BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS047B11

Length=632
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAR00230.1|  flavonoid 3'-hydroxylase                                337   7e-113   Ipomoea purpurea
dbj|BAD00187.1|  flavonoid 3'-hydroxylase                               341   1e-111   Ipomoea nil [qian niu]
gb|AAR00229.1|  flavonoid 3'-hydroxylase                                336   9e-110   Ipomoea purpurea
gb|ABW69693.1|  flavonoid 3'-hydrogenase                                334   8e-109   Ipomoea purpurea
dbj|BAD00189.1|  flavonoid 3'-hydroxylase                               325   2e-105   Ipomoea tricolor [campanilla]
gb|ACL26685.1|  flavonoid 3'-hydroxylase                                317   3e-102   Ipomoea coccinea [red morning-glory]
gb|AAS46257.1|  flavonoid 3'-hydroxylase                                315   2e-101   Ipomoea quamoclit [bejuco de cipres]
gb|ACL26686.1|  flavonoid 3'-hydroxylase                                311   5e-100   Ipomoea ternifolia
gb|ACS71532.1|  flavonoid 3' hydroxylase                                306   4e-98    Ipomoea horsfalliae [Kuhio-vine]
gb|AEH42499.1|  flavonoid 3'-hydroxylase                                303   5e-97    Ipomoea batatas [batate]
gb|ABW86861.1|  flavonoid 3'-hydroxylase                                301   3e-96    Ipomoea batatas [batate]
gb|ACB29666.1|  flavonoid 3'-hydroxylase                                295   6e-94    Ipomoea batatas [batate]
gb|AEH42501.1|  flavonoid 3'-hydroxylase                                295   6e-94    Ipomoea batatas [batate]
gb|AEH42500.1|  flavonoid 3'-hydroxylase                                295   2e-93    Ipomoea batatas [batate]
dbj|BAJ11756.1|  flavonoid 3'-hydroxylase                               280   1e-87    Calystegia pubescens
dbj|BAJ08322.1|  flavonoid 3'-hydroxylase                               277   7e-87    Calystegia soldanella
dbj|BAE47005.1|  flavonoid 3'-hydroxylase                               261   8e-81    Vitis vinifera
emb|CAI54278.1|  flavonoid-3'-hydroxylase                               261   9e-81    Vitis vinifera
emb|CAN68303.1|  hypothetical protein VITISV_041731                     261   1e-80    Vitis vinifera
gb|AGM46642.1|  flavonoid 3'-hydroxylase protein                        248   3e-80    Apium graveolens
dbj|BAE47003.1|  flavonoid 3'-hydroxylase                               254   5e-80    Vitis vinifera
gb|ACN38268.1|  flavonoid 3' hydroxylase                                259   9e-80    Vitis amurensis
ref|NP_001267916.1|  flavonoid 3' hydroxylase                           258   1e-79    Vitis vinifera
sp|Q9SBQ9.1|F3PH_PETHY  RecName: Full=Flavonoid 3'-monooxygenase;...    258   2e-79    Petunia x hybrida [garden petunia]
emb|CAN62275.1|  hypothetical protein VITISV_007552                     256   3e-79    Vitis vinifera
ref|XP_002284151.1|  PREDICTED: flavonoid 3'-monooxygenase              257   3e-79    Vitis vinifera
dbj|BAE47004.1|  flavonoid 3'-hydroxylase                               256   1e-78    Vitis vinifera
dbj|BAP94456.1|  flavonoid 3'-hydroxylas                                254   8e-78    Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_009788494.1|  PREDICTED: flavonoid 3'-monooxygenase              253   1e-77    Nicotiana sylvestris
gb|AHZ08763.1|  flavonoid 3'-monooxygenase                              253   2e-77    Nicotiana tabacum [American tobacco]
gb|ABA64468.1|  flavonoid 3'-hydroxylase                                252   3e-77    Gerbera hybrid cultivar
gb|ACO35753.1|  flavonoid 3'-hydroxylase                                251   6e-77    Bidens aurea
gb|AGO02167.1|  flavonoid 3'-hydroxylase                                251   9e-77    Nekemias grossedentata
ref|XP_008374610.1|  PREDICTED: flavonoid 3'-monooxygenase-like         251   1e-76    Malus domestica [apple tree]
gb|AHA49900.1|  flavonoid 3' hydroxylase                                250   1e-76    Malus hybrid cultivar
gb|AJO67965.1|  flavonoid-3'-hydroxylase                                241   1e-76    Prunus avium [gean]
dbj|BAO58432.1|  flavonoid 3'-hydroxylase                               250   2e-76    Vaccinium ashei
gb|ACR14869.1|  flavonoid 3' hydroxylase IIb                            250   2e-76    Malus domestica [apple tree]
ref|XP_009597267.1|  PREDICTED: flavonoid 3'-monooxygenase              250   3e-76    Nicotiana tomentosiformis
gb|AHI58943.1|  flavonoid 3'-hydroxylase                                250   3e-76    Nicotiana tabacum [American tobacco]
ref|NP_001289844.1|  flavonoid 3'-monooxygenase                         249   3e-76    Solanum lycopersicum
gb|ABM46853.1|  flavonoid 3'-hydroxylase                                249   5e-76    Ageratina adenophora
ref|XP_006345132.1|  PREDICTED: flavonoid 3'-monooxygenase-like         249   5e-76    Solanum tuberosum [potatoes]
gb|AIY22749.1|  flavonoid 3'-hydroxylase                                249   6e-76    Iochroma cyaneum
emb|CDP19009.1|  unnamed protein product                                248   8e-76    Coffea canephora [robusta coffee]
gb|ADB77826.1|  flavonoid 3'-hydroxylase allele 2                       248   8e-76    Dahlia pinnata
gb|AFI25037.1|  flavonoid 3'-hydroxylase                                238   9e-76    Populus deltoides x Populus tremuloides
gb|ACO35752.1|  flavonoid 3'-hydroxylase                                247   2e-75    Cosmos sulphureus [orange cosmos]
gb|AFQ92056.1|  flavonoid 3' hydroxylase                                248   2e-75    Pyrus pyrifolia [sha li]
emb|CDP19008.1|  unnamed protein product                                247   2e-75    Coffea canephora [robusta coffee]
gb|AEA06595.1|  flavonoid 3'-hydroxylase                                247   3e-75    Chromolaena odorata
gb|AIY22747.1|  flavonoid 3'-hydroxylase                                246   4e-75    Iochroma calycinum
gb|AIY22748.1|  flavonoid 3'-hydroxylase                                246   4e-75    Iochroma calycinum
gb|ABB29899.1|  flavonoid 3'-hydroxylase                                246   5e-75    Osteospermum hybrid cultivar
ref|XP_007037547.1|  Flavonoid 3'-hydroxylase isoform 1                 246   5e-75    
ref|XP_002319761.1|  hypothetical protein POPTR_0013s07050g             246   6e-75    Populus trichocarpa [western balsam poplar]
gb|ACN65825.1|  flavonoid 3'-hydroxylase                                246   6e-75    Cichorium intybus [radicchio]
ref|XP_007037548.1|  Flavonoid 3'-hydroxylase isoform 2                 246   7e-75    Theobroma cacao [chocolate]
ref|XP_010695197.1|  PREDICTED: flavonoid 3'-monooxygenase              246   7e-75    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011011227.1|  PREDICTED: flavonoid 3'-monooxygenase              246   1e-74    Populus euphratica
gb|ADB77825.1|  flavonoid 3'-hydroxylase allele 1                       245   2e-74    Dahlia pinnata
gb|AEF30421.1|  flavonoid 3'-hydroxylase                                237   3e-74    Fagopyrum tataricum [Kangra buckwheat]
gb|KDP31334.1|  hypothetical protein JCGZ_11710                         244   3e-74    Jatropha curcas
dbj|BAN62871.1|  flavonoid 3'-hydroxylase                               244   4e-74    Dianthus caryophyllus [carnation]
gb|ADA85883.1|  flavonoid 3'-hydroxylase                                244   5e-74    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADA85878.1|  flavonoid 3'-hydroxylase                                244   5e-74    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADA85882.1|  flavonoid 3'-hydroxylase                                243   6e-74    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_009338402.1|  PREDICTED: flavonoid 3'-monooxygenase              244   6e-74    Pyrus x bretschneideri [bai li]
gb|ABC47161.1|  flavonoid 3'-hydroxylase                                243   1e-73    Pilosella officinarum [mouse-ear hawkweed]
dbj|BAJ17668.1|  flavonoid 3' hydroxylase                               242   3e-73    Gynura bicolor
gb|ACR14867.1|  flavonoid 3' hydroxylase                                241   4e-73    Malus domestica [apple tree]
ref|XP_008393217.1|  PREDICTED: flavonoid 3'-monooxygenase-like         241   4e-73    
gb|ACV74415.1|  putative flavonoid-3'-hydroxylase                       241   5e-73    Camellia sinensis [black tea]
gb|ADZ54783.1|  flavonoid 3'-monooxygenase                              241   5e-73    Prunus avium [gean]
gb|KDO54631.1|  hypothetical protein CISIN_1g020877mg                   235   7e-73    Citrus sinensis [apfelsine]
gb|ADA85879.1|  flavonoid 3'-hydroxylase                                241   8e-73    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AJA79074.1|  flavonoid 3' hydroxylase                                240   1e-72    Prunus persica
gb|AGC29948.1|  CYP75B65                                                240   1e-72    Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_007209917.1|  hypothetical protein PRUPE_ppa004433mg             240   1e-72    Prunus persica
gb|AAG49298.1|AF313488_1  putative flavonoid 3'-hydroxylase             240   1e-72    Callistephus chinensis [Chinese aster]
ref|XP_010259651.1|  PREDICTED: flavonoid 3'-monooxygenase              240   2e-72    Nelumbo nucifera [Indian lotus]
gb|KJB51033.1|  hypothetical protein B456_008G198200                    237   2e-72    Gossypium raimondii
dbj|BAJ16330.1|  flavonoid 3'-hydroxylase                               239   3e-72    Antirrhinum kelloggii
gb|KDO37751.1|  hypothetical protein CISIN_1g042286mg                   233   3e-72    Citrus sinensis [apfelsine]
gb|ADM26615.1|  flavonoid 3'-hydroxylase                                239   3e-72    Cynara cardunculus var. scolymus [artichoke]
gb|ADA85881.1|  flavonoid 3'-hydroxylase                                238   5e-72    Chrysanthemum x morifolium [florist's chrysanthemum]
dbj|BAF96945.1|  flavonoid 3'-hydroxylase                               238   5e-72    Rhododendron x pulchrum
ref|XP_008240031.1|  PREDICTED: flavonoid 3'-monooxygenase              238   8e-72    Prunus mume [ume]
gb|ADA85880.1|  flavonoid 3'-hydroxylase                                238   1e-71    Chrysanthemum x morifolium [florist's chrysanthemum]
dbj|BAF49324.1|  flavonoid 3'-hydroxylase                               237   2e-71    Lobelia erinus
gb|KHG07922.1|  Flavonoid 3',5'-hydroxylase                             236   3e-71    Gossypium arboreum [tree cotton]
dbj|BAN05297.1|  flavonoid 3'-hydroxylase                               237   3e-71    Dianthus caryophyllus [carnation]
gb|AIU98513.1|  flavonoid 3'-hydroxylase                                236   3e-71    Paeonia suffruticosa [moutan peony]
gb|ADK56126.1|  putative flavonoid 3'-hydroxylase                       236   3e-71    Coreopsis grandiflora
gb|AEN71546.1|  flavanone 3'-hydroxylase                                236   3e-71    Paeonia suffruticosa [moutan peony]
gb|KJB51032.1|  hypothetical protein B456_008G198200                    236   5e-71    Gossypium raimondii
ref|XP_010030596.1|  PREDICTED: flavonoid 3'-monooxygenase-like         235   1e-70    Eucalyptus grandis [rose gum]
gb|ACY06905.1|  flavonoid 3'-hydroxylase                                235   1e-70    Gossypium hirsutum [American cotton]
gb|ADP24158.1|  flavonoid 3'-hydroxylase                                235   1e-70    Gossypium hirsutum [American cotton]
gb|ACO35754.1|  flavonoid 3'-hydroxylase                                235   1e-70    Dahlia pinnata
ref|XP_009771410.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    235   1e-70    Nicotiana sylvestris
gb|ACO35756.1|  flavonoid 3'-hydroxylase                                235   1e-70    Tagetes erecta [big marigold]
gb|ACO35755.1|  chalcone 3-hydroxylase                                  235   1e-70    Cosmos sulphureus [orange cosmos]
ref|XP_010258076.1|  PREDICTED: flavonoid 3'-monooxygenase-like         235   1e-70    Nelumbo nucifera [Indian lotus]
gb|AEX07282.1|  F3'H                                                    235   1e-70    Arachis hypogaea [goober]
gb|ADT63065.1|  flavonoid 3'-hydroxylase                                233   1e-70    Fagopyrum esculentum
gb|ACO35757.1|  flavonoid 3'-hydroxylase                                234   2e-70    Rudbeckia hirta
gb|AAO47850.1|  defective flavonoid 3'-hydroxylase                      228   2e-70    Glycine max [soybeans]
ref|XP_006440736.1|  hypothetical protein CICLE_v10019637mg             234   4e-70    
gb|ACN65827.1|  flavonoid 3'-hydroxylase                                233   5e-70    Centaurea cyanus [bachelor's-button]
gb|ACM62746.1|  flavonoid 3'-hydroxylase                                233   5e-70    Garcinia mangostana [mangosteen]
gb|AHZ31753.1|  flavonoid 3'-hydroxylase                                233   5e-70    Viola x wittrockiana
gb|ACN65826.1|  flavonoid 3'-hydroxylase                                233   6e-70    Echinops bannaticus
ref|XP_006477655.1|  PREDICTED: flavonoid 3'-monooxygenase-like         233   1e-69    Citrus sinensis [apfelsine]
gb|ABB53383.1|  flavonoid-3'-hydroxylase                                232   2e-69    Antirrhinum majus [garden snapdragon]
gb|AAO47844.1|  gray pubescence flavonoid 3'-hydroxylase                228   2e-69    Glycine max [soybeans]
gb|AGL81348.1|  flavanone 3' hydroxylase                                231   4e-69    Pyrus communis
dbj|BAE71221.1|  putative flavonoid 3'-hydroxylase                      231   6e-69    Trifolium pratense [peavine clover]
ref|XP_011072866.1|  PREDICTED: flavonoid 3'-monooxygenase              230   7e-69    Sesamum indicum [beniseed]
ref|XP_007138248.1|  hypothetical protein PHAVU_009G192400g             230   9e-69    Phaseolus vulgaris [French bean]
gb|KEH32010.1|  flavonoid hydroxylase                                   230   9e-69    Medicago truncatula
ref|XP_003598945.1|  Flavonoid 3'-hydroxylase                           230   1e-68    Medicago truncatula
gb|KEH33153.1|  flavonoid hydroxylase                                   230   1e-68    Medicago truncatula
gb|AFI71898.1|  flavonoid 3'-hydroxylase                                229   2e-68    Paeonia lactiflora [common garden peony]
ref|XP_006399285.1|  hypothetical protein EUTSA_v10013289mg             229   3e-68    Eutrema salsugineum [saltwater cress]
gb|ADZ28515.1|  flavonoid-3'-hydroxylase                                229   3e-68    Camellia nitidissima
dbj|BAD91808.1|  flavonoid 3'-hydroxylase                               228   5e-68    Gentiana triflora
gb|AIY51699.1|  flavonoid 3'-hydroxylase                                228   6e-68    Penstemon barbatus
gb|KHN17812.1|  Flavonoid 3'-monooxygenase                              228   7e-68    Glycine soja [wild soybean]
gb|ACR33790.1|  flavonoid 3'-hydroxylase                                228   7e-68    Glycine max [soybeans]
gb|AHY35313.1|  flavonoid 3'-hydroxylase 1                              228   7e-68    Morus notabilis
ref|NP_001237015.1|  flavonoid 3'-hydroxylase                           228   7e-68    Glycine max [soybeans]
gb|ABY89687.1|  flavonoid 3` hydroxylase 1 protein                      228   8e-68    Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_010105826.1|  Flavonoid 3'-monooxygenase                         228   8e-68    Morus notabilis
ref|XP_010491421.1|  PREDICTED: flavonoid 3'-monooxygenase-like         227   1e-67    Camelina sativa [gold-of-pleasure]
emb|CDX69984.1|  BnaA10g23330D                                          227   1e-67    
gb|ABC58722.1|  flavonoid 3'-hydroxylase                                227   1e-67    Brassica napus [oilseed rape]
ref|XP_004508739.1|  PREDICTED: flavonoid 3'-monooxygenase-like         227   1e-67    
gb|AGI16386.1|  flavonoid 3' hydroxylase                                227   1e-67    Ribes nigrum [European black currant]
ref|XP_009122411.1|  PREDICTED: flavonoid 3'-monooxygenase              227   1e-67    Brassica rapa
gb|ABY89688.1|  flavonoid 3` hydroxylase 2 protein                      227   2e-67    Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_010423152.1|  PREDICTED: flavonoid 3'-monooxygenase-like         226   4e-67    Camelina sativa [gold-of-pleasure]
gb|AIT52346.1|  flavonoid 3'-monooxygenase 1                            226   5e-67    Daucus carota [carrots]
ref|XP_002871298.1|  hypothetical protein ARALYDRAFT_487632             225   6e-67    
gb|AAG49301.1|AF313491_1  flavonoid 3'-hydroxylase                      225   9e-67    Matthiola incana
gb|AAG49315.1|AF315465_1  flavonoid 3'-hydroxylase                      224   1e-66    Pelargonium x hortorum [bedding geranium]
gb|EYU23554.1|  hypothetical protein MIMGU_mgv1a004224mg                225   1e-66    Erythranthe guttata [common monkey flower]
