6    LVLALILLSWASSVSCSVSYDRKAIIIDGKRRILISGSIHYPRSTPEMWPDLIRKAKEGG  65

Query  458  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  637
            +DVI+TYVFWN HEPSPGNY FE RYDLVRF+K +Q+AGLY HLRIGPY+C EWNFGGFP
Sbjct  66   LDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFP  125

Query  638  V  640
            V
Sbjct  126  V  126



>ref|NP_001049068.1| Os03g0165400 [Oryza sativa Japonica Group]
 sp|Q10RB4.1|BGAL5_ORYSJ RecName: Full=Beta-galactosidase 5; Short=Lactase 5; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABF94149.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10982.1| Os03g0165400 [Oryza sativa Japonica Group]
 dbj|BAG95436.1| unnamed protein product [Oryza sativa Japonica Group]
Length=841

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +2

Query  323  CSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHEP  502
            C+V+YD+KA++++GQRR+LFSGSIHYPRST EMW+ LI KAK+GG+DVI+TYVFWN HEP
Sbjct  25   CAVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHEP  84

Query  503  SPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            +PGNYNFEGRYDLVRF+KT+QKAG++ HLRIGPYICGEWNFGGFPV
Sbjct  85   TPGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPV  130



>gb|EEE58382.1| hypothetical protein OsJ_09539 [Oryza sativa Japonica Group]
Length=851

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +2

Query  323  CSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHEP  502
            C+V+YD+KA++++GQRR+LFSGSIHYPRST EMW+ LI KAK+GG+DVI+TYVFWN HEP
Sbjct  25   CAVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHEP  84

Query  503  SPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            +PGNYNFEGRYDLVRF+KT+QKAG++ HLRIGPYICGEWNFGGFPV
Sbjct  85   TPGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPV  130



>gb|AAM22973.1|AF499737_1 beta-galactosidase [Oryza sativa Japonica Group]
 gb|AAM34271.1|AF508799_1 beta-galactosidase [Oryza sativa Japonica Group]
Length=843

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +2

Query  323  CSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHEP  502
            C+V+YD+KA++++GQRR+LFSGSIHYPRST EMW+ LI KAK+GG+DVI+TYVFWN HEP
Sbjct  25   CAVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHEP  84

Query  503  SPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            +PGNYNFEGRYDLVRF+KT+QKAG++ HLRIGPYICGEWNFGGFPV
Sbjct  85   TPGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPV  130



>gb|EEC74580.1| hypothetical protein OsI_10152 [Oryza sativa Indica Group]
Length=851

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  320  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHE  499
             C+V+YD+KA++++GQRR+LFSGSIHYPRST EMW+ LI KAK+GG+DVI+TYVFWN HE
Sbjct  24   HCAVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHE  83

Query  500  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            P+PGNYNFEGRYDLVRF+KT+QKAG++ HLRIGPYICGEWNFGGFPV
Sbjct  84   PTPGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPV  130



>gb|ABF94150.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
Length=819

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  320  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHE  499
             C+V+YD+KA++++GQRR+LFSGSIHYPRST EMW+ LI KAK+GG+DVI+TYVFWN HE
Sbjct  24   HCAVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHE  83

Query  500  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            P+PGNYNFEGRYDLVRF+KT+QKAG++ HLRIGPYICGEWNFGGFPV
Sbjct  84   PTPGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPV  130



>ref|XP_004291830.1| PREDICTED: beta-galactosidase 5 [Fragaria vesca subsp. vesca]
Length=730

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 105/123 (85%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKE  451
             L L    F+ S L QC+ VSYD+KAI+ING+R++L SGSIHYPRST EMWE LI KAK+
Sbjct  11   ALYLVAFLFVGSELIQCTTVSYDKKAILINGRRKLLISGSIHYPRSTPEMWEGLIQKAKD  70

Query  452  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  631
            GG+DVI+TYVFWN HEPSPGNY FEGRYDLVRFV+T+QKAGLY HLRIGPY+C EWNFGG
Sbjct  71   GGLDVIDTYVFWNGHEPSPGNYYFEGRYDLVRFVRTVQKAGLYLHLRIGPYVCAEWNFGG  130

Query  632  FPV  640
            FPV
Sbjct  131  FPV  133



>gb|KGN59998.1| hypothetical protein Csa_3G865330 [Cucumis sativus]
Length=756

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 101/109 (93%), Gaps = 1/109 (1%)
 Frame = +2

Query  317  TQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNV  493
            TQC+ V+YD+KAI+INGQRR+L SGSIHYPRST EMW+DL+ KAK+GG+DV++TYVFWNV
Sbjct  24   TQCTTVTYDKKAILINGQRRILISGSIHYPRSTPEMWDDLMQKAKDGGLDVVDTYVFWNV  83

Query  494  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            HEPSPGNY+FEGRYDLVRF+KT Q+ GLY HLRIGPY+C EWNFGGFPV
Sbjct  84   HEPSPGNYDFEGRYDLVRFIKTAQRVGLYVHLRIGPYVCAEWNFGGFPV  132



>ref|XP_008466519.1| PREDICTED: beta-galactosidase 5-like [Cucumis melo]
Length=844

 Score =   200 bits (509),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 103/118 (87%), Gaps = 1/118 (1%)
 Frame = +2

Query  290  MVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDV  466
            M   L    TQC+ V+YD+KAI+INGQRR+L SGSIHYPRST EMWEDL+ KAK+GG+DV
Sbjct  15   MAALLGFRSTQCTTVTYDKKAILINGQRRILISGSIHYPRSTPEMWEDLMQKAKDGGLDV  74

Query  467  IETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            ++TYVFWNVHEPSPGNY+FEGRYDLVRF+KT Q+ GLY HLRIGPY+C EWNFGGFPV
Sbjct  75   VDTYVFWNVHEPSPGNYDFEGRYDLVRFIKTAQRVGLYIHLRIGPYVCAEWNFGGFPV  132



>ref|XP_008452119.1| PREDICTED: beta-galactosidase 3-like [Cucumis melo]
Length=846

 Score =   200 bits (509),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +2

Query  278  LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGG  457
            L L      +S     +V+YDRKAI+INGQRR+LFSGSIHYPRST EMWEDLI KAK GG
Sbjct  10   LFLIAFLLANSHFIHSTVTYDRKAILINGQRRILFSGSIHYPRSTPEMWEDLILKAKNGG  69

Query  458  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  637
            +DV+ETYVFWNVHEP PG YNFEGR+DLVRF+KTIQ+AGLYA+LRIGPY+C EWNFGGFP
Sbjct  70   LDVVETYVFWNVHEPYPGIYNFEGRFDLVRFIKTIQRAGLYANLRIGPYVCAEWNFGGFP  129

Query  638  V  640
            V
Sbjct  130  V  130



>ref|XP_009396354.1| PREDICTED: beta-galactosidase 5-like [Musa acuminata subsp. malaccensis]
Length=848

 Score =   200 bits (509),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +2

Query  314  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNV  493
            + QC V+YDRKAI+INGQR++L SGSIHYPRST +MWE LI KAK+GG+DVI+TYVFWN 
Sbjct  23   VAQCGVTYDRKAIIINGQRKILISGSIHYPRSTPDMWEGLIQKAKDGGLDVIQTYVFWNG  82

Query  494  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            HEPSPG YNFEGRYDLVRF+KT+QK GLY HLR+GPY+C EWNFGGFPV
Sbjct  83   HEPSPGTYNFEGRYDLVRFIKTVQKVGLYVHLRVGPYVCAEWNFGGFPV  131



>ref|XP_008388000.1| PREDICTED: beta-galactosidase 5 [Malus domestica]
Length=852

 Score =   200 bits (508),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 104/123 (85%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKE  451
            V  + M  FL S L  C+ V+YD+KAI+INGQRR+L SGSIHYPRST EMWE LI KAK+
Sbjct  11   VFFMSMALFLGSELIHCTTVTYDKKAILINGQRRLLISGSIHYPRSTPEMWEGLIQKAKD  70