gb|ADE80941.1|  flavonoid 3'-hydroxylase                                224   1e-66    Epimedium sagittatum
gb|AIY51698.1|  flavonoid 3'-hydroxylase                                224   1e-66    Penstemon neomexicanus
gb|EPS57881.1|  flavonoid 3'-hydroxylase                                222   1e-66    Genlisea aurea
gb|AIB06740.1|  flavanone 3'-hydroxylase                                224   2e-66    Mangifera indica
gb|ACJ85671.1|  unknown                                                 221   2e-66    Medicago truncatula
ref|XP_010452770.1|  PREDICTED: flavonoid 3'-monooxygenase              224   2e-66    Camelina sativa [gold-of-pleasure]
emb|CDX99037.1|  BnaC09g47980D                                          228   3e-66    
ref|XP_004515962.1|  PREDICTED: flavonoid 3'-monooxygenase-like         223   3e-66    
gb|AEE60888.1|  flavonoid 3'-hydroxylase                                223   5e-66    Fragaria chiloensis
dbj|BAL63027.1|  flavonoid 3'-hydroxylase                               222   9e-66    Fragaria x ananassa
gb|AEE60886.1|  flavonoid 3'-hydroxylase                                222   1e-65    Fragaria x ananassa
ref|NP_001274347.1|  uncharacterized protein LOC101314754               222   1e-65    Fragaria vesca [alpine strawberry]
gb|AGO03825.1|  flavonoid 3`5`-hydroxylase                              222   1e-65    Cichorium intybus [radicchio]
gb|AEE60887.1|  flavonoid 3'-hydroxylase                                222   1e-65    Fragaria virginiana
gb|AEE60883.1|  flavonoid 3'-hydroxylase                                222   1e-65    Fragaria vesca [alpine strawberry]
gb|AGT28741.1|  flavonoid 3'-hydroxylase                                221   2e-65    Fragaria x ananassa
gb|AGO03824.1|  flavonoid 3`5`-hydroxylase                              221   3e-65    Echinops bannaticus
ref|NP_196416.1|  Flavonoid 3'-monooxygenase                            221   3e-65    Arabidopsis thaliana [mouse-ear cress]
gb|AES69199.2|  flavonoid hydroxylase                                   221   4e-65    Medicago truncatula
gb|AEE60885.1|  flavonoid 3'-hydroxylase                                220   5e-65    Fragaria x ananassa
dbj|BAB59005.1|  flavonoid 3'-hydroxylase                               220   6e-65    Perilla frutescens var. crispa
gb|AGY55961.1|  flavonoid 3'-hydroxylase                                214   2e-64    Punica granatum [granado]
gb|ABB43031.1|  flavonoid 3'5'-hydroxylase                              218   4e-64    Osteospermum hybrid cultivar
ref|XP_003598948.1|  Flavonoid 3'-hydroxylase                           219   5e-64    
ref|XP_010030575.1|  PREDICTED: flavonoid 3'-monooxygenase-like         217   9e-64    Eucalyptus grandis [rose gum]
gb|AJD25177.1|  cytochrome P450 CYP75B79                                215   6e-63    Salvia miltiorrhiza [Chinese salvia]
gb|AJD25178.1|  cytochrome P450 CYP75B80                                214   9e-63    Salvia miltiorrhiza [Chinese salvia]
ref|XP_006287545.1|  hypothetical protein CARUB_v10000754mg             214   1e-62    Capsella rubella
emb|CDP16533.1|  unnamed protein product                                211   4e-62    Coffea canephora [robusta coffee]
gb|ABB43030.1|  flavonoid 3'5'-hydroxylase                              212   8e-62    Pericallis cruenta
gb|AAG49299.1|AF313489_1  flavonoid 3',5'-hydroxylase                   211   2e-61    Callistephus chinensis [Chinese aster]
gb|AGT50310.1|  flavonoid 3'-hydroxylase                                209   5e-61    Meconopsis simplicifolia
gb|AGT50309.1|  flavonoid 3'-hydroxylase                                209   6e-61    Meconopsis delavayi
gb|AAX19888.1|  flavonoid-3',5'-hydroxylase                             208   1e-60    Pericallis cruenta
gb|AGT50311.1|  flavonoid 3'-hydroxylase                                207   2e-60    Meconopsis horridula [prickly blue-poppy]
ref|XP_010105825.1|  Flavonoid 3'-monooxygenase                         208   3e-60    Morus notabilis
ref|XP_010522799.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    204   4e-60    
gb|AGT50313.1|  flavonoid 3'-hydroxylase                                206   5e-60    Meconopsis lancifolia
ref|XP_010522791.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    205   1e-59    Tarenaya hassleriana [spider flower]
gb|AGO03826.1|  flavonoid 3`5`-hydroxylase                              206   1e-59    Billardiera heterophylla
gb|AGT50318.1|  flavonoid 3'-hydroxylase                                206   1e-59    Meconopsis punicea [red poppywort]
ref|XP_010522758.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    204   3e-59    Tarenaya hassleriana [spider flower]
ref|XP_010522775.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    204   3e-59    Tarenaya hassleriana [spider flower]
ref|XP_002514665.1|  flavonoid 3-hydroxylase, putative                  202   1e-58    
gb|KHN18348.1|  Flavonoid 3'-monooxygenase                              204   1e-58    Glycine soja [wild soybean]
ref|XP_003525447.1|  PREDICTED: flavonoid 3'-monooxygenase-like         203   1e-58    Glycine max [soybeans]
dbj|BAB87839.1|  flavonoid 3'-hydroxalase                               201   2e-58    Torenia hybrid cultivar
ref|XP_010522750.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    204   2e-58    
ref|XP_010522740.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    204   3e-58    Tarenaya hassleriana [spider flower]
ref|XP_003525448.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    202   5e-58    Glycine max [soybeans]
dbj|BAE72874.1|  flavonoid 3'-hydroxylase                               201   6e-58    Glandularia x hybrida [garden verbena]
gb|KHN48735.1|  Flavonoid 3'-monooxygenase                              201   9e-58    Glycine soja [wild soybean]
ref|XP_003550701.1|  PREDICTED: flavonoid 3'-monooxygenase-like         201   1e-57    
gb|AHL83556.1|  flavonoid-3'-hydroxylase                                200   2e-57    Iris x hollandica [Dutch iris]
dbj|BAB87838.1|  flavonoid 3'-hydroxylase                               199   4e-57    Torenia hybrid cultivar
gb|AFK73718.1|  cytochrome P450                                         197   2e-56    Papaver somniferum
ref|XP_010030579.1|  PREDICTED: flavonoid 3'-monooxygenase-like         197   4e-56    Eucalyptus grandis [rose gum]
dbj|BAM28972.1|  flavonoid 3'-hydroxylase                               196   1e-55    Lilium hybrid division I
gb|AHY35314.1|  flavonoid 3'-hydroxylase 2                              195   1e-55    Morus notabilis
dbj|BAM28971.1|  flavonoid 3'-hydroxylase                               194   3e-55    Lilium hybrid division I
ref|XP_006665050.1|  PREDICTED: flavonoid 3'-monooxygenase-like         191   5e-54    Oryza brachyantha
ref|XP_008453263.1|  PREDICTED: flavonoid 3'-monooxygenase              191   5e-54    Cucumis melo [Oriental melon]
ref|XP_009394321.1|  PREDICTED: flavonoid 3'-monooxygenase              191   1e-53    
gb|AAS48419.1|  flavonoid 3'-hydroxylase                                190   1e-53    Allium cepa
gb|AFW72123.1|  red aleurone1                                           189   3e-53    
gb|AIC73642.1|  flavonoid 3'-hydroxylase                                188   5e-53    Anthurium andraeanum [flamingo-lily]
ref|XP_004983036.1|  PREDICTED: flavonoid 3'-monooxygenase-like         188   7e-53    Setaria italica
ref|XP_004138192.1|  PREDICTED: flavonoid 3'-monooxygenase-like         187   3e-52    Cucumis sativus [cucumbers]
gb|KGN63720.1|  Flavonoid 3' hydroxylase                                186   3e-52    Cucumis sativus [cucumbers]
gb|AFP95893.1|  F3'H                                                    186   4e-52    Narcissus tazetta
ref|NP_001064338.1|  Os10g0320100                                       185   2e-51    
gb|KCW83706.1|  hypothetical protein EUGRSUZ_B00580                     182   4e-51    Eucalyptus grandis [rose gum]
gb|AGG40645.1|  flavanone 3'-hydroxylase                                184   4e-51    Narcissus tazetta
ref|XP_003525450.1|  PREDICTED: flavonoid 3'-monooxygenase-like         183   4e-51    Glycine max [soybeans]
gb|AGJ50589.1|  flavonoid 3'-hydroxylase                                183   5e-51    Tulipa fosteriana
gb|KCW83705.1|  hypothetical protein EUGRSUZ_B00580                     182   5e-51    Eucalyptus grandis [rose gum]
gb|KHN48734.1|  Flavonoid 3'-monooxygenase                              183   5e-51    Glycine soja [wild soybean]
gb|AGT50323.1|  flavonoid 3'-hydroxylase                                181   1e-50    Meconopsis pseudohorridula
dbj|BAH22519.1|  flavonoid 3' hydroxylase                               182   2e-50    Tricyrtis hirta
emb|CDP16353.1|  unnamed protein product                                172   2e-50    Coffea canephora [robusta coffee]
ref|XP_002439914.1|  hypothetical protein SORBIDRAFT_09g022480          182   2e-50    Sorghum bicolor [broomcorn]
gb|ABG54319.1|  flavonoid 3'-hydroxylase                                181   3e-50    Sorghum bicolor [broomcorn]
ref|XP_008678758.1|  PREDICTED: flavonoid 3'-monooxygenase-like         181   4e-50    Zea mays [maize]
ref|XP_002452380.1|  hypothetical protein SORBIDRAFT_04g024710          181   4e-50    Sorghum bicolor [broomcorn]
gb|ABG54320.1|  flavonoid 3'-hydroxylase                                181   5e-50    Sorghum bicolor [broomcorn]
dbj|BAM28973.1|  flavonoid 3'-hydroxylase                               179   5e-50    Lilium hybrid division I
gb|AGT50312.1|  flavonoid 3'-hydroxylase                                179   6e-50    Meconopsis racemosa
gb|AGT50315.1|  flavonoid 3'-hydroxylase                                179   7e-50    Meconopsis betonicifolia [Himalayan blue-poppy]
gb|AGT50317.1|  flavonoid 3'-hydroxylase                                179   7e-50    Meconopsis zangnanensis
gb|AGT50314.1|  flavonoid 3'-hydroxylase                                179   8e-50    Meconopsis henrici
gb|AII26680.1|  flavonoid 3'-hydroxylase                                180   8e-50    Indosasa hispida
gb|AEF33624.1|  flavonoid 3' hydroxylase                                180   1e-49    Zea mays [maize]
gb|AGT50324.1|  flavonoid 3'-hydroxylase                                178   1e-49    Papaver nudicaule [Arctic poppy]
gb|ABG54321.1|  flavonoid 3'-hydroxylase                                179   1e-49    Sorghum bicolor [broomcorn]
ref|XP_002452385.1|  hypothetical protein SORBIDRAFT_04g024730          179   1e-49    Sorghum bicolor [broomcorn]
ref|XP_002454110.1|  hypothetical protein SORBIDRAFT_04g024750          179   2e-49    
gb|AGT50325.1|  flavonoid 3'-hydroxylase                                177   2e-49    Papaver radicatum
gb|AGT50316.1|  flavonoid 3'-hydroxylase                                177   2e-49    Meconopsis integrifolia [Farrer's lampshade-poppy]
gb|AGT50319.1|  flavonoid 3'-hydroxylase                                177   3e-49    Meconopsis quintuplinervia
gb|AGT50321.1|  flavonoid 3'-hydroxylase                                177   5e-49    Meconopsis wilsonii
gb|ADX95997.1|  flavonoid 3'-hydroxylase                                167   1e-48    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AFW62812.1|  putative cytochrome P450 superfamily protein            181   1e-48    
gb|AAV74194.1|  flavonoid 3'-hydroxylase                                177   1e-48    Sorghum bicolor [broomcorn]
gb|AII26679.1|  flavonoid 3'-monooxygenase                              176   4e-48    Indosasa hispida
ref|XP_010939156.1|  PREDICTED: flavonoid 3'-monooxygenase-like         175   8e-48    Elaeis guineensis
dbj|BAB17054.1|  unnamed protein product                                165   9e-48    Arabidopsis thaliana [mouse-ear cress]
gb|AGT50322.1|  flavonoid 3'-hydroxylase                                172   2e-47    Meconopsis gracilipes
ref|XP_008791304.1|  PREDICTED: flavonoid 3'-monooxygenase-like         174   2e-47    Phoenix dactylifera
ref|XP_006661696.1|  PREDICTED: flavonoid 3'-monooxygenase-like         173   4e-47    
dbj|BAJ95115.1|  predicted protein                                      172   6e-47    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACG38346.1|  flavonoid 3-monooxygenase                               171   2e-46    Zea mays [maize]
ref|XP_008678806.1|  PREDICTED: flavonoid 3'-monooxygenase-like         171   2e-46    
ref|NP_001146311.1|  uncharacterized protein LOC100279887               171   2e-46    Zea mays [maize]
ref|NP_001141292.1|  uncharacterized protein LOC100273383               170   2e-46    
ref|XP_003574810.2|  PREDICTED: flavonoid 3'-monooxygenase-like         171   3e-46    Brachypodium distachyon [annual false brome]
dbj|BAJ98136.1|  predicted protein                                      169   9e-46    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGT50320.1|  flavonoid 3'-hydroxylase                                167   1e-45    Meconopsis paniculata
gb|EAY78004.1|  hypothetical protein OsI_33044                          169   2e-45    Oryza sativa Indica Group [Indian rice]
ref|NP_001064333.1|  Os10g0317900                                       169   2e-45    
gb|EMS47585.1|  Flavonoid 3'-monooxygenase                              162   1e-44    Triticum urartu
ref|XP_003577475.1|  PREDICTED: flavonoid 3'-monooxygenase-like         166   2e-44    Brachypodium distachyon [annual false brome]
dbj|BAH89259.1|  putative flavonoid 3'-hydroxylase                      164   2e-44    Diospyros kaki [Japanese persimmon]
ref|XP_010233685.1|  PREDICTED: flavonoid 3'-monooxygenase-like         166   3e-44    Brachypodium distachyon [annual false brome]
dbj|BAJ93256.1|  predicted protein                                      162   4e-43    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABV53919.1|  flavonoid 3'-hydroxylase                                150   2e-42    Gerbera hybrid cultivar
gb|ABR16821.1|  unknown                                                 159   3e-42    Picea sitchensis
gb|AAO47856.1|  flavonoid 3'-hydroxylase                                149   2e-41    Glycine max [soybeans]
gb|AHX02955.1|  flavonoid 3'5'-hydroxylase                              155   1e-40    Iris x hollandica [Dutch iris]
ref|XP_003562884.1|  PREDICTED: flavonoid 3'-monooxygenase-like         155   2e-40    
gb|EMT24087.1|  Flavonoid 3'-monooxygenase                              151   3e-39    
gb|ACL26688.1|  flavonoid 3'-hydroxylase                                146   7e-39    Ipomoea lobata [cresta de gallo]
gb|ACL26687.1|  flavonoid 3'-hydroxylase                                146   8e-39    Ipomoea lutea
ref|XP_002314004.1|  hypothetical protein POPTR_0009s07320g             150   1e-38    
ref|XP_010247486.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      148   1e-38    
dbj|BAF93855.1|  flavonoid 3',5'-hydroxylase                            149   1e-38    
gb|EEE50732.1|  hypothetical protein OsJ_31043                          149   2e-38    
dbj|BAL61235.1|  flavonoid 3',5'-hydroxylase                            149   2e-38    
dbj|BAK64099.1|  flavonoid 3',5'-hydroxylase                            149   3e-38    
sp|Q96418.1|C75A5_EUSER  RecName: Full=Flavonoid 3',5'-hydroxylas...    148   3e-38    
ref|XP_010031713.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      148   4e-38    
gb|AGA82781.1|  flavonoid 3' hydroxylase 1                              144   4e-38    
dbj|BAH98132.1|  flavonoid 3',5'-hydroxylase                            148   5e-38    
ref|XP_010247479.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      147   6e-38    
dbj|BAH98133.1|  flavonoid 3',5'-hydroxylase                            147   7e-38    
dbj|BAF96946.1|  flavonoid 3',5'-hydroxylase                            147   7e-38    
ref|XP_011009110.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      147   8e-38    
ref|XP_006579509.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    145   9e-38    
gb|AGC30728.1|  flavonoid 3',5'-hydroxylase                             143   1e-37    
dbj|BAE86871.1|  flavonoid 3',5'-hydroxylase                            146   1e-37    
gb|KDP43193.1|  hypothetical protein JCGZ_22745                         146   2e-37    
ref|XP_003636773.1|  Flavonoid 3' 5'-hydroxylase                        140   4e-37    
gb|AFD04990.1|  flavonoid 3'5'-hydroxylase                              140   4e-37    
ref|XP_006837147.1|  hypothetical protein AMTR_s00110p00149730          145   4e-37    
ref|XP_007155246.1|  hypothetical protein PHAVU_003G1855000g            137   5e-37    
sp|O04790.1|C75A7_EUSER  RecName: Full=Flavonoid 3',5'-hydroxylas...    145   6e-37    
ref|XP_010045076.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      145   7e-37    
gb|KCW87228.1|  hypothetical protein EUGRSUZ_B03742                     145   7e-37    
gb|KCW87229.1|  hypothetical protein EUGRSUZ_B03742                     145   7e-37    
gb|ACN60403.1|  flavonoid-3',5'-hydroxylase                             143   7e-37    
dbj|BAC10997.1|  flavonoid 3',5'-hydroxylase                            144   8e-37    
dbj|BAK74845.1|  mutated flavonoid 3', 5' hydroxylase                   142   9e-37    
gb|ACN58569.1|  flavonoid 3',5'-hydroxylase                             144   1e-36    
sp|Q96581.1|C75A4_GENTR  RecName: Full=Flavonoid 3',5'-hydroxylas...    144   1e-36    
ref|XP_010045081.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      144   1e-36    
gb|EMS66050.1|  Flavonoid 3'-monooxygenase                              140   1e-36    
gb|AIM58719.1|  flavonoid 3'hydroxylase                                 144   2e-36    
gb|AAV85472.1|  flavonoid 3',5'-hydroxylase                             140   2e-36    
dbj|BAH89265.1|  flavonoid 3'5' hydroxylase                             143   2e-36    
ref|NP_001234840.1|  putative flavonoid 3'5' hydroxylase                143   2e-36    
gb|AFD05037.1|  flavonoid 3'5'-hydroxylase                              138   2e-36    
dbj|BAF64483.1|  flavonoid-3',5'-hydroxylase                            140   2e-36    
gb|AAP31058.1|  flavonoid 3',5'-hydroxylase                             143   2e-36    
gb|AFD05046.1|  flavonoid 3'5'-hydroxylase                              138   2e-36    
gb|KJB09328.1|  hypothetical protein B456_001G134900                    143   3e-36    
gb|AFD05005.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
ref|XP_006446310.1|  hypothetical protein CICLE_v10018289mg             143   3e-36    
gb|AFD05023.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AFD05051.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AFD04984.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AFD04986.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AFD05065.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AFD05026.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AFD04973.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AFD05017.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AFD04975.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AFD05008.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AFD05035.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AFD05019.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AFD04970.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AFD05042.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
ref|XP_007015254.1|  Flavonoid 3',5'-hydroxylase 2 isoform 1            143   4e-36    
gb|AFD05011.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AFD04969.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AFD05024.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AFD04980.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|ACH56524.1|  flavonoid 3'5'-hydroxylase                              142   4e-36    
gb|AFD04985.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AFD05012.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AFD04971.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|AIY22750.1|  flavonoid 3',5'-hydroxylase                             142   4e-36    
gb|AIX10138.1|  flavonoid 3',5'-hydroxylase                             142   5e-36    
ref|XP_010045077.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      142   5e-36    
dbj|BAJ08041.1|  flavonoid 3',5'-hydroxylase                            142   6e-36    
gb|AIY22751.1|  flavonoid 3',5'-hydroxylase                             142   6e-36    
gb|AFD05057.1|  flavonoid 3'5'-hydroxylase                              137   7e-36    
gb|ADV39275.1|  flavonoid 3',5'-hydroxylase                             137   7e-36    
gb|AFD05050.1|  flavonoid 3'5'-hydroxylase                              136   7e-36    
gb|AFD05020.1|  flavonoid 3'5'-hydroxylase                              136   8e-36    
gb|AFD04978.1|  flavonoid 3'5'-hydroxylase                              136   8e-36    
gb|AFD05032.1|  flavonoid 3'5'-hydroxylase                              136   8e-36    
gb|ADV39279.1|  flavonoid 3',5'-hydroxylase                             137   8e-36    
sp|P37120.1|C75A2_SOLME  RecName: Full=Flavonoid 3',5'-hydroxylas...    142   8e-36    
gb|AGI16385.1|  flavonoid 3', 5'-hydroxylase                            142   8e-36    
gb|ADV39282.1|  flavonoid 3',5'-hydroxylase                             137   8e-36    
gb|ACZ63206.1|  flavonoid 3',5'-hydroxylase                             141   8e-36    
gb|ADV39278.1|  flavonoid 3',5'-hydroxylase                             137   9e-36    
gb|AFD05052.1|  flavonoid 3'5'-hydroxylase                              136   9e-36    
gb|AFD05064.1|  flavonoid 3'5'-hydroxylase                              136   9e-36    
gb|AFD05010.1|  flavonoid 3'5'-hydroxylase                              136   9e-36    
gb|ADV39281.1|  flavonoid 3',5'-hydroxylase                             137   9e-36    
gb|AIY22752.1|  flavonoid 3',5'-hydroxylase                             141   9e-36    
gb|ACX37698.1|  flavonoid 3',5'-hydroxylase                             141   1e-35    
gb|ACZ63205.1|  flavonoid 3',5'-hydroxylase                             141   1e-35    
gb|ADV39277.1|  flavonoid 3',5'-hydroxylase                             137   1e-35    
gb|ADV39273.1|  flavonoid 3',5'-hydroxylase                             137   1e-35    
dbj|BAF64482.1|  flavonoid-3',5'-hydroxylase                            140   1e-35    
gb|ACY06904.1|  flavonoid 3'5'-hydroxylase                              141   1e-35    
dbj|BAK74846.1|  flavonoid 3', 5' hydroxylase                           141   1e-35    
gb|AAY23287.1|  flavonoid 3',5'-hydroxylase                             141   1e-35    
gb|AFD04994.1|  flavonoid 3'5'-hydroxylase                              135   2e-35    
gb|AFD04991.1|  flavonoid 3'5'-hydroxylase                              135   2e-35    
gb|ABA40923.1|  flavonoid 3',5'-hydroxylase                             140   2e-35    
gb|ADV39276.1|  flavonoid 3',5'-hydroxylase                             136   2e-35    
dbj|BAF34566.1|  flavonoid 3',5'-hydroxylase                            140   2e-35    
ref|XP_009619846.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1           140   2e-35    
dbj|BAC97831.1|  Flavonoid 3',5'-hydroxylase                            140   2e-35    
gb|KHF97502.1|  Flavonoid 3',5'-hydroxylase 2                           140   2e-35    
emb|CAA50442.1|  P450 hydroxylase                                       139   3e-35    
gb|AFD04977.1|  flavonoid 3'5'-hydroxylase                              135   3e-35    
ref|XP_003638766.1|  Flavonoid 3' 5'-hydroxylase                        140   3e-35    
gb|KEH33357.1|  flavonoid hydroxylase                                   140   4e-35    
dbj|BAF34559.1|  flavonoid 3',5'-hydroxylase                            139   4e-35    
gb|ADV39274.1|  flavonoid 3',5'-hydroxylase                             135   4e-35    
dbj|BAF34571.1|  flavonoid 3',5'-hydroxylase                            139   4e-35    
gb|AFD05049.1|  flavonoid 3'5'-hydroxylase                              134   4e-35    
dbj|BAF34557.1|  flavonoid 3',5'-hydroxylase                            139   4e-35    
gb|AFD05059.1|  flavonoid 3'5'-hydroxylase                              134   5e-35    
sp|P48418.1|C75A1_PETHY  RecName: Full=Flavonoid 3',5'-hydroxylas...    139   5e-35    
dbj|BAF34569.1|  flavonoid 3',5'-hydroxylase                            139   5e-35    
dbj|BAF34575.1|  flavonoid 3',5'-hydroxylase                            139   5e-35    
dbj|BAF34560.1|  flavonoid 3',5'-hydroxylase                            139   5e-35    
gb|ABN42195.1|  flavonoid-3',5'-hydroxylase                             139   5e-35    
dbj|BAF34563.1|  flavonoid 3',5'-hydroxylase                            139   5e-35    
dbj|BAF34561.1|  flavonoid 3',5'-hydroxylase                            139   5e-35    
dbj|BAF34572.1|  flavonoid 3',5'-hydroxylase                            139   5e-35    
dbj|BAF34562.1|  flavonoid 3',5'-hydroxylase                            139   5e-35    
gb|ABY77007.1|  flavonoid 3',5'-hydroxylase                             139   6e-35    
gb|AFD05054.1|  flavonoid 3'5'-hydroxylase                              134   6e-35    
gb|AIX10137.1|  flavonoid 3',5'-hydroxylase                             139   7e-35    
gb|AAG49300.1|AF313490_1  flavonoid 3',5'-hydroxylase                   139   8e-35    
ref|XP_006349127.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    139   8e-35    
dbj|BAF34558.1|  flavonoid 3',5'-hydroxylase                            139   8e-35    
dbj|BAF34568.1|  flavonoid 3',5'-hydroxylase                            139   9e-35    
gb|AAX51796.1|  flavonoid 3'5'-hydroxylase                              139   9e-35    
ref|NP_001274807.1|  flavonoid 3',5'-hydroxylase                        139   1e-34    
dbj|BAJ09746.1|  flavonoid 3',5'-hydroxylase                            139   1e-34    
dbj|BAO66642.1|  flavonoid 3',5'-hydroxylase                            139   1e-34    
gb|AIX10136.1|  flavonoid 3',5'-hydroxylase                             138   1e-34    
gb|AIX10142.1|  flavonoid 3',5'-hydroxylase                             138   1e-34    
dbj|BAO04188.1|  flavonoid 3'5'-hydroxylase                             138   1e-34    
dbj|BAJ16328.1|  flavonoid 3',5'-hydroxylase                            138   1e-34    
gb|ABQ96219.1|  flavonoid 3'5' hydroxylase                              138   1e-34    
gb|AIX10140.1|  flavonoid 3',5'-hydroxylase                             138   1e-34    
ref|XP_010651523.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      138   1e-34    
dbj|BAF34567.1|  flavonoid 3',5'-hydroxylase                            138   1e-34    
gb|AIX10133.1|  flavonoid 3',5'-hydroxylase                             138   2e-34    
gb|AIX10135.1|  flavonoid 3',5'-hydroxylase                             138   2e-34    
gb|AIX10139.1|  flavonoid 3',5'-hydroxylase                             138   2e-34    
dbj|BAE47007.1|  flavonoid 3',5'-hydroxylase                            138   2e-34    
dbj|BAM09186.1|  flavonoid 3'5'-hydroxylase                             138   2e-34    
gb|AJA40049.1|  flavonoid 3'5'-hydroxylase                              138   2e-34    
gb|AIX10134.1|  flavonoid 3',5'-hydroxylase                             138   2e-34    
dbj|BAJ14025.1|  flavonoid 3'5'-hydroxylase                             138   2e-34    
ref|NP_001236632.1|  flavonoid 3', 5'-hydroxylase                       138   2e-34    
gb|ABQ96218.1|  flavonoid 3'5' hydroxylase                              138   2e-34    
ref|XP_006593479.1|  PREDICTED: flavonoid 3', 5'-hydroxylase isof...    137   2e-34    
emb|CAN82588.1|  hypothetical protein VITISV_038260                     137   2e-34    
gb|AEY80043.1|  flavonoid-3',5'-hydroxylase                             137   2e-34    
ref|NP_001268164.1|  uncharacterized protein LOC100261319               137   2e-34    
gb|AHK10251.1|  flavonoid-3',5'-hydroxylase                             137   3e-34    
gb|AIX10141.1|  flavonoid 3',5'-hydroxylase                             137   3e-34    
gb|AFL91704.1|  flavonoid-3',5'-hydroxylase                             137   3e-34    
gb|AFD05053.1|  flavonoid 3'5'-hydroxylase                              132   3e-34    
dbj|BAJ16329.1|  flavonoid 3',5'-hydroxylase                            137   3e-34    
ref|XP_007146175.1|  hypothetical protein PHAVU_006G018800g             136   3e-34    
gb|AAV85470.1|  flavonoid 3',5'-hydroxylase                             137   3e-34    
dbj|BAB20076.1|  flavonoid 3',5'-hydroxylase                            137   3e-34    
gb|AJD25176.1|  cytochrome P450 CYP75A57                                137   4e-34    
ref|XP_003632209.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           137   4e-34    
emb|CAN81079.1|  hypothetical protein VITISV_007550                     137   4e-34    
emb|CAN61852.1|  hypothetical protein VITISV_020443                     137   5e-34    
ref|XP_003632242.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           136   5e-34    
emb|CAN82604.1|  hypothetical protein VITISV_005589                     136   5e-34    
dbj|BAE72871.1|  flavonoid 3',5'-hdyroxylase                            136   6e-34    
ref|XP_011024984.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      136   6e-34    
ref|XP_007146174.1|  hypothetical protein PHAVU_006G018800g             136   7e-34    
gb|AAT34974.1|  flavonoid 3',5'-hydroxylase                             136   7e-34    
dbj|BAF34573.1|  flavonoid 3',5'-hydroxylase                            136   7e-34    
gb|ACN38269.1|  flavonoid-3',5'-hydroxylase                             136   8e-34    
ref|XP_002280939.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           135   9e-34    
gb|ABC86840.1|  flavonoid 3',5'-hydroxylase                             135   1e-33    
ref|XP_010651525.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           135   1e-33    
emb|CAN60738.1|  hypothetical protein VITISV_042284                     134   1e-33    
gb|AFR67330.1|  flavonoid-3',5'-hydroxylase                             135   1e-33    
gb|AIY51702.1|  flavonoid 3',5'-hydroxylase                             135   1e-33    
ref|XP_002298464.1|  hypothetical protein POPTR_0001s28140g             135   1e-33    
ref|XP_003638760.1|  Flavonoid 3' 5'-hydroxylase                        135   1e-33    
ref|XP_008794133.1|  PREDICTED: flavonoid 3'-monooxygenase-like         135   2e-33    
ref|XP_006856442.1|  hypothetical protein AMTR_s00047p00229040          135   2e-33    
dbj|BAF34570.1|  flavonoid 3',5'-hydroxylase                            135   2e-33    
gb|ADE80942.1|  flavonoid 3',5'-hydroxylase                             135   2e-33    
ref|XP_007015255.1|  Flavonoid 3',5'-hydroxylase 2 isoform 2            134   2e-33    
gb|AAM51564.1|  flavonoid 3', 5'-hydroxylase                            134   3e-33    
gb|AFF59221.1|  flavonoid 3'5'-hydroxylase                              134   4e-33    
gb|AGO02173.1|  flavonoid 3'5'-hydroxylase                              134   4e-33    
dbj|BAE72870.1|  flavonoid 3',5'-hdyroxylase                            134   5e-33    
dbj|BAF49293.1|  flavonoid 3',5'-hydroxylase                            134   5e-33    
dbj|BAE72872.1|  flavonoid 3',5'-hdyroxylase                            134   5e-33    
gb|ADW66657.1|  flavonoid-3',5'-hydroxylase                             133   8e-33    
ref|XP_004513234.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    132   1e-32    
gb|ADW66160.1|  flavonoid 3' 5' hydroxylase                             132   1e-32    
ref|XP_006470529.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      132   2e-32    
gb|KDO54767.1|  hypothetical protein CISIN_1g047593mg                   132   2e-32    
ref|XP_009383085.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      132   2e-32    
ref|XP_003556788.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    132   2e-32    
sp|P48419.1|C75A3_PETHY  RecName: Full=Flavonoid 3',5'-hydroxylas...    131   3e-32    
ref|XP_010910221.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      131   5e-32    
ref|XP_002271739.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           131   5e-32    
emb|CBI30128.3|  unnamed protein product                                130   8e-32    
emb|CAN80142.1|  hypothetical protein VITISV_038979                     130   8e-32    
emb|CAA09850.1|  flavonoid 3',5'-hydroxylase                            130   1e-31    
ref|XP_003632212.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      130   1e-31    
sp|O04773.1|C75A6_CAMME  RecName: Full=Flavonoid 3',5'-hydroxylas...    130   1e-31    
ref|XP_009411862.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      129   1e-31    
gb|ABC86841.1|  flavonoid 3',5'-hydroxylase                             129   1e-31    
gb|AGC74041.1|  flavonoid-3',5'-hydroxylase                             129   2e-31    
ref|XP_010936313.1|  PREDICTED: flavonoid 3'-monooxygenase-like         129   2e-31    
ref|XP_006665049.1|  PREDICTED: flavonoid 3'-monooxygenase-like         129   3e-31    
emb|CAN82592.1|  hypothetical protein VITISV_038264                     128   3e-31    
ref|NP_001268157.1|  flavonoid-3,5'-hydroxylase                         129   3e-31    
ref|XP_010651527.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      129   3e-31    
gb|ABC72066.1|  flavonoid 3',5'-hydroxylase                             128   3e-31    
gb|ABR16345.1|  unknown                                                 129   3e-31    