Query  452  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  631
            GG+DVI+TYVFWN HEPSPGNY FEGRYDLV F+KT+QKAGL+ HLRIGPYIC EWNFGG
Sbjct  71   GGLDVIDTYVFWNGHEPSPGNYYFEGRYDLVGFIKTVQKAGLFLHLRIGPYICAEWNFGG  130

Query  632  FPV  640
            FPV
Sbjct  131  FPV  133



>ref|XP_003558743.1| PREDICTED: beta-galactosidase 5 [Brachypodium distachyon]
Length=839

 Score =   200 bits (508),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  320  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHE  499
            +C+V+YD+KA++I+GQRR+LFSGSIHYPRST EMWE L  KAK+GG+DVI+TYVFWN HE
Sbjct  24   ECAVTYDKKAVLIDGQRRILFSGSIHYPRSTPEMWEGLFQKAKDGGLDVIQTYVFWNGHE  83

Query  500  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            P+PGNYNFEGRYDLV+F+KT QKAGL+ HLRIGPYICGEWNFGGFPV
Sbjct  84   PTPGNYNFEGRYDLVKFIKTAQKAGLFVHLRIGPYICGEWNFGGFPV  130



>ref|XP_004147848.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
 ref|XP_004154857.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=844

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 101/109 (93%), Gaps = 1/109 (1%)
 Frame = +2

Query  317  TQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNV  493
            TQC+ V+YD+KAI+INGQRR+L SGSIHYPRST EMW+DL+ KAK+GG+DV++TYVFWNV
Sbjct  24   TQCTTVTYDKKAILINGQRRILISGSIHYPRSTPEMWDDLMQKAKDGGLDVVDTYVFWNV  83

Query  494  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            HEPSPGNY+FEGRYDLVRF+KT Q+ GLY HLRIGPY+C EWNFGGFPV
Sbjct  84   HEPSPGNYDFEGRYDLVRFIKTAQRVGLYVHLRIGPYVCAEWNFGGFPV  132



>ref|XP_008809207.1| PREDICTED: beta-galactosidase 5-like [Phoenix dactylifera]
Length=852

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +2

Query  317  TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVH  496
             QC V+YDRKA+VING RR+L SGSIHYPRST +MWE LI KAK+GG+DV++TYVFWN H
Sbjct  27   AQCGVTYDRKAVVINGHRRILISGSIHYPRSTPDMWEGLIQKAKDGGLDVVQTYVFWNGH  86

Query  497  EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            EPSPG+YNF+G YDLVRF+KT+QKAGLY HLRIGPYICGEWNFGGFPV
Sbjct  87   EPSPGSYNFKGSYDLVRFIKTVQKAGLYVHLRIGPYICGEWNFGGFPV  134



>ref|XP_007136038.1| hypothetical protein PHAVU_009G012700g [Phaseolus vulgaris]
 gb|ESW08032.1| hypothetical protein PHAVU_009G012700g [Phaseolus vulgaris]
Length=738

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  302  LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYV  481
            + S L  C+V+YDRK+++I GQRR+L SGSIHYPRST +MWEDLI KAK GG+DVI+TYV
Sbjct  21   VGSQLIHCNVTYDRKSLLIKGQRRILISGSIHYPRSTPDMWEDLIRKAKHGGLDVIDTYV  80

Query  482  FWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            FW+VHEPSPGNYNFEGRYDLVRF+KT+QK GLYA+LRIGPY+C EWNFGG PV
Sbjct  81   FWDVHEPSPGNYNFEGRYDLVRFIKTVQKVGLYANLRIGPYVCAEWNFGGIPV  133



>gb|ABR16628.1| unknown [Picea sitchensis]
Length=836

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +2

Query  272  WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKE  451
            W   L +   L+ G  +C V+YD KA+VING+RR+L SGSIHYPRST EMW DL  KAK+
Sbjct  6    WFAFLVLSVMLAVGGVECGVTYDHKALVINGERRILISGSIHYPRSTAEMWPDLFRKAKD  65

Query  452  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  631
            GG+DVI+TYVFWN+HEPSPGNYNFEGR+DLV+FVK  Q+AGLY HLRIGPY+C EWNFGG
Sbjct  66   GGLDVIQTYVFWNMHEPSPGNYNFEGRFDLVKFVKLAQEAGLYVHLRIGPYVCAEWNFGG  125

Query  632  FPV  640
            FPV
Sbjct  126  FPV  128



>gb|EMT10014.1| Beta-galactosidase 5 [Aegilops tauschii]
Length=851

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +2

Query  326  SVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHEPS  505
            +V+YDRKA++I+G+RR+LFSGSIHYPRST EMWE LI KAK+GG+DVI+TYVFWN HEP+
Sbjct  32   AVTYDRKAVLISGERRILFSGSIHYPRSTQEMWEGLIQKAKDGGLDVIQTYVFWNGHEPT  91

Query  506  PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            PGNYNFEGRYDLVRF+KT QKAGL+ HLRIGPYICGEWNFGGFPV
Sbjct  92   PGNYNFEGRYDLVRFIKTAQKAGLFVHLRIGPYICGEWNFGGFPV  136



>dbj|BAJ96054.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=847

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +2

Query  326  SVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHEPS  505
            +V+YDRKA++INGQRR+LFSGSIHYPRST EMWE LI KAK+GG+DVI+TYVFWN HEP+
Sbjct  31   AVTYDRKAVLINGQRRILFSGSIHYPRSTPEMWEGLIQKAKDGGLDVIQTYVFWNGHEPT  90

Query  506  PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            PG+YNFEGRYDLV+F+KT QKAGL+ HLRIGPYICGEWNFGGFPV
Sbjct  91   PGSYNFEGRYDLVKFIKTAQKAGLFVHLRIGPYICGEWNFGGFPV  135



>dbj|BAK07157.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=847

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +2

Query  326  SVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHEPS  505
            +V+YDRKA++INGQRR+LFSGSIHYPRST EMWE LI KAK+GG+DVI+TYVFWN HEP+
Sbjct  31   AVTYDRKAVLINGQRRILFSGSIHYPRSTPEMWEGLIQKAKDGGLDVIQTYVFWNGHEPT  90

Query  506  PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            PG+YNFEGRYDLV+F+KT QKAGL+ HLRIGPYICGEWNFGGFPV
Sbjct  91   PGSYNFEGRYDLVKFIKTAQKAGLFVHLRIGPYICGEWNFGGFPV  135



>gb|KEH36209.1| beta-galactosidase-like protein [Medicago truncatula]
Length=733

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWE  427
            +   ++ K +LV+    F+        V+YDRK+++INGQRR+L SGSIHYPRST EMWE
Sbjct  1    MNATSVSKLLLVVVTTLFVLFLGCHSKVTYDRKSLLINGQRRILISGSIHYPRSTPEMWE  60

Query  428  DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  607
            DLI KAK GG+DVI+TYVFW+VHEPSP NYNFEGRYDLVRF+KT+QKAGLYA+LRIGPY+
Sbjct  61   DLIRKAKHGGLDVIDTYVFWDVHEPSPSNYNFEGRYDLVRFIKTVQKAGLYANLRIGPYV  120

Query  608  CGEWNFGGFPV  640
            C EWNFGG PV
Sbjct  121  CAEWNFGGIPV  131



>ref|XP_011457728.1| PREDICTED: beta-galactosidase 3-like [Fragaria vesca subsp. vesca]
Length=843

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  314  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNV  493
            L Q +VSYDRKA+VINGQR++LFSGSIHYPRST EMWE LI KAK+GG+DVI+TYVFWN+
Sbjct  23   LIQSNVSYDRKALVINGQRKILFSGSIHYPRSTPEMWEGLIEKAKDGGLDVIDTYVFWNL  82

Query  494  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            HEPSPGNYNFEGR DLVRF+K +Q+A LY HLRIGPYIC EWNFGGFPV
Sbjct  83   HEPSPGNYNFEGRNDLVRFIKMVQEARLYVHLRIGPYICSEWNFGGFPV  131