>gb|AAR00230.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
Length=323

 Score =   337 bits (865),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMAER+GP
Sbjct  6    LIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMAERHGP  65

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLR+GFVDVVVAASAAVAAQFLKVHD+NFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR
Sbjct  66   LMHLRMGFVDVVVAASAAVAAQFLKVHDANFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  125

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM
Sbjct  126  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  185

Query  541  LGRKVFNDGGSKSDP  585
            LGRKVFNDGGSKSDP
Sbjct  186  LGRKVFNDGGSKSDP  200



>dbj|BAD00187.1| flavonoid 3'-hydroxylase [Ipomoea nil]
 dbj|BAD00190.1| flavonoid 3'-hydroxylase [Ipomoea nil]
Length=519

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 195/195 (100%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGKKPHQSIAAMAERYGP
Sbjct  6    LIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGKKPHQSIAAMAERYGP  65

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASAAVAAQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR
Sbjct  66   LMHLRLGFVDVVVAASAAVAAQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  125

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM
Sbjct  126  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  185

Query  541  LGRKVFNDGGSKSDP  585
            LGRKVFNDGGSKSDP
Sbjct  186  LGRKVFNDGGSKSDP  200



>gb|AAR00229.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
 dbj|BAD00188.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
 dbj|BAD00191.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
Length=519

 Score =   336 bits (862),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMAER+GP
Sbjct  6    LIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMAERHGP  65

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLR+GFVDVVVAASAAVAAQFLKVHD+NFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR
Sbjct  66   LMHLRMGFVDVVVAASAAVAAQFLKVHDANFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  125

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM
Sbjct  126  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  185

Query  541  LGRKVFNDGGSKSDP  585
            LGRKVFNDGGSKSDP
Sbjct  186  LGRKVFNDGGSKSDP  200



>gb|ABW69693.1| flavonoid 3'-hydrogenase [Ipomoea purpurea]
Length=519

 Score =   334 bits (856),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMAER+GP
Sbjct  6    LIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMAERHGP  65

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLR+GFVDVVVAASAAVAAQFLKVHD+NFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR
Sbjct  66   LMHLRMGFVDVVVAASAAVAAQFLKVHDANFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  125

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM
Sbjct  126  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  185

Query  541  LGRKVFNDGGSKSDP  585
            LGRKVFNDG SKSDP
Sbjct  186  LGRKVFNDGSSKSDP  200



>dbj|BAD00189.1| flavonoid 3'-hydroxylase [Ipomoea tricolor]
 dbj|BAD00192.1| flavonoid 3'-hydroxylase [Ipomoea tricolor]
Length=522

 Score =   325 bits (834),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LI CTLVFAI LYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA+ YGP
Sbjct  6    LILCTLVFAICLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMAQSYGP  65

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGAEHIAYNYQDLVFAPYGPRWR
Sbjct  66   LMHLRLGFVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAEHIAYNYQDLVFAPYGPRWR  125

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM
Sbjct  126  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  185

Query  541  LGRKVFNDGGSKSDP  585
            LGRKVFNDG SKSDP
Sbjct  186  LGRKVFNDGSSKSDP  200



>gb|ACL26685.1| flavonoid 3'-hydroxylase [Ipomoea coccinea]
Length=519

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  22   FAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLG  201
            FAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA++YGPLMHLRLG
Sbjct  13   FAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMAQKYGPLMHLRLG  72

Query  202  FvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS  381
            FVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS
Sbjct  73   FVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS  132

Query  382  VHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFN  561
            VHLFSAKALDDF HVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFN
Sbjct  133  VHLFSAKALDDFSHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFN  192

Query  562  DGGSKSDP  585
            DGGSKSDP
Sbjct  193  DGGSKSDP  200



>gb|AAS46257.1| flavonoid 3'-hydroxylase [Ipomoea quamoclit]
Length=519

 Score =   315 bits (807),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  22   FAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLG  201
            FAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA++YGPLMHLRLG
Sbjct  13   FAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMAQKYGPLMHLRLG  72

Query  202  FvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS  381
            FVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS
Sbjct  73   FVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS  132

Query  382  VHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFN  561
            VHLFSAKALDDF HVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFN
Sbjct  133  VHLFSAKALDDFSHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFN  192

Query  562  DGGSKSDP  585
            DG SKSDP
Sbjct  193  DGSSKSDP  200



>gb|ACL26686.1| flavonoid 3'-hydroxylase [Ipomoea ternifolia]
Length=519

 Score =   311 bits (797),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  22   FAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLG  201
            FAI LYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA++YGPLMHLRLG
Sbjct  13   FAISLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMAKKYGPLMHLRLG  72

Query  202  FvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS  381
            FVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPRWRMLRKITS
Sbjct  73   FVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPRWRMLRKITS  132

Query  382  VHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFN  561
            VHLFSAKALDDF HVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFN
Sbjct  133  VHLFSAKALDDFSHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFN  192

Query  562  DGGSKSDP  585
            DGGSKSDP
Sbjct  193  DGGSKSDP  200



>gb|ACS71532.1| flavonoid 3' hydroxylase [Ipomoea horsfalliae]
Length=517

 Score =   306 bits (785),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 187/195 (96%), Gaps = 2/195 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LI CT VFA+FLYFL LR+K RYPLPLPPGPKPWPV+GNLPHLG+KPHQSIAA+A+ YGP
Sbjct  6    LILCTSVFAVFLYFL-LRLK-RYPLPLPPGPKPWPVVGNLPHLGQKPHQSIAALAQSYGP  63

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFV VVVAASAAVAAQFLKVHD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  64   LMHLRLGFVHVVVAASAAVAAQFLKVHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPRWR  123

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKITSVHLFSAKALDDFCHVRQEEVATL RSLASAGKTPVKLGQLLNVCTTNAL RVM
Sbjct  124  MLRKITSVHLFSAKALDDFCHVRQEEVATLARSLASAGKTPVKLGQLLNVCTTNALGRVM  183

Query  541  LGRKVFNDGGSKSDP  585
            LGRKVFNDGGSKSDP
Sbjct  184  LGRKVFNDGGSKSDP  198



>gb|AEH42499.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   303 bits (777),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 186/195 (95%), Gaps = 2/195 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LI CT+VF IFLYFL LRVK RYPLPLPPGPKPWPV+GNLPHLG+KPHQSIAA+A+ YGP
Sbjct  7    LILCTIVFTIFLYFL-LRVK-RYPLPLPPGPKPWPVVGNLPHLGEKPHQSIAALAQSYGP  64

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  65   LMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPRWR  124

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
             LRKITSVHLFSAKALDDF HVRQ EVATLTRSLASAGKTPVKLGQLLNVCTTNALARV+
Sbjct  125  RLRKITSVHLFSAKALDDFSHVRQGEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVV  184

Query  541  LGRKVFNDGGSKSDP  585
            LGRKVFNDGGSKSDP
Sbjct  185  LGRKVFNDGGSKSDP  199



>gb|ABW86861.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=517

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 185/195 (95%), Gaps = 2/195 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIFCT+VF IFLY L LRVK RYPLPLPPGPKPWPV+GNLPHLG+KPHQSIAA+A+ YGP
Sbjct  6    LIFCTIVFTIFLYCL-LRVK-RYPLPLPPGPKPWPVVGNLPHLGEKPHQSIAALAQSYGP  63

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  64   LMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPRWR  123

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
             LRKITSVHLFSAKALDDF HVRQ EVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM
Sbjct  124  RLRKITSVHLFSAKALDDFSHVRQGEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  183

Query  541  LGRKVFNDGGSKSDP  585
            LGRKVFNDG SKSDP
Sbjct  184  LGRKVFNDGSSKSDP  198



>gb|ACB29666.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   295 bits (756),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 183/195 (94%), Gaps = 2/195 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LI CT VF IFLY L LRVK RYPLPLPPGPKPWP++GNLPHLG+KPHQSIAA+A+ YGP
Sbjct  7    LILCTSVFTIFLYCL-LRVK-RYPLPLPPGPKPWPIVGNLPHLGEKPHQSIAALAQSYGP  64

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAY+YQDLVFAPYGPRWR
Sbjct  65   LMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYSYQDLVFAPYGPRWR  124

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKITSVHLFSAKALDDF HVRQ  VATLTRSLASAGKTPVKLGQLLNVCTTNALARVM
Sbjct  125  MLRKITSVHLFSAKALDDFSHVRQGVVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  184

Query  541  LGRKVFNDGGSKSDP  585
            LGRKVFNDG SKSDP
Sbjct  185  LGRKVFNDGSSKSDP  199



>gb|AEH42501.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   295 bits (756),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 183/195 (94%), Gaps = 2/195 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LI CT VF IFLY L LRVK RYPLPLPPGPKPWP++GNLPHLG+KPHQSIAA+A+ YGP
Sbjct  7    LILCTSVFTIFLYCL-LRVK-RYPLPLPPGPKPWPIVGNLPHLGEKPHQSIAALAQSYGP  64

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAY+YQDLVFAPYGPRWR
Sbjct  65   LMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYSYQDLVFAPYGPRWR  124

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKITSVHLFSAKALDDF HVRQ  VATLTRSLASAGKTPVKLGQLLNVCTTNALARVM
Sbjct  125  MLRKITSVHLFSAKALDDFSHVRQGVVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  184

Query  541  LGRKVFNDGGSKSDP  585
            LGRKVFNDG SKSDP
Sbjct  185  LGRKVFNDGSSKSDP  199



>gb|AEH42500.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 183/195 (94%), Gaps = 2/195 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LI CT V  I LY L LRVK RYPLPLPPGPKPWPV+GNLPHLG+KP+QS+AA+A+ YGP
Sbjct  7    LILCTSVITISLYCL-LRVK-RYPLPLPPGPKPWPVVGNLPHLGEKPNQSLAALAQSYGP  64

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  65   LMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPRWR  124

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKITSVHLFSAKALDDF HVRQ EVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM
Sbjct  125  MLRKITSVHLFSAKALDDFSHVRQGEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  184

Query  541  LGRKVFNDGGSKSDP  585
            LGRKVFNDGGSKSDP
Sbjct  185  LGRKVFNDGGSKSDP  199



>dbj|BAJ11756.1| flavonoid 3'-hydroxylase [Calystegia pubescens]
Length=520

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 178/201 (89%), Gaps = 6/201 (3%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRV---KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAER  171
            L   T +FAIFLYFL+ ++    +RYPL LPPGP PWPV+GNLPHLG KPHQ++AA+A+ 
Sbjct  6    LFLFTSIFAIFLYFLVCQLLISNKRYPLLLPPGPSPWPVVGNLPHLGPKPHQTLAALAQN  65

Query  172  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  351
            YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGP
Sbjct  66   YGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGP  125

Query  352  RWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALA  531
            RWRMLRKITSVHLFS+KALDDF HVRQEE+  LTR+LASAGKTPVKLGQLLNVCTTNAL+
Sbjct  126  RWRMLRKITSVHLFSSKALDDFRHVRQEEIGVLTRALASAGKTPVKLGQLLNVCTTNALS  185

Query  532  RVMLGRKVFND---GGSKSDP  585
            RV+LGRKVFND    G KSDP
Sbjct  186  RVLLGRKVFNDQTNAGGKSDP  206



>dbj|BAJ08322.1| flavonoid 3'-hydroxylase [Calystegia soldanella]
Length=520

 Score =   277 bits (709),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 179/201 (89%), Gaps = 6/201 (3%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRV---KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAER  171
            L   T +FAIF+YFL+ ++    +RYPLPLPPGP PWPV+GNLPHLG KPHQ++AA+A+ 
Sbjct  6    LFLFTSIFAIFIYFLVCQLLISNKRYPLPLPPGPSPWPVVGNLPHLGPKPHQTLAALAQN  65

Query  172  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  351
            YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGP
Sbjct  66   YGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGP  125

Query  352  RWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALA  531
            RWRMLRKITSVHLFS+KALDDF HVRQEE+  LTR+LASAG+TPVKLGQLLNVCTTNAL+
Sbjct  126  RWRMLRKITSVHLFSSKALDDFRHVRQEEIGVLTRALASAGRTPVKLGQLLNVCTTNALS  185

Query  532  RVMLGRKVFND---GGSKSDP  585
            RV+LGRKVFND    G KSDP
Sbjct  186  RVLLGRKVFNDQTNAGGKSDP  206



>dbj|BAE47005.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   261 bits (668),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 157/195 (81%), Gaps = 4/195 (2%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A+ YGP
Sbjct  6    LIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALAKTYGP  61

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  62   LMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPRWR  121

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI SVHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNAL RVM
Sbjct  122  MLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNALGRVM  181

Query  541  LGRKVFNDGGSKSDP  585
            LGR+VF DG    DP
Sbjct  182  LGRRVFGDGSGGEDP  196



>emb|CAI54278.1| flavonoid-3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   261 bits (667),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 158/195 (81%), Gaps = 4/195 (2%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIFCT +F + LY  + R   R P  L P P      GNLPHLG  PH SIAA+A+ YGP
Sbjct  6    LIFCTALFCVLLYHFLTRRSVRLPPGLKPWPIV----GNLPHLGPVPHHSIAALAKTYGP  61

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  62   LMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPRWR  121

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI SVHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNAL RVM
Sbjct  122  MLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNALGRVM  181

Query  541  LGRKVFNDGGSKSDP  585
            LGR+VF DG    DP
Sbjct  182  LGRRVFGDGSGGEDP  196



>emb|CAN68303.1| hypothetical protein VITISV_041731 [Vitis vinifera]
Length=509

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 157/195 (81%), Gaps = 4/195 (2%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIFCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A+ YGP
Sbjct  6    LIFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALAKTYGP  61

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  62   LMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPRWR  121

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI SVHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNAL RVM
Sbjct  122  MLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNALGRVM  181

Query  541  LGRKVFNDGGSKSDP  585
            LGR+VF DG    DP
Sbjct  182  LGRRVFGDGSGGEDP  196



>gb|AGM46642.1| flavonoid 3'-hydroxylase protein, partial [Apium graveolens]
Length=153

 Score =   248 bits (634),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG KPH S+AA+A+ YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NFS+RPPN
Sbjct  6    GNLPHLGAKPHHSLAALAKNYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFSSRPPN  65

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDF HVRQEEV  LTR+LASA
Sbjct  66   SGAKHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFRHVRQEEVGILTRALASA  125

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKV  555
            GKTPVKLGQLLNVCTTNALARVMLGR+V
Sbjct  126  GKTPVKLGQLLNVCTTNALARVMLGRRV  153



>dbj|BAE47003.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=334

 Score =   254 bits (648),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 155/195 (79%), Gaps = 4/195 (2%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            L FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A+ YGP
Sbjct  6    LSFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALAKTYGP  61

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  62   LMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPRWR  121

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI SVHLFS +ALDDF H+RQEEV  L R+LA AG+TPVKLGQLLNVCTTNAL RVM
Sbjct  122  MLRKICSVHLFSGQALDDFRHIRQEEVLALMRALARAGQTPVKLGQLLNVCTTNALGRVM  181

Query  541  LGRKVFNDGGSKSDP  585
            LGR+VF DG    DP
Sbjct  182  LGRRVFGDGSGGEDP  196



>gb|ACN38268.1| flavonoid 3' hydroxylase [Vitis amurensis]
Length=509

 Score =   259 bits (661),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 156/195 (80%), Gaps = 4/195 (2%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            L FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A+ YGP
Sbjct  6    LFFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALAKTYGP  61

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  62   LMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPRWR  121

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI SVHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNAL RVM
Sbjct  122  MLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNALGRVM  181

Query  541  LGRKVFNDGGSKSDP  585
            LGR+VF DG    DP
Sbjct  182  LGRRVFGDGSGGEDP  196



>ref|NP_001267916.1| flavonoid 3' hydroxylase [Vitis vinifera]
 dbj|BAE47006.1| flavonoid 3'-hydroxylase [Vitis vinifera]
 gb|ABH06586.1| flavonoid 3' hydroxylase [Vitis vinifera]
Length=509

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 156/195 (80%), Gaps = 4/195 (2%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            L FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A+ YGP
Sbjct  6    LFFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALAKTYGP  61

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  62   LMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPRWR  121

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI SVHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNAL RVM
Sbjct  122  MLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNALGRVM  181

Query  541  LGRKVFNDGGSKSDP  585
            LGR+VF DG    DP
Sbjct  182  LGRRVFGDGSGGEDP  196



>sp|Q9SBQ9.1|F3PH_PETHY RecName: Full=Flavonoid 3'-monooxygenase; AltName: Full=Cytochrome 
P450 75B2; AltName: Full=Flavonoid 3'-hydroxylase [Petunia 
x hybrida]
 gb|AAD56282.1|AF155332_1 flavonoid 3'-hydroxylase [Petunia x hybrida]
Length=512

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 173/197 (88%), Gaps = 3/197 (2%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILR--VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  174
            LI  T++F+  L F ILR   ++RYPLPLPPGPKPWP++GNL HLG KPHQS AAMA+ Y
Sbjct  6    LILYTVIFSFLLQF-ILRSFFRKRYPLPLPPGPKPWPIIGNLVHLGPKPHQSTAAMAQTY  64

Query  175  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  354
            GPLM+L++GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGAEH+AYNYQDLVFAPYGPR
Sbjct  65   GPLMYLKMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAEHMAYNYQDLVFAPYGPR  124

Query  355  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  534
            WRMLRKI SVHLFS KALDDF HVRQ+EV TLTR+LASAG+ PVKLGQLLNVCTTNALAR
Sbjct  125  WRMLRKICSVHLFSTKALDDFRHVRQDEVKTLTRALASAGQKPVKLGQLLNVCTTNALAR  184

Query  535  VMLGRKVFNDGGSKSDP  585
            VMLG++VF DG    DP
Sbjct  185  VMLGKRVFADGSGDVDP  201



>emb|CAN62275.1| hypothetical protein VITISV_007552 [Vitis vinifera]
Length=471

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 156/195 (80%), Gaps = 4/195 (2%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A+ YGP
Sbjct  6    LIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALAKTYGP  61

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  62   LMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPRWR  121

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI SVHLFS +ALDDF H+RQEEV  L R+LA AG+TPVKLGQLLNVCTTNAL RVM
Sbjct  122  MLRKICSVHLFSGQALDDFRHIRQEEVLALMRALARAGQTPVKLGQLLNVCTTNALGRVM  181

Query  541  LGRKVFNDGGSKSDP  585
            LGR+VF DG    DP
Sbjct  182  LGRRVFGDGSGGEDP  196



>ref|XP_002284151.1| PREDICTED: flavonoid 3'-monooxygenase [Vitis vinifera]
 emb|CAN75347.1| hypothetical protein VITISV_002956 [Vitis vinifera]
Length=509

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 156/195 (80%), Gaps = 4/195 (2%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A+ YGP
Sbjct  6    LIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALAKTYGP  61

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  62   LMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPRWR  121

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI SVHLFS +ALDDF H+RQEEV  L R+LA AG+TPVKLGQLLNVCTTNAL RVM
Sbjct  122  MLRKICSVHLFSGQALDDFRHIRQEEVLALMRALARAGQTPVKLGQLLNVCTTNALGRVM  181

Query  541  LGRKVFNDGGSKSDP  585
            LGR+VF DG    DP
Sbjct  182  LGRRVFGDGSGGEDP  196



>dbj|BAE47004.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 155/195 (79%), Gaps = 4/195 (2%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A+ YGP
Sbjct  6    LIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALAKTYGP  61

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  62   LMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPRWR  121

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI SVHLFS +ALDDF H+RQEEV  L R+LA  G+TPVKLGQLLNVCTTNAL RVM
Sbjct  122  MLRKICSVHLFSGQALDDFRHIRQEEVLALMRALAREGQTPVKLGQLLNVCTTNALGRVM  181

Query  541  LGRKVFNDGGSKSDP  585
            LGR+VF DG    DP
Sbjct  182  LGRRVFGDGSGGEDP  196



>dbj|BAP94456.1| flavonoid 3'-hydroxylas [Eustoma exaltatum subsp. russellianum]
Length=519

 Score =   254 bits (648),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 145/196 (74%), Positives = 166/196 (85%), Gaps = 1/196 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  177
            L+  T +F++ +Y  L L  ++     LPPGPKPWP++GNLPHLG KPHQ++AAMA+ YG
Sbjct  9    LVVYTAIFSLLIYAILKLLRRENRRPSLPPGPKPWPIIGNLPHLGTKPHQTLAAMAKTYG  68

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            PLMHL+LGFVDVVVAASA+VA QFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPRW
Sbjct  69   PLMHLKLGFVDVVVAASASVAEQFLKKHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPRW  128

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  537
            R+LRKI SVHLFSAKALDDF HVRQEEV  LTRS+ASAG+ P+ LGQLL VCTTNALARV
Sbjct  129  RLLRKICSVHLFSAKALDDFQHVRQEEVGILTRSIASAGENPINLGQLLGVCTTNALARV  188

Query  538  MLGRKVFNDGGSKSDP  585
            MLGR+VF DG    DP
Sbjct  189  MLGRRVFGDGSGGVDP  204



>ref|XP_009788494.1| PREDICTED: flavonoid 3'-monooxygenase [Nicotiana sylvestris]
Length=514

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 171/196 (87%), Gaps = 2/196 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  177
            L+  T++F+  L+  L L  ++RYPLPLPPGPKPWP++GNL H+G KPHQS AAMA  YG
Sbjct  6    LLLYTVIFSFLLHSILTLFFRKRYPLPLPPGPKPWPIIGNLVHMGPKPHQSTAAMARTYG  65

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            PLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  66   PLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  125

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  537
            RMLRKI  VHLFSAKALDDF HVRQ+EV TLTR+LASAG+ PVKLGQLLNVCTTNALARV
Sbjct  126  RMLRKICFVHLFSAKALDDFSHVRQDEVKTLTRALASAGQKPVKLGQLLNVCTTNALARV  185

Query  538  MLGRKVFNDGGSKSDP  585
            MLGR+VF D  S +DP
Sbjct  186  MLGRRVFADASS-ADP  200



>gb|AHZ08763.1| flavonoid 3'-monooxygenase [Nicotiana tabacum]
Length=515

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 169/196 (86%), Gaps = 1/196 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  177
            L+  T++F+  L+  L L  ++RYPLPLPPGPKPWP++GNL H+G KPHQS AAMA  YG
Sbjct  6    LLLYTVIFSFLLHSILTLFFRKRYPLPLPPGPKPWPIIGNLVHMGPKPHQSTAAMARTYG  65

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            PLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  66   PLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  125

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  537
            RMLRKI SVHLFSAKALDDF HVRQ+EV TLTR+LASA + PVKLGQLLNVCTTNALA+V
Sbjct  126  RMLRKICSVHLFSAKALDDFSHVRQDEVRTLTRALASAAQKPVKLGQLLNVCTTNALAQV  185

Query  538  MLGRKVFNDGGSKSDP  585
            MLGR+VF D     DP
Sbjct  186  MLGRRVFADANGGVDP  201



>gb|ABA64468.1| flavonoid 3'-hydroxylase [Gerbera hybrid cultivar]
Length=512

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 167/194 (86%), Gaps = 1/194 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            L+  T V  +FLY L+ R   R P  LPPGP PWPV+GNLPHLG  PH S+AAMA++YGP
Sbjct  6    LLIGTCVTGLFLYVLLNRC-TRNPNRLPPGPTPWPVVGNLPHLGTIPHHSLAAMAKKYGP  64

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  65   LMHLRLGFVDVVVAASASVAAQFLKTHDANFADRPPNSGAKHIAYNYQDLVFAPYGPRWR  124

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI SVHLFS KALDDF HVRQEEVA L R+L  AGK+PVKLGQLLNVCTTNALARVM
Sbjct  125  MLRKICSVHLFSTKALDDFRHVRQEEVAILARALVGAGKSPVKLGQLLNVCTTNALARVM  184

Query  541  LGRKVFNDGGSKSD  582
            LGR+VF+ G +++D
Sbjct  185  LGRRVFDSGDAQAD  198



>gb|ACO35753.1| flavonoid 3'-hydroxylase [Bidens aurea]
Length=512

 Score =   251 bits (642),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG  PH S+AA+A +YGPLMHLRLGFVDVVVAASA+VA+QFLK HD+NF++RPPN
Sbjct  42   GNLPHLGTVPHHSLAALAAKYGPLMHLRLGFVDVVVAASASVASQFLKTHDANFASRPPN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGAEHIAYNYQDLVFAPYGPRWRMLRKI SVHLFS KALDD+ HVRQEEVA LTR+L  A
Sbjct  102  SGAEHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDYRHVRQEEVAILTRALVGA  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
            GK PVKLGQLLNVCTTNALARVMLGR+VF DG    DP
Sbjct  162  GKAPVKLGQLLNVCTTNALARVMLGRRVFGDGSGGGDP  199



>gb|AGO02167.1| flavonoid 3'-hydroxylase [Ampelopsis grossedentata]
Length=509

 Score =   251 bits (640),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 153/195 (78%), Gaps = 4/195 (2%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            L+FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A+ YGP
Sbjct  6    LLFCTALFCVLLYRFLTRRSPRLPPGPKPWPIV----GNLPHLGPVPHHSIAALAKTYGP  61

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLR+GFVDVVVAASA+VA+QFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  62   LMHLRMGFVDVVVAASASVASQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPRWR  121

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI S+HLFS KALDDF H+RQEE++ LT +LA AG  PV LGQLLNVCTTNAL RVM
Sbjct  122  MLRKICSIHLFSGKALDDFRHIRQEEISVLTSALARAGPAPVNLGQLLNVCTTNALGRVM  181

Query  541  LGRKVFNDGGSKSDP  585
            LGR+ F DG    DP
Sbjct  182  LGRRAFGDGSGGEDP  196



>ref|XP_008374610.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
 gb|ACR14868.1| flavonoid 3' hydroxylase IIa [Malus domestica]
Length=511

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 161/194 (83%), Gaps = 0/194 (0%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIF T+V A FLY L      R+  PLPPGPKPWPV+GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFFTVVLAFFLYRLFAPGGSRHAQPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYGP  63

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRWR
Sbjct  64   LMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRWR  123

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV LGQLLNVCT NAL RVM
Sbjct  124  MLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLGQLLNVCTVNALGRVM  183

Query  541  LGRKVFNDGGSKSD  582
            +GR++F DGG + D
Sbjct  184  VGRRLFGDGGGRED  197



>gb|AHA49900.1| flavonoid 3' hydroxylase [Malus hybrid cultivar]
Length=511

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 161/194 (83%), Gaps = 0/194 (0%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIF T+V A FLY L      R+  PLPPGPKPWPV+GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFFTVVLAFFLYRLFAPGGSRHAQPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYGP  63

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRWR
Sbjct  64   LMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRWR  123

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV LGQLLNVCT NAL RVM
Sbjct  124  MLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLGQLLNVCTVNALGRVM  183

Query  541  LGRKVFNDGGSKSD  582
            +GR++F DGG + D
Sbjct  184  VGRRLFGDGGGRED  197



>gb|AJO67965.1| flavonoid-3'-hydroxylase, partial [Prunus avium]
Length=215

 Score =   241 bits (615),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 160/194 (82%), Gaps = 1/194 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIF T+VFA FLY L++    R+ LPL PGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAAFLYRLLVP-GNRHSLPLAPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDV+VAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVIVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI+SVHLFS KALDD  HVRQEEVA L  SLA AG   V L QLLN+CT NAL RVM
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHSLAGAGSKTVNLAQLLNICTVNALGRVM  182

Query  541  LGRKVFNDGGSKSD  582
            +G+K+F DG    D
Sbjct  183  VGKKLFADGSGSGD  196



>dbj|BAO58432.1| flavonoid 3'-hydroxylase [Vaccinium ashei]
Length=517

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 163/196 (83%), Gaps = 2/196 (1%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            I  +L+  IFLYF++  ++ RYP PLPPGPKPWPV+GNLPHLG  PH SIAA+A  YGPL
Sbjct  7    IIYSLLIGIFLYFVLSLLRNRYPRPLPPGPKPWPVIGNLPHLGTMPHHSIAALARTYGPL  66

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            MHL +G V VVVAASA+VA QFLK HD NFS+RPPNSGA+HIAYNYQDLVFAPYGPRWRM
Sbjct  67   MHLWMGSVHVVVAASASVAXQFLKTHDQNFSSRPPNSGAKHIAYNYQDLVFAPYGPRWRM  126

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAG--KTPVKLGQLLNVCTTNALARV  537
            LRKI SVHLFSAKALDDF HVRQEEVA LTR+LASA   KT V LGQLLN+CTTNA+ RV
Sbjct  127  LRKICSVHLFSAKALDDFRHVRQEEVAILTRALASAAKSKTTVNLGQLLNLCTTNAIGRV  186

Query  538  MLGRKVFNDGGSKSDP  585
            MLGR+VF DG    DP
Sbjct  187  MLGRRVFGDGSGGGDP  202



>gb|ACR14869.1| flavonoid 3' hydroxylase IIb [Malus domestica]
Length=511

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 162/194 (84%), Gaps = 0/194 (0%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIF T+V A FLY L      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFFTVVLAFFLYRLFAPGGSRHALPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYGP  63

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRWR
Sbjct  64   LMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRWR  123

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV LGQLLNVCT NAL RVM
Sbjct  124  MLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVSLGQLLNVCTVNALGRVM  183

Query  541  LGRKVFNDGGSKSD  582
            +GR++F DGG + D
Sbjct  184  VGRRLFGDGGGRED  197



>ref|XP_009597267.1| PREDICTED: flavonoid 3'-monooxygenase [Nicotiana tomentosiformis]
Length=515

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 168/196 (86%), Gaps = 1/196 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLI-LRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  177
            LI  T++F+  L+ +  L  ++RYPL LPPGPKPWP++GNL H+G KPHQS AAMA  YG
Sbjct  6    LILYTVIFSFLLHSIFSLFFRKRYPLTLPPGPKPWPIIGNLVHMGPKPHQSTAAMARTYG  65

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            PLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  66   PLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  125

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  537
            RMLRKI SVHLFSAKALDDF HVRQ+EV TLTR+LASA + PVKLGQLLNVCTTNALA+V
Sbjct  126  RMLRKICSVHLFSAKALDDFSHVRQDEVRTLTRALASAAQKPVKLGQLLNVCTTNALAQV  185

Query  538  MLGRKVFNDGGSKSDP  585
            MLGR+VF D     DP
Sbjct  186  MLGRRVFADANGGVDP  201



>gb|AHI58943.1| flavonoid 3'-hydroxylase [Nicotiana tabacum]
Length=515

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 168/196 (86%), Gaps = 1/196 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLI-LRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  177
            LI  T++F+  L+ +  L  ++RYPL LPPGPKPWP++GNL H+G KPHQS AAMA  YG
Sbjct  6    LILYTVIFSFLLHSIFSLFFRKRYPLTLPPGPKPWPIIGNLVHMGPKPHQSTAAMARTYG  65