>ref|XP_010932916.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=845

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = +2

Query  317  TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVH  496
             QC V+YDRKAI+ING+RR+L SGSIHYPRST +MWE L+ KA++GG+DVI+TYVFWN H
Sbjct  20   AQCGVTYDRKAIIINGRRRILISGSIHYPRSTPDMWEGLVQKARDGGLDVIQTYVFWNGH  79

Query  497  EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            EPSPGNYNFEGRYDLVRF+KT  K G+Y HLRIGPY+CGEWNFGGFPV
Sbjct  80   EPSPGNYNFEGRYDLVRFIKTAHKVGMYVHLRIGPYVCGEWNFGGFPV  127



>ref|XP_006649450.1| PREDICTED: beta-galactosidase 5-like [Oryza brachyantha]
Length=841

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +2

Query  332  SYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHEPSPG  511
            +YD+K++VI+GQRR+LFSGSIHYPRST EMWE LI KAK+GG+DVI+TYVFWN HEP+PG
Sbjct  28   TYDKKSVVIDGQRRILFSGSIHYPRSTPEMWEGLIEKAKDGGLDVIQTYVFWNGHEPTPG  87

Query  512  NYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            NYNFEGRYDLVRF+KT+QKAG++ HLRIGPYICGEWNFGGFPV
Sbjct  88   NYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPV  130



>gb|EYU32887.1| hypothetical protein MIMGU_mgv1a001295mg [Erythranthe guttata]
Length=845

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +2

Query  320  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHE  499
             C+V+YD KAI+INGQRR+L SGS+HYPRST +MWEDLI KAK GG+DVI+TYVFWN HE
Sbjct  26   NCTVTYDNKAILINGQRRILLSGSVHYPRSTPDMWEDLILKAKNGGLDVIDTYVFWNGHE  85

Query  500  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            PSPGNYNFEGRYDLVRFVKT+QK GL+ +LRIGPY+C EWN+GGFPV
Sbjct  86   PSPGNYNFEGRYDLVRFVKTVQKVGLFVNLRIGPYVCAEWNYGGFPV  132



>ref|XP_008660537.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 5-like [Zea 
mays]
Length=842

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 108/130 (83%), Gaps = 4/130 (3%)
 Frame = +2

Query  263  MRKW---VLVLCMVFFLSSGLT-QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWED  430
            MR+W    L+ C V         +C+V+YD+KA++I+GQRR+LFSGSIHYPRST +MWE 
Sbjct  1    MRRWWPAALLGCAVAVSVLVAAVECAVTYDKKAVLIDGQRRILFSGSIHYPRSTPDMWEG  60

Query  431  LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  610
            LI KAK+GG+DVI+TYVFWN HEP+PGNY FE RYDLVRF+KT+QKAGL+ HLRIGPYIC
Sbjct  61   LIQKAKDGGLDVIQTYVFWNGHEPTPGNYYFEERYDLVRFIKTVQKAGLFVHLRIGPYIC  120

Query  611  GEWNFGGFPV  640
            GEWNFGGFPV
Sbjct  121  GEWNFGGFPV  130



>ref|XP_010049746.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
 gb|KCW82504.1| hypothetical protein EUGRSUZ_C03896 [Eucalyptus grandis]
Length=722

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  278  LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGG  457
            LVL ++    +    CSVSYDRKAI+I+G+RR+L SGSIHYPRST EMW DLI KAK+GG
Sbjct  6    LVLALILLSWASSVSCSVSYDRKAIIIDGKRRILISGSIHYPRSTPEMWPDLIWKAKQGG  65

Query  458  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  637
            +DVI+TYVFWN HEPSPGNY F+ RYDLV+F+K +Q+AGLY HLRIGPY+C EWNFGGFP
Sbjct  66   LDVIQTYVFWNGHEPSPGNYYFQDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFP  125

Query  638  V  640
            V
Sbjct  126  V  126



>gb|KJB65165.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
 gb|KJB65168.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=634

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 102/123 (83%), Gaps = 4/123 (3%)
 Frame = +2

Query  272  WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKE  451
            W+L    VF L S     +VSYD KAI+ING+RR+L SGSIHYPRST +MW DLI+KAKE
Sbjct  18   WLLFSSWVFSLVS----ATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKE  73

Query  452  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  631
            GG+DVI+TYVFWN HEPSPGNY FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGG
Sbjct  74   GGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGG  133

Query  632  FPV  640
            FPV
Sbjct  134  FPV  136



>gb|EYU45189.1| hypothetical protein MIMGU_mgv1a003101mg [Erythranthe guttata]
Length=608

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  278  LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGG  457
            LV+ ++  ++    + +VSYD KA +INGQR++L SGSIHYPRST EMW DLI KAK+GG
Sbjct  7    LVVTVLLAIACSSVRATVSYDDKAFIINGQRKILISGSIHYPRSTPEMWPDLIQKAKDGG  66

Query  458  VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  637
            +DVI+TYVFWN HEPSPGNYNFEGR+DLV+F+K   +AGLY HLRIGPY+CGEWNFGGFP
Sbjct  67   LDVIQTYVFWNGHEPSPGNYNFEGRFDLVKFIKLAHQAGLYVHLRIGPYVCGEWNFGGFP  126

Query  638  V  640
            V
Sbjct  127  V  127



>ref|XP_009335672.1| PREDICTED: beta-galactosidase 5 [Pyrus x bretschneideri]
Length=852

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 103/123 (84%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKE  451
            VL + M  FL S L  C+ V+YD+KAI+INGQRR+L SGSIHYPRST EMWE LI KAK+
Sbjct  11   VLFMSMALFLGSELIHCTTVTYDKKAILINGQRRLLISGSIHYPRSTPEMWEGLIQKAKD  70

Query  452  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  631
            GG+DVI+TYVFWN HEPSPGNY FE RYDLV F+KT++KAGL  HLRIGPY+C EWNFGG
Sbjct  71   GGLDVIDTYVFWNGHEPSPGNYYFEERYDLVGFIKTVEKAGLLLHLRIGPYVCAEWNFGG  130

Query  632  FPV  640
            FPV
Sbjct  131  FPV  133



>ref|XP_004174126.1| PREDICTED: beta-galactosidase-like, partial [Cucumis sativus]
Length=154

 Score =   182 bits (462),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +2

Query  326  SVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHEPS  505
            SV+YD KAI+INGQRR+L SGSIHYPRST +MW DLI KAK+GG+D+IETYVFWN HEPS
Sbjct  1    SVTYDHKAIIINGQRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDIIETYVFWNGHEPS  60

Query  506  PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            P  Y FE RYDLVRF+K +Q+AGLY HLRIGPY+C EWN+GGFP+
Sbjct  61   PDKYYFEERYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPL  105



>ref|XP_004500970.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Cicer arietinum]
Length=627

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +2

Query  311  GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWN  490
            G    +VSYDRK+++ING RR+L SGSIHYPRST +MWEDLI KAK GG+DVI+TYVFW+
Sbjct  20   GCNCSNVSYDRKSLLINGHRRILISGSIHYPRSTPQMWEDLIWKAKHGGLDVIDTYVFWD  79

Query  491  VHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            VHEPSPGNYNFEGRYDLVRF+KT+QK GLYA+LRIGPY+C EWNFGG PV
Sbjct  80   VHEPSPGNYNFEGRYDLVRFIKTVQKVGLYANLRIGPYVCAEWNFGGIPV  129



>ref|XP_010107841.1| Beta-galactosidase 3 [Morus notabilis]
 gb|EXC17241.1| Beta-galactosidase 3 [Morus notabilis]
Length=860

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = +2

Query  317  TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVH  496
            TQC+V YDRKA+VIN QR++ FSGSIHYPRST +MW  L+ KAK+GG+DVI+TYVFWN+H
Sbjct  25   TQCNVGYDRKALVINAQRKLFFSGSIHYPRSTPQMWAGLVQKAKDGGLDVIDTYVFWNLH  84

Query  497  EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            EPSPGNYNFEGR DLV F+KT+Q+AGLY HLRIGPYIC EWNFGGFPV
Sbjct  85   EPSPGNYNFEGRNDLVGFIKTVQRAGLYVHLRIGPYICSEWNFGGFPV  132



>ref|XP_009395554.1| PREDICTED: beta-galactosidase 5 [Musa acuminata subsp. malaccensis]
Length=842

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +2

Query  329  VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHEPSP  508
            V+YDRKAI+I+GQRR+L SGSIHYPRST EMWE LI KAK+GG+DVI+TYVFWN HEPSP
Sbjct  21   VTYDRKAIIIDGQRRILISGSIHYPRSTPEMWEGLIQKAKDGGLDVIQTYVFWNGHEPSP  80

Query  509  GNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            G YNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPV
Sbjct  81   GTYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPV  124



>ref|XP_006838689.1| hypothetical protein AMTR_s00002p00246870 [Amborella trichopoda]
 gb|ERN01258.1| hypothetical protein AMTR_s00002p00246870 [Amborella trichopoda]
Length=843

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +2

Query  314  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNV  493
            L  C+V+YD +++VING RR+L SGSIHYPRST EMW DLI KAK+GG+DVI+TYVFWNV
Sbjct  19   LAHCAVTYDHRSLVINGNRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNV  78

Query  494  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            HEPSPGNY+F GRYDLVRFVKT QK GLY HLRIGPY C EWNFGGFPV
Sbjct  79   HEPSPGNYDFSGRYDLVRFVKTAQKVGLYVHLRIGPYACAEWNFGGFPV  127



>ref|XP_010545349.1| PREDICTED: beta-galactosidase 12-like isoform X2 [Tarenaya hassleriana]
Length=588

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 104/125 (83%), Gaps = 1/125 (1%)
 Frame = +2

Query  266  RKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKA  445
            + W+L++ +     S + + +VSYD KA++INGQRR+L SGSIHYPRST EMW DLI KA
Sbjct  8    KGWILLVILCCSSISSV-KGAVSYDHKAVIINGQRRILLSGSIHYPRSTPEMWSDLIQKA  66

Query  446  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  625
            K+GG+DVI+TYVFWN HEPSPGNY FE RYDLVRF++ +QKAGLY HLRIGPY+C EWNF
Sbjct  67   KDGGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIRVVQKAGLYVHLRIGPYVCAEWNF  126

Query  626  GGFPV  640
            GGFPV
Sbjct  127  GGFPV  131



>gb|KJB65166.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=697

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 102/123 (83%), Gaps = 4/123 (3%)
 Frame = +2

Query  272  WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKE  451
            W+L    VF L S     +VSYD KAI+ING+RR+L SGSIHYPRST +MW DLI+KAKE
Sbjct  18   WLLFSSWVFSLVS----ATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKE  73

Query  452  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  631
            GG+DVI+TYVFWN HEPSPGNY FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGG
Sbjct  74   GGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGG  133

Query  632  FPV  640
            FPV
Sbjct  134  FPV  136



>emb|CDX76255.1| BnaA04g05190D [Brassica napus]
Length=128

 Score =   180 bits (456),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  266  RKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKA  445
            + W+ +  M F L    T+  VSYD KA++INGQ+R+L SGSIHYPRST EMW DLI KA
Sbjct  8    KAWIFLAIMCFSLLICSTKALVSYDHKALIINGQKRILLSGSIHYPRSTPEMWPDLIKKA  67

Query  446  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  625
            KEGG+DVI+TYVFWN HEPSPG Y F  RYDLVRF+K +Q+AGLY  LRIGPY+C EWNF
Sbjct  68   KEGGLDVIQTYVFWNGHEPSPGQYYFGDRYDLVRFIKLVQQAGLYVSLRIGPYVCAEWNF  127

Query  626  G  628
            G
Sbjct  128  G  128



>ref|NP_194344.2| beta-galactosidase 12 [Arabidopsis thaliana]
 gb|AAM20463.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAN15586.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEE85163.1| beta-galactosidase 12 [Arabidopsis thaliana]
Length=636

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 103/127 (81%), Gaps = 4/127 (3%)
 Frame = +2

Query  266  RKWVL--VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            + W+L  +LC    + S   +  V+YDRKA++INGQRR+L SGSIHYPRST EMW DLI 
Sbjct  8    KAWILLGILCCSSLICS--VKAIVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQ  65

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+DVI+TYVFWN HEPSPG Y FE RYDLV+F+K +Q+AGLY HLRIGPY+C EW
Sbjct  66   KAKDGGLDVIQTYVFWNGHEPSPGQYYFEDRYDLVKFIKVVQQAGLYVHLRIGPYVCAEW  125

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  126  NFGGFPV  132



>ref|XP_006353531.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=726

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 101/119 (85%), Gaps = 2/119 (2%)
 Frame = +2

Query  284  LCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVD  463
            +C + F SS   + SVSYD +AI+ING+R++L SGSIHYPRST +MW DLI KAK+GG+D
Sbjct  14   ICSLDFFSS--VKASVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLD  71

Query  464  VIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            VIETYVFWN HEPSPG YNFEGRYDLVRF+K  Q+AGLY +LRIGPYIC EWNFGGFPV
Sbjct  72   VIETYVFWNAHEPSPGKYNFEGRYDLVRFIKLAQRAGLYVNLRIGPYICAEWNFGGFPV  130



>ref|XP_004500969.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Cicer arietinum]
Length=732

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +2

Query  311  GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWN  490
            G    +VSYDRK+++ING RR+L SGSIHYPRST +MWEDLI KAK GG+DVI+TYVFW+
Sbjct  20   GCNCSNVSYDRKSLLINGHRRILISGSIHYPRSTPQMWEDLIWKAKHGGLDVIDTYVFWD  79

Query  491  VHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            VHEPSPGNYNFEGRYDLVRF+KT+QK GLYA+LRIGPY+C EWNFGG PV
Sbjct  80   VHEPSPGNYNFEGRYDLVRFIKTVQKVGLYANLRIGPYVCAEWNFGGIPV  129



>gb|EYU42595.1| hypothetical protein MIMGU_mgv1a001990mg [Erythranthe guttata]
Length=729

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 103/129 (80%), Gaps = 3/129 (2%)
 Frame = +2

Query  263  MRKWVLVLCMVFFLSSGL---TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDL  433
            M     VLC+           + CSV+YDRKA+VINGQR++LFSGSIHYPRS+ +MWE L
Sbjct  1    MEAKCFVLCVTLLNLLLFLQLSHCSVTYDRKALVINGQRKILFSGSIHYPRSSPDMWEGL  60

Query  434  ISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICG  613
            I KAK+GG+D I+TYVFW++HEPSPGNYNFEGR DL+RF+K + +AGLY HLRIGPYIC 
Sbjct  61   IQKAKDGGLDAIDTYVFWDLHEPSPGNYNFEGRCDLIRFIKLVHEAGLYLHLRIGPYICA  120

Query  614  EWNFGGFPV  640
            EWNFGGFPV
Sbjct  121  EWNFGGFPV  129



>ref|XP_010242207.1| PREDICTED: beta-galactosidase [Nelumbo nucifera]
Length=846

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +2

Query  320  QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHE  499
            + SVSYD+KAI+INGQRR+LFSGSIHYPRST EMW DLI KAK+GG+D I+TYVFWN HE
Sbjct  38   KASVSYDQKAIIINGQRRILFSGSIHYPRSTPEMWPDLIQKAKDGGLDAIQTYVFWNGHE  97

Query  500  PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            PSPG Y FEGRYDLVRF+K +Q+AGLY HLRIGPY+C EWNFGGFPV
Sbjct  98   PSPGQYYFEGRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPV  144



>gb|KCW82506.1| hypothetical protein EUGRSUZ_C03898, partial [Eucalyptus grandis]
Length=700

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 102/122 (84%), Gaps = 2/122 (2%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            +L L ++ + SS    CSVSYDRKAIVI+G+RR+L SGSIHYPRST EMW DLI KAK G
Sbjct  1    MLALILLSWASS--VSCSVSYDRKAIVIDGKRRILISGSIHYPRSTPEMWPDLIWKAKRG  58