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            PLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  66   PLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  125

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  537
            RMLRKI SVHLFSAKALDDF HVRQ+EV TLTR+LASA + PVKLGQLLNVCTTNALA+V
Sbjct  126  RMLRKICSVHLFSAKALDDFSHVRQDEVRTLTRALASAAQKPVKLGQLLNVCTTNALAQV  185

Query  538  MLGRKVFNDGGSKSDP  585
            MLGR+VF D     DP
Sbjct  186  MLGRRVFADANGGVDP  201



>ref|NP_001289844.1| flavonoid 3'-monooxygenase [Solanum lycopersicum]
 gb|ADK56284.1| putative flavonoid 3' hydroxylase CYP75B49 [Solanum lycopersicum]
Length=514

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYF-LILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  177
            LI  T++ +I L+F L L  ++RYP+PLPPGPKPWP++GN+  LG KPHQS A+MA  YG
Sbjct  6    LILYTIISSIILHFSLSLFFRKRYPVPLPPGPKPWPIIGNIIQLGPKPHQSTASMARTYG  65

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            PLMHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRW
Sbjct  66   PLMHLRMGFVDVVVAASASVAAQFLKNHDANFSSRPPNSGAKHMAYNYHDLVFAPYGPRW  125

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  537
            RMLRKI SVHLFS KALDDF HVRQEEV TLTR+LA+AG+ P+KLGQLLNVCTTNALARV
Sbjct  126  RMLRKICSVHLFSTKALDDFRHVRQEEVRTLTRALANAGQNPIKLGQLLNVCTTNALARV  185

Query  538  MLGRKVFNDGGSKSDP  585
            MLG++VF DG +  DP
Sbjct  186  MLGKRVFADGTNGMDP  201



>gb|ABM46853.1| flavonoid 3'-hydroxylase [Ageratina adenophora]
Length=510

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +1

Query  37   YFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvv  216
            ++L+L ++ R+P  LPPGP PWP++GNLPHLG  PH S+AA+A +YGPLMHLRLGFVDVV
Sbjct  17   FYLLLNLRTRHPKRLPPGPTPWPIVGNLPHLGTVPHHSLAALATKYGPLMHLRLGFVDVV  76

Query  217  vaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFS  396
            VAASA+VA+QFLK HD+NF++RPPNSGA+HIAYNY DLVFAPYGPRWRMLRKI SVHLFS
Sbjct  77   VAASASVASQFLKSHDANFASRPPNSGAKHIAYNYHDLVFAPYGPRWRMLRKICSVHLFS  136

Query  397  AKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSK  576
            AK+LDDF HVRQEEVA LTR L SAG+T VKLGQLLNVCTTNALARV+LGR+VF DG   
Sbjct  137  AKSLDDFRHVRQEEVAILTRVLISAGETTVKLGQLLNVCTTNALARVLLGRRVFGDGSRD  196

Query  577  SDP  585
            SDP
Sbjct  197  SDP  199



>ref|XP_006345132.1| PREDICTED: flavonoid 3'-monooxygenase-like [Solanum tuberosum]
Length=514

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 172/196 (88%), Gaps = 1/196 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLI-LRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  177
            LI  T++ +  L+F++ L  ++RYP+PLPPGPKPWP++GN+  LG KPHQS A+MA  YG
Sbjct  6    LILYTIISSFILHFILSLFFRKRYPVPLPPGPKPWPIIGNIVQLGPKPHQSTASMARTYG  65

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            PLMHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRW
Sbjct  66   PLMHLRMGFVDVVVAASASVAAQFLKNHDANFSSRPPNSGAKHMAYNYHDLVFAPYGPRW  125

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  537
            RMLRKI SVHLFSAKALDDF HVRQEEV TLTR+LA+AG+ P+KLGQLLNVCTTNALARV
Sbjct  126  RMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANAGQKPIKLGQLLNVCTTNALARV  185

Query  538  MLGRKVFNDGGSKSDP  585
            MLG++VF DG +  DP
Sbjct  186  MLGKRVFADGTNGIDP  201



>gb|AIY22749.1| flavonoid 3'-hydroxylase [Iochroma cyaneum]
Length=515

 Score =   249 bits (635),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 168/196 (86%), Gaps = 1/196 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  177
            +I CT++ +  L+  L L   +RYP+PLPPGPKPWP++GN+ HLG KPHQS A MA  YG
Sbjct  6    IILCTIIISFLLHTILSLFFLKRYPVPLPPGPKPWPIIGNIVHLGPKPHQSTADMARTYG  65

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            PLMHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRW
Sbjct  66   PLMHLRMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAPYGPRW  125

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  537
            RMLRKI SVHLFSAKALDDF HVRQEEV TLTR+LA+A + PVKLGQLLNVCTTN+LARV
Sbjct  126  RMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANASQKPVKLGQLLNVCTTNSLARV  185

Query  538  MLGRKVFNDGGSKSDP  585
            MLG++VF DG    DP
Sbjct  186  MLGKRVFADGTGGIDP  201



>emb|CDP19009.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   248 bits (634),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 164/196 (84%), Gaps = 2/196 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIF + + A FL + IL+        LPPGPKPWP++GNLPHLG KPH S+AAMA+ YGP
Sbjct  6    LIFISSLLA-FLLYSILKKAGNPSKSLPPGPKPWPIVGNLPHLGTKPHHSLAAMAKTYGP  64

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  65   LMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPRWR  124

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRS-LASAGKTPVKLGQLLNVCTTNALARV  537
            +LRKI S+HLFSAKALDDF  VRQEEV TL R+ LASAGKTPV LGQLLNVCTTNAL RV
Sbjct  125  LLRKICSIHLFSAKALDDFHLVRQEEVGTLARALLASAGKTPVNLGQLLNVCTTNALGRV  184

Query  538  MLGRKVFNDGGSKSDP  585
            MLGR+VF DG    DP
Sbjct  185  MLGRRVFGDGSGGGDP  200



>gb|ADB77826.1| flavonoid 3'-hydroxylase allele 2 [Dahlia pinnata]
Length=508

 Score =   248 bits (634),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 163/194 (84%), Gaps = 1/194 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            L+    + A+ LY L L ++ R+   LPPGP PWP++GNLPHLG  PH S+AA+AE+YGP
Sbjct  6    LLLYASITALPLYVL-LNLRTRHSNRLPPGPTPWPIVGNLPHLGTIPHHSLAALAEKYGP  64

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLR GFVDVVVAASA+VA+QFLK HD+ F++RPPNSGAEHIAYNYQDLVFAPYGPRWR
Sbjct  65   LMHLRFGFVDVVVAASASVASQFLKTHDAKFASRPPNSGAEHIAYNYQDLVFAPYGPRWR  124

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI SVHLFS KALDDF HVRQEEVA LTR LA AG + VKLGQLLNVCTTNALARVM
Sbjct  125  MLRKICSVHLFSGKALDDFRHVRQEEVAILTRVLAGAGNSTVKLGQLLNVCTTNALARVM  184

Query  541  LGRKVFNDGGSKSD  582
            LGR+VF DG  K+D
Sbjct  185  LGRRVFGDGDPKAD  198



>gb|AFI25037.1| flavonoid 3'-hydroxylase, partial [Populus deltoides x Populus 
tremuloides]
Length=201

 Score =   238 bits (608),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 163/189 (86%), Gaps = 3/189 (2%)
 Frame = +1

Query  28   IFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLG  201
            IF+Y L+ LR ++ R+  PLPPGPKPWP++GNLPHLG  PH S+AA+A+ YGPLMHLR G
Sbjct  1    IFVYCLLQLRSLRDRHGKPLPPGPKPWPLVGNLPHLGPVPHHSMAALAKTYGPLMHLRFG  60

Query  202  FvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS  381
            FVDVVVAASA+VAAQFLKVHDSNFS+RPPNSGA+HIAYNYQDLVFAPYGPRWRMLRKI+S
Sbjct  61   FVDVVVAASASVAAQFLKVHDSNFSSRPPNSGAKHIAYNYQDLVFAPYGPRWRMLRKISS  120

Query  382  VHLFSAKALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLLNVCTTNALARVMLGRKVF  558
            VHLFSAK+LDDF H+RQEEVA LT +L  +G  TPV LGQLLNVCT NAL RVMLGR+VF
Sbjct  121  VHLFSAKSLDDFRHIRQEEVAVLTGALTRSGPTTPVNLGQLLNVCTANALGRVMLGRRVF  180

Query  559  NDGGSKSDP  585
             DG    DP
Sbjct  181  GDGSGDGDP  189



>gb|ACO35752.1| flavonoid 3'-hydroxylase [Cosmos sulphureus]
Length=508

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG  PH S+AA+A +YGPLMHLRLGFVDVVVAASA+VA+QFLK HD+NF++RPPN
Sbjct  42   GNLPHLGTTPHHSLAALAAKYGPLMHLRLGFVDVVVAASASVASQFLKTHDANFASRPPN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGAEH+AYNYQDLVFAPYGPRWRMLRKI SVHLFS KALDDF HVRQEEVA LTR+LA A
Sbjct  102  SGAEHMAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDFRHVRQEEVAVLTRALAGA  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
            GK+PVKLGQLL+VCTTNALARVMLGR+VF +  +K+D
Sbjct  162  GKSPVKLGQLLSVCTTNALARVMLGRRVFGERDAKAD  198



>gb|AFQ92056.1| flavonoid 3' hydroxylase [Pyrus pyrifolia]
Length=511

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 161/194 (83%), Gaps = 0/194 (0%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIF T+V A FLY L    + R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFFTVVLAFFLYRLFAPGRSRHGLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYGP  63

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRWR
Sbjct  64   LMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRWR  123

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV LGQLLNVCT NAL RVM
Sbjct  124  MLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLGQLLNVCTVNALGRVM  183

Query  541  LGRKVFNDGGSKSD  582
            +GR++F DG    D
Sbjct  184  VGRRLFGDGSGGED  197



>emb|CDP19008.1| unnamed protein product [Coffea canephora]
 emb|CDP16354.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG KPH S+AAMA+ YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPN
Sbjct  42   GNLPHLGTKPHHSLAAMAKTYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRS-LAS  468
            SGA+HIAYNYQDLVFAPYGPRWR+LRKI S+HLFSAKALDDF  VRQEEV TL R+ LAS
Sbjct  102  SGAKHIAYNYQDLVFAPYGPRWRLLRKICSIHLFSAKALDDFHLVRQEEVGTLARALLAS  161

Query  469  AGKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
            AGKTPV LGQLLNVCTTNAL RVMLGR+VF DG    DP
Sbjct  162  AGKTPVNLGQLLNVCTTNALGRVMLGRRVFGDGSGGGDP  200



>gb|AEA06595.1| flavonoid 3'-hydroxylase [Chromolaena odorata]
Length=507

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = +1

Query  31   FLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvd  210
             +++L+L ++ R+   LPPGP PWP++GNLPHLG  PH S+AA+A++YGPLMHLRLGFVD
Sbjct  15   LVFYLLLNLRPRHSKRLPPGPSPWPIVGNLPHLGTIPHHSLAALAKKYGPLMHLRLGFVD  74

Query  211  vvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHL  390
            VVVAASA+VAAQFLK HD+NF++RPPNSGA+HIAYNY DLVFAPYGPRWRMLRKI SVHL
Sbjct  75   VVVAASASVAAQFLKTHDANFASRPPNSGAKHIAYNYHDLVFAPYGPRWRMLRKICSVHL  134

Query  391  FSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFNDGG  570
            FS KALDDF H+RQEEVA LTR L  AG++ VKLGQLLNVCTTNALARVMLGR+VF DG 
Sbjct  135  FSTKALDDFRHIRQEEVAILTRVLVGAGESTVKLGQLLNVCTTNALARVMLGRRVFGDGS  194

Query  571  SKSDP  585
               DP
Sbjct  195  GTGDP  199



>gb|AIY22747.1| flavonoid 3'-hydroxylase [Iochroma calycinum]
Length=516

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 168/196 (86%), Gaps = 1/196 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  177
            +I  T++F+  L+  L L   +RYP+PLPPGPKPWP++GN+ HLG KPHQSIA MA  YG
Sbjct  6    IILYTIIFSFLLHSILSLFFLKRYPVPLPPGPKPWPIIGNIVHLGPKPHQSIADMARTYG  65

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            P MHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRW
Sbjct  66   PFMHLRMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAPYGPRW  125

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  537
            RMLRKI SVHLFSAKALDDF HVRQEEV TLTR+LA+A + PVKLGQLLNVCTTN+LARV
Sbjct  126  RMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANASQKPVKLGQLLNVCTTNSLARV  185

Query  538  MLGRKVFNDGGSKSDP  585
            MLG++VF DG    DP
Sbjct  186  MLGKRVFADGTGGIDP  201



>gb|AIY22748.1| flavonoid 3'-hydroxylase [Iochroma calycinum]
Length=516

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 168/196 (86%), Gaps = 1/196 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  177
            +I  T++F+  L+  L L   +RYP+PLPPGPKPWP++GN+ HLG KPHQSIA MA  YG
Sbjct  6    IILYTIIFSFLLHSILSLFFLKRYPVPLPPGPKPWPIIGNIVHLGPKPHQSIADMARTYG  65

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            P MHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRW
Sbjct  66   PFMHLRMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAPYGPRW  125

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  537
            RMLRKI SVHLFSAKALDDF HVRQEEV TLTR+LA+A + PVKLGQLLNVCTTN+LARV
Sbjct  126  RMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANASQKPVKLGQLLNVCTTNSLARV  185

Query  538  MLGRKVFNDGGSKSDP  585
            MLG++VF DG    DP
Sbjct  186  MLGKRVFADGTGGIDP  201



>gb|ABB29899.1| flavonoid 3'-hydroxylase [Osteospermum hybrid cultivar]
Length=514

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 145/196 (74%), Positives = 166/196 (85%), Gaps = 2/196 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            L+  + +  + +Y L L ++ R+   LPPGP PWP++GNLPHLG  PH S+AAMAE+YGP
Sbjct  6    LVLYSCITGLVIYVL-LNLRTRHSNRLPPGPTPWPIVGNLPHLGVVPHHSLAAMAEKYGP  64

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY-GPRW  357
            LMHLRLGFVDVVVAASAAVAAQFLKVHD+NF++RPPNSGA+HIAYNYQDLVFAPY GPRW
Sbjct  65   LMHLRLGFVDVVVAASAAVAAQFLKVHDANFASRPPNSGAKHIAYNYQDLVFAPYYGPRW  124

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  537
            RMLRKI SVHLFS+KALDDF HVRQEEVA LTR+L  AG +PVKLGQLLNVCTTNALARV
Sbjct  125  RMLRKICSVHLFSSKALDDFRHVRQEEVAILTRALIGAGDSPVKLGQLLNVCTTNALARV  184

Query  538  MLGRKVFNDGGSKSDP  585
            MLG++VF D     DP
Sbjct  185  MLGKRVFGDRSGGGDP  200



>ref|XP_007037547.1| Flavonoid 3'-hydroxylase isoform 1 [Theobroma cacao]
 gb|EOY22048.1| Flavonoid 3'-hydroxylase isoform 1 [Theobroma cacao]
Length=501

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 169/194 (87%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            +  +++ A+FLYF+   +++R+ LPLPPGPKPWP++GNLPH+G  PH S+AA+A+ YGPL
Sbjct  5    LLYSILSAVFLYFIFATLRKRHRLPLPPGPKPWPIIGNLPHMGPVPHHSLAALAKVYGPL  64

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            MHLRLGFVDVVVAASA+VAAQFLKVHD+NFS+RPPNSGA+++AYNYQDLVFAPYGPRWRM
Sbjct  65   MHLRLGFVDVVVAASASVAAQFLKVHDANFSSRPPNSGAKYVAYNYQDLVFAPYGPRWRM  124

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI+SVHLFS KALDDF HVRQ+EV  L R+LA A KT V LGQLLNVCT NAL RVML
Sbjct  125  LRKISSVHLFSGKALDDFRHVRQDEVGVLVRALADA-KTKVNLGQLLNVCTVNALGRVML  183

Query  544  GRKVFNDGGSKSDP  585
            G++VF DG  K+DP
Sbjct  184  GKRVFGDGSGKADP  197



>ref|XP_002319761.1| hypothetical protein POPTR_0013s07050g [Populus trichocarpa]
 gb|EEE95684.1| hypothetical protein POPTR_0013s07050g [Populus trichocarpa]
Length=521