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            GVDVI++YVFWN HEPSPG Y FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGGF
Sbjct  59   GVDVIQSYVFWNGHEPSPGQYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGGF  118

Query  635  PV  640
            PV
Sbjct  119  PV  120



>ref|XP_010049744.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
Length=703

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 102/122 (84%), Gaps = 2/122 (2%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            +L L ++ + SS    CSVSYDRKAIVI+G+RR+L SGSIHYPRST EMW DLI KAK G
Sbjct  1    MLALILLSWASS--VSCSVSYDRKAIVIDGKRRILISGSIHYPRSTPEMWPDLIWKAKRG  58

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            GVDVI++YVFWN HEPSPG Y FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGGF
Sbjct  59   GVDVIQSYVFWNGHEPSPGQYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGGF  118

Query  635  PV  640
            PV
Sbjct  119  PV  120



>gb|KJB65169.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=811

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 102/123 (83%), Gaps = 4/123 (3%)
 Frame = +2

Query  272  WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKE  451
            W+L    VF L S     +VSYD KAI+ING+RR+L SGSIHYPRST +MW DLI+KAKE
Sbjct  18   WLLFSSWVFSLVS----ATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKE  73

Query  452  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  631
            GG+DVI+TYVFWN HEPSPGNY FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGG
Sbjct  74   GGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGG  133

Query  632  FPV  640
            FPV
Sbjct  134  FPV  136



>emb|CDX88594.1| BnaA03g10550D [Brassica napus]
Length=325

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 101/127 (80%), Gaps = 4/127 (3%)
 Frame = +2

Query  266  RKWVL--VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            + W+   +LC    + S   + +VSYDRKA++INGQRR+L SGSIHYPRST EMW  LI 
Sbjct  8    KAWIFLAILCYSSLICS--VKATVSYDRKAVIINGQRRILLSGSIHYPRSTPEMWPGLIQ  65

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAKEGG+DVIETYVFWN HEPSPGNY F  RYDLV+F+K + +AGLY +LRIGPY+C EW
Sbjct  66   KAKEGGLDVIETYVFWNGHEPSPGNYYFGDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEW  125

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  126  NFGGFPV  132



>gb|KHN32687.1| Beta-galactosidase 1 [Glycine soja]
Length=831

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 101/123 (82%), Gaps = 1/123 (1%)
 Frame = +2

Query  272  WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKE  451
            W + L +VF L  G  + SVSYD KAI INGQRR+L SGSIHYPRST EMW DLI KAK+
Sbjct  2    WNVALLLVFSLI-GSAKASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKD  60

Query  452  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  631
            GG+DVI+TYVFWN HEPSPG Y FEG YDLV+F+K +Q+AGLY HLRIGPY+C EWNFGG
Sbjct  61   GGLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGG  120

Query  632  FPV  640
            FPV
Sbjct  121  FPV  123



>gb|KJB65167.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=843

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 102/123 (83%), Gaps = 4/123 (3%)
 Frame = +2

Query  272  WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKE  451
            W+L    VF L S     +VSYD KAI+ING+RR+L SGSIHYPRST +MW DLI+KAKE
Sbjct  18   WLLFSSWVFSLVS----ATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKE  73

Query  452  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  631
            GG+DVI+TYVFWN HEPSPGNY FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGG
Sbjct  74   GGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGG  133

Query  632  FPV  640
            FPV
Sbjct  134  FPV  136



>gb|KGN59822.1| hypothetical protein Csa_3G848310 [Cucumis sativus]
Length=737

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  263  MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISK  442
            ++ W +++  + F      Q SVSYD KAI+ING RR+L SGSIHYPRST EMW DLI K
Sbjct  6    LKMWNVIMGFLCFFGVLSVQASVSYDSKAIIINGHRRILISGSIHYPRSTSEMWPDLIQK  65

Query  443  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  622
            AKEGG+DVIETYVFWN HEP PG Y FEG YDLVRFVK + +AGLY HLRIGPY+C EWN
Sbjct  66   AKEGGLDVIETYVFWNGHEPEPGKYYFEGNYDLVRFVKLVHQAGLYVHLRIGPYVCAEWN  125

Query  623  FGGFPV  640
            FGGFPV
Sbjct  126  FGGFPV  131



>ref|XP_003546676.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=840

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 101/123 (82%), Gaps = 1/123 (1%)
 Frame = +2

Query  272  WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKE  451
            W + L +VF L  G  + SVSYD KAI INGQRR+L SGSIHYPRST EMW DLI KAK+
Sbjct  11   WNVALLLVFSLI-GSAKASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKD  69

Query  452  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  631
            GG+DVI+TYVFWN HEPSPG Y FEG YDLV+F+K +Q+AGLY HLRIGPY+C EWNFGG
Sbjct  70   GGLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGG  129

Query  632  FPV  640
            FPV
Sbjct  130  FPV  132



>gb|KJB65170.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
 gb|KJB65171.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=842

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 102/123 (83%), Gaps = 4/123 (3%)
 Frame = +2

Query  272  WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKE  451
            W+L    VF L S     +VSYD KAI+ING+RR+L SGSIHYPRST +MW DLI+KAKE
Sbjct  18   WLLFSSWVFSLVS----ATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKE  73

Query  452  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  631
            GG+DVI+TYVFWN HEPSPGNY FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGG
Sbjct  74   GGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGG  133

Query  632  FPV  640
            FPV
Sbjct  134  FPV  136



>ref|XP_010041868.1| PREDICTED: beta-galactosidase 12-like [Eucalyptus grandis]
Length=121

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +2

Query  323  CSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHEP  502
             S+SYD KAI INGQRR+L SGSIHYPRST EMW DLI KAKEGG+DVI+TYVFWN HEP
Sbjct  20   ASLSYDAKAIKINGQRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEP  79

Query  503  SPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  628
            SPG YNFEG+YDLV+FVK +Q+A LY HLR+GPY+C EWNFG
Sbjct  80   SPGKYNFEGKYDLVKFVKLVQQASLYVHLRVGPYVCAEWNFG  121



>ref|XP_011077976.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=729

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
             LVL ++F L+    + +VSYD KA +ING+RR+L SGSIHYPRST EMW DLI KAK+G
Sbjct  12   TLVLVVLFSLACSSVRATVSYDDKAFIINGKRRILISGSIHYPRSTPEMWPDLIQKAKDG  71

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DVI+TYVFWN HE SPG YNFEGR+DLV+F+K +Q+AGLY HLRIGPY+C EWNFGGF
Sbjct  72   GLDVIQTYVFWNGHEASPGKYNFEGRFDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGF  131

Query  635  PV  640
            PV
Sbjct  132  PV  133



>ref|NP_849553.1| beta-galactosidase 12 [Arabidopsis thaliana]
 sp|Q9SCV0.1|BGA12_ARATH RecName: Full=Beta-galactosidase 12; Short=Lactase 12; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB64748.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEE85162.1| beta-galactosidase 12 [Arabidopsis thaliana]
Length=728

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 103/127 (81%), Gaps = 4/127 (3%)
 Frame = +2

Query  266  RKWVL--VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            + W+L  +LC    + S   +  V+YDRKA++INGQRR+L SGSIHYPRST EMW DLI 
Sbjct  8    KAWILLGILCCSSLICS--VKAIVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQ  65

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+DVI+TYVFWN HEPSPG Y FE RYDLV+F+K +Q+AGLY HLRIGPY+C EW
Sbjct  66   KAKDGGLDVIQTYVFWNGHEPSPGQYYFEDRYDLVKFIKVVQQAGLYVHLRIGPYVCAEW  125

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  126  NFGGFPV  132



>emb|CAB39679.1| putative beta-galactosidase [Arabidopsis thaliana]
 emb|CAB79469.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=729

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 103/127 (81%), Gaps = 4/127 (3%)
 Frame = +2

Query  266  RKWVL--VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            + W+L  +LC    + S   +  V+YDRKA++INGQRR+L SGSIHYPRST EMW DLI 
Sbjct  8    KAWILLGILCCSSLICS--VKAIVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQ  65

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+DVI+TYVFWN HEPSPG Y FE RYDLV+F+K +Q+AGLY HLRIGPY+C EW
Sbjct  66   KAKDGGLDVIQTYVFWNGHEPSPGQYYFEDRYDLVKFIKVVQQAGLYVHLRIGPYVCAEW  125

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  126  NFGGFPV  132



>ref|XP_008805774.1| PREDICTED: beta-galactosidase-like isoform X2 [Phoenix dactylifera]
Length=841

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 102/122 (84%), Gaps = 2/122 (2%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            ++V  MV FLS  L   +VSYD KA++INGQRR+L SGSIHYPRST +MW DLI KAK G
Sbjct  18   LMVALMVAFLS--LGDAAVSYDHKAVIINGQRRILISGSIHYPRSTPDMWPDLIQKAKVG  75

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DVI+TYVFWN HEPSPG Y FEGRYDLVRF+K +++AGLY HLRIGPY+C EWNFGGF
Sbjct  76   GLDVIQTYVFWNAHEPSPGQYYFEGRYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGF  135

Query  635  PV  640
            P+
Sbjct  136  PI  137



>ref|XP_008447606.1| PREDICTED: beta-galactosidase 1 [Cucumis melo]
Length=844

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  263  MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISK  442
            ++ W +++  +        Q SVSYD KAI+INGQRR+L SGSIHYPRST EMW DLI K
Sbjct  9    LKMWNVIMGFLCLFGVFSVQASVSYDSKAIIINGQRRILISGSIHYPRSTSEMWPDLIQK  68

Query  443  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  622
            AKEGG+DVIETYVFWN HEP PG Y FEG YDLVRFVK + +AGLY HLRIGPY+C EWN
Sbjct  69   AKEGGLDVIETYVFWNGHEPEPGKYYFEGNYDLVRFVKLVHQAGLYVHLRIGPYVCAEWN  128

Query  623  FGGFPV  640
            FGGFPV
Sbjct  129  FGGFPV  134



>ref|XP_004146823.1| PREDICTED: beta-galactosidase 1-like [Cucumis sativus]
 ref|XP_004164891.1| PREDICTED: beta-galactosidase 1-like [Cucumis sativus]
Length=841

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  263  MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISK  442
            ++ W +++  + F      Q SVSYD KAI+ING RR+L SGSIHYPRST EMW DLI K
Sbjct  6    LKMWNVIMGFLCFFGVLSVQASVSYDSKAIIINGHRRILISGSIHYPRSTSEMWPDLIQK  65

Query  443  AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  622
            AKEGG+DVIETYVFWN HEP PG Y FEG YDLVRFVK + +AGLY HLRIGPY+C EWN
Sbjct  66   AKEGGLDVIETYVFWNGHEPEPGKYYFEGNYDLVRFVKLVHQAGLYVHLRIGPYVCAEWN  125

Query  623  FGGFPV  640
            FGGFPV
Sbjct  126  FGGFPV  131



>gb|KCW69753.1| hypothetical protein EUGRSUZ_F031302, partial [Eucalyptus grandis]
Length=518

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 100/125 (80%), Gaps = 4/125 (3%)
 Frame = +2

Query  278  LVLCMVFFLSSGL----TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKA  445
            LVL  V  LS G+       SVSYD KAIVINGQRR+L SGSIHYPRST EMW DLI KA
Sbjct  5    LVLWNVLGLSLGVCVFSVLASVSYDSKAIVINGQRRILISGSIHYPRSTPEMWPDLIEKA  64

Query  446  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  625
            KEGG+DVI+TYVFWN HEPSPG Y FEG YDLV+F+K  ++AGLY HLRIGPY+C EWNF
Sbjct  65   KEGGLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFIKLAKQAGLYVHLRIGPYVCAEWNF  124

Query  626  GGFPV  640
            GGFPV
Sbjct  125  GGFPV  129



>ref|XP_008805772.1| PREDICTED: beta-galactosidase-like isoform X1 [Phoenix dactylifera]
Length=846

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 102/122 (84%), Gaps = 2/122 (2%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            ++V  MV FLS  L   +VSYD KA++INGQRR+L SGSIHYPRST +MW DLI KAK G
Sbjct  18   LMVALMVAFLS--LGDAAVSYDHKAVIINGQRRILISGSIHYPRSTPDMWPDLIQKAKVG  75

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DVI+TYVFWN HEPSPG Y FEGRYDLVRF+K +++AGLY HLRIGPY+C EWNFGGF
Sbjct  76   GLDVIQTYVFWNAHEPSPGQYYFEGRYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGF  135

Query  635  PV  640
            P+
Sbjct  136  PI  137



>ref|XP_010545348.1| PREDICTED: beta-galactosidase 12-like isoform X1 [Tarenaya hassleriana]
Length=726

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 103/127 (81%), Gaps = 5/127 (4%)
 Frame = +2

Query  266  RKWVL--VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            + W+L  +LC     S    + +VSYD KA++INGQRR+L SGSIHYPRST EMW DLI 
Sbjct  8    KGWILLVILCCSSISS---VKGAVSYDHKAVIINGQRRILLSGSIHYPRSTPEMWSDLIQ  64

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+DVI+TYVFWN HEPSPGNY FE RYDLVRF++ +QKAGLY HLRIGPY+C EW
Sbjct  65   KAKDGGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIRVVQKAGLYVHLRIGPYVCAEW  124

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  125  NFGGFPV  131



>ref|XP_007138730.1| hypothetical protein PHAVU_009G232500g [Phaseolus vulgaris]
 gb|ESW10724.1| hypothetical protein PHAVU_009G232500g [Phaseolus vulgaris]
Length=722

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = +2

Query  281  VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGV  460
            VL ++F    G+T  SV+YD KAIVI+G+RR+L SGSIHYPRST +MW DLI KAK+GGV
Sbjct  10   VLMLLFLWVCGVT-ASVTYDHKAIVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGV  68

Query  461  DVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            DVI+TYVFWN HEPSPG Y FE RYDLVRFVK +Q+AGLY HLRIGPYIC EWNFGGFPV
Sbjct  69   DVIQTYVFWNGHEPSPGKYYFEDRYDLVRFVKVVQQAGLYVHLRIGPYICAEWNFGGFPV  128



>ref|XP_009418405.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +2

Query  314  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNV  493
            + QC V+YDRKAI+INGQRR+L SGSIHYPRST EMWE LI KAK+  +DVI+TYVFWN 
Sbjct  21   VAQCGVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEGLIQKAKDAHLDVIQTYVFWNG  80

Query  494  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            HEPSPG Y+FEGRYDLV+F+KT+Q  GLY HLRIGPY+C EWNFGGFPV
Sbjct  81   HEPSPGTYDFEGRYDLVKFIKTVQNLGLYVHLRIGPYVCAEWNFGGFPV  129



>ref|XP_003531618.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
 gb|KHN11289.1| Beta-galactosidase 1 [Glycine soja]
Length=843

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 103/128 (80%), Gaps = 2/128 (2%)
 Frame = +2

Query  263  MRKWVLVLCMVFFLSSGLTQCS--VSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLI  436
            ++ W + L +V F  S L Q S  VSYD KAI+INGQRR+L SGSIHYPRST EMW DLI
Sbjct  6    LKVWNVPLLLVVFACSLLGQASASVSYDHKAIIINGQRRILLSGSIHYPRSTPEMWPDLI  65

Query  437  SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  616
             KAKEGG+DVI+TYVFWN HEPSPG Y F G YDLVRF+K +Q+AGLY +LRIGPY+C E
Sbjct  66   QKAKEGGLDVIQTYVFWNGHEPSPGKYYFGGNYDLVRFIKLVQQAGLYVNLRIGPYVCAE  125

Query  617  WNFGGFPV  640
            WNFGGFPV
Sbjct  126  WNFGGFPV  133



>ref|XP_003543598.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=841

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 100/123 (81%), Gaps = 1/123 (1%)
 Frame = +2