 Score =   246 bits (629),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 168/198 (85%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  174
            LI  + + AIF+Y L+ LR ++ R+  PLPPGPKPWP++GNLPHLG  PH S+AA+A+ Y
Sbjct  4    LILYSALLAIFVYCLLQLRSLRDRHGKPLPPGPKPWPLVGNLPHLGPMPHHSMAALAKTY  63

Query  175  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  354
            GPLMHLR GFVDVVVAASA+VAAQFLKVHDSNFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  64   GPLMHLRFGFVDVVVAASASVAAQFLKVHDSNFSSRPPNSGAKHIAYNYQDLVFAPYGPR  123

Query  355  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLLNVCTTNALA  531
            WRMLRKI+SVHLFSAK+LDDF H+RQEEVA LT +L  +G  TPV LGQLLNVCT NAL 
Sbjct  124  WRMLRKISSVHLFSAKSLDDFRHIRQEEVAVLTGALTRSGPTTPVNLGQLLNVCTANALG  183

Query  532  RVMLGRKVFNDGGSKSDP  585
            RVMLGR+VF DG    DP
Sbjct  184  RVMLGRRVFGDGSGDGDP  201



>gb|ACN65825.1| flavonoid 3'-hydroxylase [Cichorium intybus]
Length=511

 Score =   246 bits (628),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 161/195 (83%), Gaps = 1/195 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LI    V  I  Y L L ++ R    LPPGP PWP++GNLPHLG  PH S+AA+A RYGP
Sbjct  6    LIIYACVTGIAAYVL-LNLRNRRAKRLPPGPTPWPIVGNLPHLGTIPHHSLAALATRYGP  64

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+H+AYNYQDLVFAPYGPRWR
Sbjct  65   LMHLRLGFVDVVVAASASVAAQFLKAHDANFASRPPNSGAKHMAYNYQDLVFAPYGPRWR  124

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI SVHLFSAK+LDDF HVRQEEVA LTR+L  AGK+ V LGQLLNVCTTNALARVM
Sbjct  125  MLRKICSVHLFSAKSLDDFRHVRQEEVAILTRALVDAGKSTVILGQLLNVCTTNALARVM  184

Query  541  LGRKVFNDGGSKSDP  585
            LGR+VF DG    DP
Sbjct  185  LGRRVFGDGSGGGDP  199



>ref|XP_007037548.1| Flavonoid 3'-hydroxylase isoform 2 [Theobroma cacao]
 gb|EOY22049.1| Flavonoid 3'-hydroxylase isoform 2 [Theobroma cacao]
Length=507

 Score =   246 bits (627),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 169/194 (87%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            +  +++ A+FLYF+   +++R+ LPLPPGPKPWP++GNLPH+G  PH S+AA+A+ YGPL
Sbjct  5    LLYSILSAVFLYFIFATLRKRHRLPLPPGPKPWPIIGNLPHMGPVPHHSLAALAKVYGPL  64

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            MHLRLGFVDVVVAASA+VAAQFLKVHD+NFS+RPPNSGA+++AYNYQDLVFAPYGPRWRM
Sbjct  65   MHLRLGFVDVVVAASASVAAQFLKVHDANFSSRPPNSGAKYVAYNYQDLVFAPYGPRWRM  124

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI+SVHLFS KALDDF HVRQ+EV  L R+LA A KT V LGQLLNVCT NAL RVML
Sbjct  125  LRKISSVHLFSGKALDDFRHVRQDEVGVLVRALADA-KTKVNLGQLLNVCTVNALGRVML  183

Query  544  GRKVFNDGGSKSDP  585
            G++VF DG  K+DP
Sbjct  184  GKRVFGDGSGKADP  197



>ref|XP_010695197.1| PREDICTED: flavonoid 3'-monooxygenase [Beta vulgaris subsp. vulgaris]
Length=512

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 169/195 (87%), Gaps = 1/195 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            L F T+  AIF+Y+LI  +  RYP PLPPGPKPWP++GNLPH+G  PHQ +A +A++YGP
Sbjct  6    LTFYTIALAIFIYYLITTIFSRYPGPLPPGPKPWPIVGNLPHMGPVPHQGLAKLAQKYGP  65

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            L+HLRLG+V VVVAASA+VAA+FLK HD+NFS+RPPNSGA++IAYNYQDLVFAPYGPRWR
Sbjct  66   LLHLRLGYVHVVVAASASVAAEFLKAHDANFSSRPPNSGAKYIAYNYQDLVFAPYGPRWR  125

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLLNVCTTNALARV  537
            MLRKI+S+HLFSAKAL+D+  +RQEEVA LT++LA +G   P++LGQLLNVCTTNAL+R 
Sbjct  126  MLRKISSLHLFSAKALEDYKPIRQEEVAILTKALAKSGSNNPIQLGQLLNVCTTNALSRA  185

Query  538  MLGRKVFNDGGSKSD  582
            MLGR+VF DG  KSD
Sbjct  186  MLGRRVFGDGTGKSD  200



>ref|XP_011011227.1| PREDICTED: flavonoid 3'-monooxygenase [Populus euphratica]
Length=521

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 168/198 (85%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  174
            LI  + + A+F+Y L+ LR ++ R+  PLPPGPKPWP++GNLPHLG  PH S+AA+A+ Y
Sbjct  4    LILYSALVAVFVYCLLQLRSLRDRHGKPLPPGPKPWPLVGNLPHLGPMPHHSMAALAKTY  63

Query  175  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  354
            GPLMHLR GFVDVVVAASA+VAAQFLKVHDSNFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  64   GPLMHLRFGFVDVVVAASASVAAQFLKVHDSNFSSRPPNSGAKHIAYNYQDLVFAPYGPR  123

Query  355  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLLNVCTTNALA  531
            WRMLRKI+SVHLFSAK+LDDF H+RQEEVA LT +L  +G  TPV LGQLLNVCT NAL 
Sbjct  124  WRMLRKISSVHLFSAKSLDDFRHIRQEEVAVLTGALTRSGPTTPVNLGQLLNVCTANALG  183

Query  532  RVMLGRKVFNDGGSKSDP  585
            RVMLGR+VF DG    DP
Sbjct  184  RVMLGRRVFGDGSGDGDP  201



>gb|ADB77825.1| flavonoid 3'-hydroxylase allele 1 [Dahlia pinnata]
Length=508

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG  PH S+AA+AE+YGPLMHLR GFVDVVVAASA+VA+QFLK HD+ F++RPPN
Sbjct  42   GNLPHLGTIPHHSLAALAEKYGPLMHLRFGFVDVVVAASASVASQFLKTHDAKFASRPPN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGAEHIAYNYQDLVFAPYGPRWRMLRKI SVHLFS KALDDF HVRQEEVA LTR LA A
Sbjct  102  SGAEHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDFRHVRQEEVAILTRVLAGA  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
            G + VKLGQLLNVCTTNALARVML R+VF DG  K+D
Sbjct  162  GNSTVKLGQLLNVCTTNALARVMLSRRVFGDGDPKAD  198



>gb|AEF30421.1| flavonoid 3'-hydroxylase, partial [Fagopyrum tataricum]
Length=277

 Score =   237 bits (605),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPH+G  PH S+AA+A+ YGPLMHLRLG V V++AASA+VA+QFLK HD+NFS+RPPN
Sbjct  6    GNLPHMGAVPHHSLAALAKVYGPLMHLRLGSVHVIIAASASVASQFLKTHDANFSSRPPN  65

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI  VHLFS KAL+DF  VR+EEV  LTR+L+ A
Sbjct  66   SGAKHIAYNYQDLVFAPYGPRWRMLRKICQVHLFSGKALEDFRFVREEEVGILTRALSKA  125

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
            GK  V+LGQLLNVCTTNAL RVMLGR+VF DG  K+DP
Sbjct  126  GKNAVQLGQLLNVCTTNALGRVMLGRRVFGDGSGKADP  163



>gb|KDP31334.1| hypothetical protein JCGZ_11710 [Jatropha curcas]
Length=511

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG KPHQS+AA+A  YGPLMHLR+GFVDVVVAASAAVA QFLKVHD+NFS+RPPN
Sbjct  39   GNLPHLGPKPHQSLAALARSYGPLMHLRMGFVDVVVAASAAVATQFLKVHDANFSSRPPN  98

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
             GA+++AYNYQDLVFAPYGPRWRMLRKI+SVHLFS KALDDF H+RQ+EV+ LTR+LASA
Sbjct  99   CGAKYVAYNYQDLVFAPYGPRWRMLRKISSVHLFSGKALDDFRHIRQQEVSVLTRALASA  158

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
            G TPV LGQLLNVCT NAL RVM+GR+VF DG    D
Sbjct  159  GPTPVNLGQLLNVCTANALGRVMIGRRVFGDGTGGGD  195



>dbj|BAN62871.1| flavonoid 3'-hydroxylase [Dianthus caryophyllus]
Length=513

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 166/195 (85%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            L F T+V A  LY+LI  V + +  PLPPGP+PWP++GNLPH+G+ PHQ +AA+A++YGP
Sbjct  6    LTFYTIVLATILYYLITTVFRGHQKPLPPGPRPWPIVGNLPHMGQAPHQGLAALAQKYGP  65

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            L+++RLG+VDVVVAASA+VA QFLK HD NFS+RPPNSGA+HIAYNYQDLVFAPYGP+WR
Sbjct  66   LLYMRLGYVDVVVAASASVATQFLKTHDLNFSSRPPNSGAKHIAYNYQDLVFAPYGPKWR  125

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI S+H+FS+KALDDF  VRQEEV+ L  ++A AG  PV+LGQLLNVCTTNAL+RVM
Sbjct  126  MLRKICSLHMFSSKALDDFRLVRQEEVSILVNAIAKAGTKPVQLGQLLNVCTTNALSRVM  185

Query  541  LGRKVFNDGGSKSDP  585
            LG++V  DG  KSDP
Sbjct  186  LGKRVLGDGTGKSDP  200



>gb|ADA85883.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
 gb|AGX01487.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 163/192 (85%), Gaps = 1/192 (1%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A++YGPL
Sbjct  7    VFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALAKKYGPL  65

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            MHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYGPRWR+
Sbjct  66   MHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPYGPRWRL  125

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI SVHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNALARVML
Sbjct  126  LRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNALARVML  185

Query  544  GRKVFNDGGSKS  579
            GR+VF DG  +S
Sbjct  186  GRRVFGDGIDRS  197



>gb|ADA85878.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 163/192 (85%), Gaps = 1/192 (1%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A++YGPL
Sbjct  7    VFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALAKKYGPL  65

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            MHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYGPRWR+
Sbjct  66   MHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPYGPRWRL  125

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI SVHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNALARVML
Sbjct  126  LRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNALARVML  185

Query  544  GRKVFNDGGSKS  579
            GR+VF DG  +S
Sbjct  186  GRRVFGDGIDRS  197



>gb|ADA85882.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   243 bits (621),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 163/192 (85%), Gaps = 1/192 (1%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A++YGPL
Sbjct  7    VFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALAKKYGPL  65

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            MHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYGPRWR+
Sbjct  66   MHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPYGPRWRL  125

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI SVHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNALARVML
Sbjct  126  LRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNALARVML  185

Query  544  GRKVFNDGGSKS  579
            GR+VF DG  +S
Sbjct  186  GRRVFGDGIDRS  197



>ref|XP_009338402.1| PREDICTED: flavonoid 3'-monooxygenase [Pyrus x bretschneideri]
Length=511

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 160/195 (82%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LI  T+VFA FLY +      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIVFTVVFAFFLYRIFAPSGSRHSLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYGP  63

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRWR
Sbjct  64   LMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRWR  123

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV L QLLNVCT NAL RVM
Sbjct  124  MLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSRPVNLAQLLNVCTVNALGRVM  183

Query  541  LGRKVFNDGGSKSDP  585
            +GR++F +G    DP
Sbjct  184  VGRRLFGNGKGGEDP  198



>gb|ABC47161.1| flavonoid 3'-hydroxylase [Pilosella officinarum]
Length=512

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG  PH S+A +A RYGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPN
Sbjct  42   GNLPHLGTIPHHSLADLATRYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+H+AYNYQDLVFAPYGPRWRMLRKI SVHLFSAK+LDDF HVRQEEVA LTR+L  A
Sbjct  102  SGAKHMAYNYQDLVFAPYGPRWRMLRKICSVHLFSAKSLDDFRHVRQEEVAILTRALVGA  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
            GK+ VKLGQLL+VCTTNAL RVMLGR+VF DG    DP
Sbjct  162  GKSTVKLGQLLHVCTTNALVRVMLGRRVFGDGSGGGDP  199



>dbj|BAJ17668.1| flavonoid 3' hydroxylase [Gynura bicolor]
Length=511

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            L+  T + A+ LY L L +  R+P  LPPGP PWP++GNLPHLG  PH  +AA+A +YGP
Sbjct  6    LVLYTSIIALVLYVL-LNLFTRHPNRLPPGPTPWPIVGNLPHLGSIPHHGLAALATKYGP  64

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+H+AYNYQDLVFAPYGPRWR
Sbjct  65   LMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPNSGAKHMAYNYQDLVFAPYGPRWR  124

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            +LRKI SVHLFS+KALDDF HVRQEEVA LTR L  A K+PVKLGQLLNVCTTNALARVM
Sbjct  125  LLRKICSVHLFSSKALDDFRHVRQEEVAILTRDLVGAKKSPVKLGQLLNVCTTNALARVM  184

Query  541  LGRKVFNDGGS  573
            LGR+VF  GG 
Sbjct  185  LGRRVFGSGGG  195



>gb|ACR14867.1| flavonoid 3' hydroxylase [Malus domestica]
Length=511

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 160/195 (82%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LI  T+VFA FLY +      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIVFTVVFAFFLYRIFAPGGSRHSLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYGP  63

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRWR
Sbjct  64   LMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRWR  123

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            +LRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV L QLLNVCT NAL RVM
Sbjct  124  LLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLAQLLNVCTVNALGRVM  183

Query  541  LGRKVFNDGGSKSDP  585
            +GR++F +G    DP
Sbjct  184  VGRRLFGNGMGGEDP  198



>ref|XP_008393217.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=511

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 160/195 (82%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LI  T+VFA FLY +      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIVFTVVFAFFLYRIFAPGGSRHSLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYGP  63

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRWR
Sbjct  64   LMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRWR  123

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            +LRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV L QLLNVCT NAL RVM
Sbjct  124  LLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLAQLLNVCTVNALGRVM  183

Query  541  LGRKVFNDGGSKSDP  585
            +GR++F +G    DP
Sbjct  184  VGRRLFGNGMGGEDP  198



>gb|ACV74415.1| putative flavonoid-3'-hydroxylase [Camellia sinensis]
Length=518

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 162/198 (82%), Gaps = 4/198 (2%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLI-LRVK--QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  174
            +  +L+ A+FLY L+ LR     R+P PLPPGP PWPV+GNLPHLG  PH SIA MA  Y
Sbjct  7    VLYSLLIAVFLYCLLNLRTLLFNRHPRPLPPGPTPWPVIGNLPHLGTMPHHSIATMARTY  66

Query  175  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  354
            GPLMHLRLG VDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  67   GPLMHLRLGLVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPR  126

Query  355  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK-TPVKLGQLLNVCTTNALA  531
            WRMLRKI SVHLFS KALDDF HVRQEE+A LTR+L SAG+   V LGQLLNVCTTNAL 
Sbjct  127  WRMLRKICSVHLFSTKALDDFRHVRQEEIAILTRALESAGQAAAVNLGQLLNVCTTNALG  186

Query  532  RVMLGRKVFNDGGSKSDP  585
            RVMLG +VF DG    DP
Sbjct  187  RVMLGHRVFGDGSGSGDP  204



>gb|ADZ54783.1| flavonoid 3'-monooxygenase [Prunus avium]
Length=510

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 160/194 (82%), Gaps = 1/194 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIF T+VFA FLY L++    R+ LPL PGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAAFLYRLLVP-GNRHSLPLAPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDV+VAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVIVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI+SVHLFS KALDD  HVRQEEVA L  SLA AG   V L QLLN+CT NAL RVM
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHSLAGAGSKTVNLAQLLNICTVNALGRVM  182

Query  541  LGRKVFNDGGSKSD  582
            +G+K+F DG    D
Sbjct  183  VGKKLFADGSGSGD  196



>gb|KDO54631.1| hypothetical protein CISIN_1g020877mg [Citrus sinensis]
Length=320