Query  272  WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKE  451
            W + L + F L  G  + SVSYD KAI INGQRR+L SGSIHYPRST EMW DLI KAK+
Sbjct  12   WNVALLLAFSLI-GSAKASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKD  70

Query  452  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  631
            GG+DVI+TYVFWN HEPSPG Y FEG YDLV+F+K +Q+AGLY HLRIGPY+C EWNFGG
Sbjct  71   GGLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGG  130

Query  632  FPV  640
            FPV
Sbjct  131  FPV  133



>ref|XP_010438795.1| PREDICTED: beta-galactosidase 12 isoform X1 [Camelina sativa]
Length=728

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 103/127 (81%), Gaps = 4/127 (3%)
 Frame = +2

Query  266  RKWVL--VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            + W+   VLC    + S   + +V+YDRKA++INGQRR+L SGS+HYPRST EMW DLI 
Sbjct  8    KTWIFLGVLCCSSLICS--VKATVTYDRKAVIINGQRRILLSGSVHYPRSTPEMWPDLIQ  65

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+DVI+TYVFWN HEPSPG Y FE RYDLV+F+K +Q+AGLY HLRIGPY+C EW
Sbjct  66   KAKDGGLDVIQTYVFWNGHEPSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEW  125

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  126  NFGGFPV  132



>ref|XP_009418404.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=860

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +2

Query  314  LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNV  493
            + QC V+YDRKAI+INGQRR+L SGSIHYPRST EMWE LI KAK+  +DVI+TYVFWN 
Sbjct  21   VAQCGVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEGLIQKAKDAHLDVIQTYVFWNG  80

Query  494  HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            HEPSPG Y+FEGRYDLV+F+KT+Q  GLY HLRIGPY+C EWNFGGFPV
Sbjct  81   HEPSPGTYDFEGRYDLVKFIKTVQNLGLYVHLRIGPYVCAEWNFGGFPV  129



>ref|XP_010438797.1| PREDICTED: beta-galactosidase 12 isoform X2 [Camelina sativa]
Length=726

 Score =   191 bits (486),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 103/127 (81%), Gaps = 4/127 (3%)
 Frame = +2

Query  266  RKWVL--VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            + W+   VLC    + S   + +V+YDRKA++INGQRR+L SGS+HYPRST EMW DLI 
Sbjct  8    KTWIFLGVLCCSSLICS--VKATVTYDRKAVIINGQRRILLSGSVHYPRSTPEMWPDLIQ  65

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+DVI+TYVFWN HEPSPG Y FE RYDLV+F+K +Q+AGLY HLRIGPY+C EW
Sbjct  66   KAKDGGLDVIQTYVFWNGHEPSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEW  125

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  126  NFGGFPV  132



>ref|XP_010448320.1| PREDICTED: beta-galactosidase 12-like isoform X2 [Camelina sativa]
Length=726

 Score =   191 bits (486),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 103/127 (81%), Gaps = 4/127 (3%)
 Frame = +2

Query  266  RKWVL--VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            + W+   +LC    + S   + +V+YDRKA++INGQRR+L SGSIHYPRST EMW DLI 
Sbjct  8    KAWIFLGILCCSSLICS--VKATVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQ  65

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+DVI+TYVFWN HEPSPG Y FE RYDLV+F+K +Q+AGLY HLRIGPY+C EW
Sbjct  66   KAKDGGLDVIQTYVFWNGHEPSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEW  125

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  126  NFGGFPV  132



>ref|XP_010448319.1| PREDICTED: beta-galactosidase 12-like isoform X1 [Camelina sativa]
Length=728

 Score =   191 bits (486),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 103/127 (81%), Gaps = 4/127 (3%)
 Frame = +2

Query  266  RKWVL--VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            + W+   +LC    + S   + +V+YDRKA++INGQRR+L SGSIHYPRST EMW DLI 
Sbjct  8    KAWIFLGILCCSSLICS--VKATVTYDRKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQ  65

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GG+DVI+TYVFWN HEPSPG Y FE RYDLV+F+K +Q+AGLY HLRIGPY+C EW
Sbjct  66   KAKDGGLDVIQTYVFWNGHEPSPGQYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYVCAEW  125

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  126  NFGGFPV  132



>ref|XP_010051543.1| PREDICTED: beta-galactosidase [Eucalyptus grandis]
Length=790

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            +LVL +V    S    CSVSYDRKAIVI+GQRR+L SGSIHYPRST EMW DL+ KAK G
Sbjct  42   ILVLALVLISWSRSVSCSVSYDRKAIVIDGQRRILISGSIHYPRSTPEMWPDLLQKAKAG  101

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DVI+TYVFWN HEPS G Y FE R+DLVRF+K +Q AGLY HLRIGPY+C EWNFGGF
Sbjct  102  GLDVIQTYVFWNGHEPSRGKYYFEDRFDLVRFIKLVQHAGLYVHLRIGPYVCAEWNFGGF  161

Query  635  PV  640
            PV
Sbjct  162  PV  163



>ref|NP_001266133.1| beta-galactosidase-like [Cicer arietinum]
 emb|CAA06309.1| beta-galactosidase [Cicer arietinum]
Length=730

 Score =   191 bits (486),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 105/127 (83%), Gaps = 2/127 (2%)
 Frame = +2

Query  266  RKWVLVLCMVFFLSSGL--TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            RK+ +V+ +V FL   +     SV+YD KAIVINGQRR+L SGSIHYPRST +MW DLI 
Sbjct  8    RKFYMVIGLVLFLCLFVFSVTASVTYDHKAIVINGQRRILISGSIHYPRSTPQMWPDLIQ  67

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAK+GGVDVI+TYVFWN HEPSPGNY FE R+DLV+FVK +Q+AGLY +LRIGPY+C EW
Sbjct  68   KAKDGGVDVIQTYVFWNGHEPSPGNYYFEDRFDLVKFVKVVQQAGLYVNLRIGPYVCAEW  127

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  128  NFGGFPV  134



>gb|KCW69752.1| hypothetical protein EUGRSUZ_F031302 [Eucalyptus grandis]
Length=546

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 100/125 (80%), Gaps = 4/125 (3%)
 Frame = +2

Query  278  LVLCMVFFLSSGL----TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKA  445
            LVL  V  LS G+       SVSYD KAIVINGQRR+L SGSIHYPRST EMW DLI KA
Sbjct  5    LVLWNVLGLSLGVCVFSVLASVSYDSKAIVINGQRRILISGSIHYPRSTPEMWPDLIEKA  64

Query  446  KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  625
            KEGG+DVI+TYVFWN HEPSPG Y FEG YDLV+F+K  ++AGLY HLRIGPY+C EWNF
Sbjct  65   KEGGLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFIKLAKQAGLYVHLRIGPYVCAEWNF  124

Query  626  GGFPV  640
            GGFPV
Sbjct  125  GGFPV  129



>ref|XP_008450853.1| PREDICTED: beta-galactosidase-like [Cucumis melo]
Length=721

 Score =   191 bits (485),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  LCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVD  463
            + +VF         SV+YD KAI+ING+RR+L SGSIHYPRST +MW DLI KAK+GG+D
Sbjct  7    IMVVFLWVCSSVMASVTYDHKAIIINGRRRILISGSIHYPRSTPQMWPDLIQKAKDGGLD  66

Query  464  VIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            VI+TYVFWN HEPSPG+YNFE RYDLVRFVK +Q+AGLY HLRIGPY+C EWNFGGFPV
Sbjct  67   VIDTYVFWNGHEPSPGHYNFEDRYDLVRFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPV  125



>ref|XP_004985588.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Setaria italica]
Length=841

 Score =   191 bits (486),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +2

Query  332  SYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHEPSPG  511
            +YD+KA++I+GQRR+LFSGSIHYPRST +MWE+LI KAK+GG+DVI+TYVFWN HEP+PG
Sbjct  28   TYDKKAVLIDGQRRILFSGSIHYPRSTPDMWEELIQKAKDGGLDVIQTYVFWNGHEPTPG  87

Query  512  NYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            NY FE RYDLVRFVKT+QKAGL+ HLRIGPYICGEWNFGGFPV
Sbjct  88   NYYFEERYDLVRFVKTVQKAGLFVHLRIGPYICGEWNFGGFPV  130



>ref|XP_002308268.2| hypothetical protein POPTR_0006s14680g [Populus trichocarpa]
 gb|EEE91791.2| hypothetical protein POPTR_0006s14680g [Populus trichocarpa]
Length=837

 Score =   191 bits (486),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  326  SVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHEPS  505
            SVSYD KA++INGQRR+L SGSIHYPRST EMW DLI KAK+GGVDVI+TYVFWN HEPS
Sbjct  26   SVSYDHKAVIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGVDVIQTYVFWNGHEPS  85

Query  506  PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            PGNY FE RYDLV+F+K +Q+AGLY HLRIGPYIC EWNFGGFPV
Sbjct  86   PGNYYFEDRYDLVKFIKLVQQAGLYLHLRIGPYICAEWNFGGFPV  130



>gb|KJB07253.1| hypothetical protein B456_001G011600 [Gossypium raimondii]
Length=642

 Score =   190 bits (483),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 101/123 (82%), Gaps = 4/123 (3%)
 Frame = +2

Query  272  WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKE  451
            W+L    VF L S     +VSYD KAI+ING+RR+L SGSIHYPRST EMW DLI+KAKE
Sbjct  22   WLLFSSWVFSLVS----ATVSYDSKAIIINGRRRILLSGSIHYPRSTPEMWPDLIAKAKE  77

Query  452  GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  631
            GG+DVI+TYVFWN HEPSPG Y FE RYDLVRFVK +Q+AGLY +LRIGPY+C EWNFGG
Sbjct  78   GGLDVIQTYVFWNGHEPSPGKYYFEDRYDLVRFVKLVQQAGLYVNLRIGPYVCAEWNFGG  137

Query  632  FPV  640
            FPV
Sbjct  138  FPV  140



>ref|XP_011045966.1| PREDICTED: beta-galactosidase-like isoform X2 [Populus euphratica]
Length=838

 Score =   191 bits (486),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  326  SVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGVDVIETYVFWNVHEPS  505
            SVSYD KA++INGQRR+L SGSIHYPRST EMW DLI KAK+GGVDVI+TYVFWN HEPS
Sbjct  27   SVSYDHKAVIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGVDVIQTYVFWNGHEPS  86

Query  506  PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            PGNY FE RYDLV+F+K +Q+AGLY HLRIGPYIC EWNFGGFPV
Sbjct  87   PGNYYFEDRYDLVKFIKLVQQAGLYLHLRIGPYICAEWNFGGFPV  131



>ref|XP_009137581.1| PREDICTED: beta-galactosidase 12-like [Brassica rapa]
Length=729

 Score =   191 bits (484),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 102/127 (80%), Gaps = 4/127 (3%)
 Frame = +2

Query  266  RKWVL--VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLIS  439
            + WV   VLC    + S   + +V+YD KA++INGQRR+L SGSIHYPRST EMW DLI 
Sbjct  8    KAWVFLWVLCCSSLICS--VKATVTYDHKAVIINGQRRILLSGSIHYPRSTPEMWPDLIQ  65

Query  440  KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  619
            KAKEGG+DVI+TYVFWN HEPSPG Y FE RYDLV+F+K +Q+AGLY HLRIGPY+C EW
Sbjct  66   KAKEGGLDVIQTYVFWNGHEPSPGQYYFEERYDLVKFIKLVQQAGLYVHLRIGPYVCAEW  125

Query  620  NFGGFPV  640
            NFGGFPV
Sbjct  126  NFGGFPV  132



>ref|XP_010536861.1| PREDICTED: beta-galactosidase 12 [Tarenaya hassleriana]
Length=726

 Score =   191 bits (484),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 105/134 (78%), Gaps = 8/134 (6%)
 Frame = +2

Query  245  KLRGGAMRKWVL--VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLE  418
             LRG A   W+   +LC     S+   + +VSYD KA++INGQRR+L SGSIHYPRST E
Sbjct  4    NLRGKA---WIFLAILCCSSISSA---KAAVSYDHKAVIINGQRRILLSGSIHYPRSTPE  57

Query  419  MWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIG  598
            MW DLI KAK+GG+DVI+TYVFWN HEPSPG Y FE RYDLVRFVK +Q+AGLY HLRIG
Sbjct  58   MWPDLIQKAKDGGLDVIQTYVFWNGHEPSPGKYYFEDRYDLVRFVKLVQQAGLYVHLRIG  117

Query  599  PYICGEWNFGGFPV  640
            PY+C EWNFGGFPV
Sbjct  118  PYVCAEWNFGGFPV  131



>gb|AHL69742.1| beta-galactosidase [Hylocereus undatus]
Length=835

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 102/122 (84%), Gaps = 3/122 (2%)
 Frame = +2

Query  275  VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEG  454
            ++++C+ F L       SV YD+K IV+NGQR++L SGSIHYPRST +MWEDLI+KAK G
Sbjct  11   IILVCVSFVLG---VHSSVIYDKKGIVVNGQRKILISGSIHYPRSTPDMWEDLITKAKHG  67

Query  455  GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  634
            G+DVI+TYVFWN HEPSPG Y FEGRYDLVRF+KT+Q+ GLY +LRIGPY+C EWNFGGF
Sbjct  68   GLDVIDTYVFWNGHEPSPGKYYFEGRYDLVRFIKTVQRVGLYVNLRIGPYVCAEWNFGGF  127

Query  635  PV  640
            PV
Sbjct  128  PV  129



>gb|AAF67341.1| beta galactosidase [Vigna radiata]
Length=721

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = +2

Query  281  VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTLEMWEDLISKAKEGGV  460
            VL ++FF   G+T  SV+YD KAIVI+G+RR+L SGSIHYPRST +MW DLI KAK+GG+
Sbjct  10   VLMLLFFWVCGVT-ASVTYDHKAIVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGL  68

Query  461  DVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  640
            DVI+TYVFWN HEPSPG Y FE RYDLVRFVK  Q+AGLY HLRIGPYIC EWNFGGFPV
Sbjct  69   DVIQTYVFWNGHEPSPGKYYFEDRYDLVRFVKLAQQAGLYVHLRIGPYICAEWNFGGFPV  128



>gb|KDO57768.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
 gb|KDO57769.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=605

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  224  QELALREKLRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYP  403
            +++ ++ K+ G  ++  +LVL           + SVSYD KA++INGQ+R+L SGSIHYP
Sbjct  4    KQVLVKWKMLGANVKVLMLVLLSFCSWEISFVKASVSYDHKAVIINGQKRILISGSIHYP  63

Query  404  RSTLEMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYA  583
            RST EMW DLI KAK+GG+DVI+TYVFWN HEP+ GNY F+ RYDLVRF+K +Q+AGLY 
Sbjct  64   RSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYV  123

Query  584  HLRIGPYICGEWNFGGFPV  640
            HLRIGPY+C EWN+GGFPV
Sbjct  124  HLRIGPYVCAEWNYGGFPV  142



>gb|KDO57767.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=635

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  224  QELALREKLRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYP  403
            +++ ++ K+ G  ++  +LVL           + SVSYD KA++INGQ+R+L SGSIHYP
Sbjct  4    KQVLVKWKMLGANVKVLMLVLLSFCSWEISFVKASVSYDHKAVIINGQKRILISGSIHYP  63

Query  404  RSTLEMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYA  583
            RST EMW DLI KAK+GG+DVI+TYVFWN HEP+ GNY F+ RYDLVRF+K +Q+AGLY 
Sbjct  64   RSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYV  123

Query  584  HLRIGPYICGEWNFGGFPV  640
            HLRIGPY+C EWN+GGFPV
Sbjct  124  HLRIGPYVCAEWNYGGFPV  142



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375