 Score =   235 bits (600),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG  PHQSIA +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPN
Sbjct  47   GNLPHLGPMPHQSIAGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPN  106

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNYQD+VF PYGPRWRMLRKI+SVHLFS KALDD+ HVRQEE+A LTR+LASA
Sbjct  107  SGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASA  166

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
            G  PV L Q LN+C  NAL RVMLG +VF DG   SDP
Sbjct  167  GTEPVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGSDP  204



>gb|ADA85879.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   241 bits (614),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 162/192 (84%), Gaps = 1/192 (1%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A++YGPL
Sbjct  7    VFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALAKKYGPL  65

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            MHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYGPRWR+
Sbjct  66   MHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPYGPRWRL  125

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI SVHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNALARVML
Sbjct  126  LRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNALARVML  185

Query  544  GRKVFNDGGSKS  579
            GR+VF  G  +S
Sbjct  186  GRRVFGGGIDRS  197



>gb|AJA79074.1| flavonoid 3' hydroxylase [Prunus persica]
 gb|AJA79081.1| flavonoid 3' hydroxylase [Prunus persica]
Length=509

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 159/194 (82%), Gaps = 1/194 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIF T+VFA  LY L+     R+ LPLPPGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  9    LIFITVVFAALLYRLLFS-GNRHSLPLPPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  67

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  68   LMHLRLGFVDVVVAASASVASQFLKTHDTNFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  127

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI+SVHLFS KALDD  HVRQEEVA L   LA AG  PV L QLLNVCT NAL RVM
Sbjct  128  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHGLAGAGSKPVNLAQLLNVCTVNALGRVM  187

Query  541  LGRKVFNDGGSKSD  582
            +G+++F DG    D
Sbjct  188  VGKRLFGDGSGSGD  201



>gb|AGC29948.1| CYP75B65 [Sinopodophyllum hexandrum]
Length=510

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 160/196 (82%), Gaps = 2/196 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LI  TLV    +Y +I ++  R PLPLPPGPKPWP++GNLPHLG  PH S+A++A +YGP
Sbjct  6    LILSTLVIGTIVYTIISKLINRTPLPLPPGPKPWPIVGNLPHLGPVPHHSLASLASKYGP  65

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLG V+V+VAAS++VA Q  K HD+NFS+RPPNSGA+HIAYNYQDLVFAPYGP+WR
Sbjct  66   LMHLRLGSVNVIVAASSSVAVQIFKTHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPKWR  125

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI SVHLFSAKALDDF H+RQEEV  LT+ L  AGK PV L +LLNVCTTNAL RVM
Sbjct  126  MLRKICSVHLFSAKALDDFRHIRQEEVMVLTKVLLGAGKAPVDLAKLLNVCTTNALGRVM  185

Query  541  LGRKVFNDGG--SKSD  582
            LGR+VF DG    KSD
Sbjct  186  LGRRVFGDGNGDEKSD  201



>ref|XP_007209917.1| hypothetical protein PRUPE_ppa004433mg [Prunus persica]
 gb|AFC62055.1| flavonoid 3' hydroxylase [Prunus persica]
 gb|EMJ11116.1| hypothetical protein PRUPE_ppa004433mg [Prunus persica]
Length=510

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 159/194 (82%), Gaps = 1/194 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIF T+VFA  LY L+     R+ LPLPPGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAALLYRLLFS-GNRHSLPLPPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVVVAASASVASQFLKTHDTNFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI+SVHLFS KALDD  HVRQEEVA L   LA AG  PV L QLLNVCT NAL RVM
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHGLAGAGSKPVNLAQLLNVCTVNALGRVM  182

Query  541  LGRKVFNDGGSKSD  582
            +G+++F DG    D
Sbjct  183  VGKRLFGDGSGSGD  196



>gb|AAG49298.1|AF313488_1 putative flavonoid 3'-hydroxylase [Callistephus chinensis]
Length=518

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 142/160 (89%), Gaps = 2/160 (1%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG  PH S+AA+A++YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPN
Sbjct  42   GNLPHLGMIPHHSLAALAQKYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI SVHLFS KALDDF HVR+EEVA LTR L  A
Sbjct  102  SGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSTKALDDFRHVREEEVAILTRVLVHA  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDG--GSKSDP  585
            G++ VKLGQLLNVCTTNALARVMLGR+VF DG  G   DP
Sbjct  162  GESAVKLGQLLNVCTTNALARVMLGRRVFADGSEGRGVDP  201



>ref|XP_010259651.1| PREDICTED: flavonoid 3'-monooxygenase [Nelumbo nucifera]
Length=513

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = +1

Query  19   VFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRL  198
            +F  FL + +  +  RYP PLPPGPKPWP++GNLPHLG  PH S+AAMA  YGPL+HLRL
Sbjct  11   LFVAFLIYFLFNLLNRYPRPLPPGPKPWPIIGNLPHLGTVPHHSLAAMARTYGPLLHLRL  70

Query  199  GFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKIT  378
            G V VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPRWRMLRKI 
Sbjct  71   GSVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPRWRMLRKIC  130

Query  379  SVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVF  558
            SVHLFS KALDDF H+RQEEVA L R+LA AGK  V +GQLL+VCTTNALARVMLGR+VF
Sbjct  131  SVHLFSGKALDDFRHIRQEEVAVLIRALAGAGKAAVNVGQLLSVCTTNALARVMLGRRVF  190

Query  559  NDGGSKSD  582
              G    D
Sbjct  191  GSGEGTGD  198



>gb|KJB51033.1| hypothetical protein B456_008G198200 [Gossypium raimondii]
Length=422

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 166/194 (86%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YGPL
Sbjct  5    VLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYGPL  64

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            MHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRWR+
Sbjct  65   MHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRWRL  124

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI+S+HLFS KALDDF  +R+EE+  L R+LASA KT V LGQLLNVCT NAL +VM+
Sbjct  125  LRKISSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQVMM  183

Query  544  GRKVFNDGGSKSDP  585
            G++VF DG   SDP
Sbjct  184  GKRVFGDGSGGSDP  197



>dbj|BAJ16330.1| flavonoid 3'-hydroxylase [Antirrhinum kelloggii]
Length=509

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LI  TL+    L ++ L  K +   PLPPGPKPWP++GNLPHLG KPHQS+AA+A  +GP
Sbjct  7    LIASTLILGFLLLYIFLNRKAKAAAPLPPGPKPWPIVGNLPHLGPKPHQSMAALARVHGP  66

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            L+HL++GFV VVVAASA+VA +FLKVHD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRWR
Sbjct  67   LIHLKMGFVHVVVAASASVAEKFLKVHDANFSSRPPNSGAKHVAYNYQDLVFAPYGPRWR  126

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI ++HLFSAKAL DF HVRQEEV  LTR+LA AGKTPVKLGQ+LN C TNA+ARVM
Sbjct  127  MLRKICALHLFSAKALTDFTHVRQEEVGILTRALADAGKTPVKLGQMLNTCATNAIARVM  186

Query  541  LGRKV  555
            LGR+V
Sbjct  187  LGRRV  191



>gb|KDO37751.1| hypothetical protein CISIN_1g042286mg, partial [Citrus sinensis]
Length=303

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG  PHQSIA +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPN
Sbjct  47   GNLPHLGPMPHQSIAGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPN  106

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNYQD+VF PYGPRWRMLRKI+SVHLFS KALDD+ HVRQEE+A L R+LASA
Sbjct  107  SGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLARALASA  166

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
            G  PV L Q LN+C  NAL RVMLG +VF DG   SDP
Sbjct  167  GTEPVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGSDP  204



>gb|ADM26615.1| flavonoid 3'-hydroxylase [Cynara cardunculus var. scolymus]
Length=512

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG+ PH ++AAMA +YGPLMHLRLG VDVVVAASA+VAAQFLKVHD+NF++RPPN
Sbjct  42   GNLPHLGRIPHHALAAMATKYGPLMHLRLGVVDVVVAASASVAAQFLKVHDANFASRPPN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAY+YQDLVFAPYGP+WRMLRKI SVHLFS KALDDF HVR+EEVA L R+LA A
Sbjct  102  SGAKHIAYDYQDLVFAPYGPKWRMLRKICSVHLFSNKALDDFRHVREEEVAILARALAGA  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
            G++ V LGQLLNVCTTNALARVMLGR+VF DG    DP
Sbjct  162  GRSTVALGQLLNVCTTNALARVMLGRRVFGDGSGGVDP  199



>gb|ADA85881.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 162/192 (84%), Gaps = 1/192 (1%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A++YGPL
Sbjct  7    VFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALAKKYGPL  65

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            MHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYGPRWR+
Sbjct  66   MHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPYGPRWRL  125

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI SVHLFSAKALDDF HVRQE+VA LTR L SAG +PV+LGQLLNVC TNALARVML
Sbjct  126  LRKICSVHLFSAKALDDFRHVRQEKVAVLTRVLVSAGNSPVQLGQLLNVCATNALARVML  185

Query  544  GRKVFNDGGSKS  579
            GR+V  DG  +S
Sbjct  186  GRRVSGDGIDRS  197



>dbj|BAF96945.1| flavonoid 3'-hydroxylase [Rhododendron x pulchrum]
Length=480

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 138/158 (87%), Gaps = 1/158 (1%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG  PH SIAA+A  YGPLMHL +G V VVVAASA+VAAQFLK HD+NFS+RPPN
Sbjct  7    GNLPHLGTMPHHSIAALAREYGPLMHLWMGSVHVVVAASASVAAQFLKTHDANFSSRPPN  66

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI SVHLFSAKALDDF HVRQEEVA LTR+LA+A
Sbjct  67   SGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSAKALDDFRHVRQEEVAILTRALANA  126

Query  472  GK-TPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
            GK T V LGQLLN+CTTNA+ARVMLGR+VF DG    D
Sbjct  127  GKSTTVNLGQLLNLCTTNAIARVMLGRRVFGDGSGSGD  164



>ref|XP_008240031.1| PREDICTED: flavonoid 3'-monooxygenase [Prunus mume]
Length=510

 Score =   238 bits (607),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 159/194 (82%), Gaps = 1/194 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIF T+VFA FLY L+     R+ LPLPPGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAAFLYRLLFS-GNRHFLPLPPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVVVAASASVASQFLKTHDTNFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI+SVHLFS KALDD  HVRQEE+A L   LA AG   V L QLLNVCT NAL RVM
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEIAVLAHGLAGAGSKTVNLAQLLNVCTVNALGRVM  182

Query  541  LGRKVFNDGGSKSD  582
            +G+++F DG    D
Sbjct  183  VGKRLFGDGSGSGD  196



>gb|ADA85880.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 161/192 (84%), Gaps = 1/192 (1%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A++YGPL
Sbjct  7    VFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALAKKYGPL  65

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
             HLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAP GPRWR+
Sbjct  66   THLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPCGPRWRL  125

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI SVHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNALARVML
Sbjct  126  LRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNALARVML  185

Query  544  GRKVFNDGGSKS  579
            GR+VF DG  +S
Sbjct  186  GRRVFGDGIDRS  197



>dbj|BAF49324.1| flavonoid 3'-hydroxylase [Lobelia erinus]
Length=515

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 161/202 (80%), Gaps = 8/202 (4%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLI-------LRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  159
            LIF T + A  LY L+       L        PLPPGPKPWP++GNLPHLG  PHQ++AA
Sbjct  3    LIFYTCIIAFLLYVLLSTLRTFLLNRNPASRKPLPPGPKPWPIVGNLPHLGTMPHQTMAA  62

Query  160  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  339
            +A  YGPLMHLRLG VDVVVAAS AVA QFLKVHD+NF NRPPNSGA HIAYNYQDLVFA
Sbjct  63   LARTYGPLMHLRLGSVDVVVAASGAVAEQFLKVHDANFLNRPPNSGAVHIAYNYQDLVFA  122

Query  340  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  519
            PYGPRWR+LRK+++VHLFSAKALDDF HVRQEEVA LTR LASAG  PV L QLL+VCTT
Sbjct  123  PYGPRWRLLRKVSAVHLFSAKALDDFRHVRQEEVAVLTRDLASAGNAPVHLNQLLSVCTT  182

Query  520  NALARVMLGRKVFNDGG-SKSD  582
            NAL+RVM G++VF  GG SK+D
Sbjct  183  NALSRVMFGKRVFGGGGDSKAD  204



>gb|KHG07922.1| Flavonoid 3',5'-hydroxylase [Gossypium arboreum]
Length=510

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 166/194 (86%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            +  +++  +FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YGPL
Sbjct  5    VLYSILSTVFLYFVFIISRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYGPL  64

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            MHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRWR+
Sbjct  65   MHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRWRL  124

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI+SVHLFS KALDDF H+R+EE+  L R+LASA KT V LGQLLNVCT NAL +VM+
Sbjct  125  LRKISSVHLFSGKALDDFRHIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQVMM  183

Query  544  GRKVFNDGGSKSDP  585
            G++VF DG   +DP
Sbjct  184  GKRVFGDGSGGADP  197



>dbj|BAN05297.1| flavonoid 3'-hydroxylase [Dianthus caryophyllus]
Length=514

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 165/196 (84%), Gaps = 1/196 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            L F T+  A  LY+LI  V + +  PLPPGP+PWP++GNLPH+G+ PHQ +AA+A++YGP
Sbjct  6    LTFYTIALATILYYLIPTVFRGHQKPLPPGPRPWPIVGNLPHMGQAPHQGLAALAQKYGP  65

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            L+++RLG+VDVVVAASA+VA QFLK HD NFS+RPPNSGA+HIAYNYQDLVFAPYGP+WR
Sbjct  66   LLYMRLGYVDVVVAASASVATQFLKTHDLNFSSRPPNSGAKHIAYNYQDLVFAPYGPKWR  125

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ-LLNVCTTNALARV  537
            MLRKI S+H+FS+KALDDF  VRQEEV+ L  ++A AG  PV+LGQ LLNVCTTNAL+RV
Sbjct  126  MLRKICSLHMFSSKALDDFRLVRQEEVSILVNAIAKAGTKPVQLGQLLLNVCTTNALSRV  185

Query  538  MLGRKVFNDGGSKSDP  585
            MLG++V  DG  KSDP
Sbjct  186  MLGKRVLGDGTGKSDP  201



>gb|AIU98513.1| flavonoid 3'-hydroxylase [Paeonia suffruticosa]
Length=512

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG KPHQS+A++A  YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+NF+NRPPN
Sbjct  45   GNLPHLGSKPHQSLASLARSYGPLMHLRLGFVDVVVAASASVAAQFLKTNDANFANRPPN  104

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA++IAYNYQDLVFAPYGPRWR+LRK++S+HLFS KALDDF H+RQEEVA LT +LASA
Sbjct  105  SGAKYIAYNYQDLVFAPYGPRWRLLRKVSSLHLFSGKALDDFRHLRQEEVAVLTHALASA  164

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
              + V LGQLLNVCTTNALARVMLG++VF DG   +DP
Sbjct  165  RDSLVNLGQLLNVCTTNALARVMLGKRVFGDGSGGADP  202



>gb|ADK56126.1| putative flavonoid 3'-hydroxylase [Coreopsis grandiflora]
Length=512

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 158/195 (81%), Gaps = 1/195 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LI    V  I  Y L L ++ R    LPPGP PWP++GNLPHLG  PH S+AA+A RYGP
Sbjct  6    LIIYACVTGIAAYVL-LNLRNRRAKRLPPGPTPWPIVGNLPHLGTIPHHSLAALATRYGP  64

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RP +SG +H+AYNYQDLVFAPYGPRWR
Sbjct  65   LMHLRLGFVDVVVAASASVAAQFLKAHDANFASRPLSSGGKHMAYNYQDLVFAPYGPRWR  124

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI SVHLF AK+LDDF HVRQEEVA LTR+L  AGK+ V LGQLLNVCTTNALARVM
Sbjct  125  MLRKICSVHLFPAKSLDDFRHVRQEEVAILTRALVDAGKSTVILGQLLNVCTTNALARVM  184

Query  541  LGRKVFNDGGSKSDP  585
            LGR+VF DG    DP
Sbjct  185  LGRRVFGDGSGGGDP  199



>gb|AEN71546.1| flavanone 3'-hydroxylase [Paeonia suffruticosa]
Length=512

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG KPHQS+A++A  YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+NF+NRPPN
Sbjct  45   GNLPHLGSKPHQSLASLARSYGPLMHLRLGFVDVVVAASASVAAQFLKTNDANFANRPPN  104

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA++IAYNYQDLVFAPYGPRWR+LRK++S+HLFS KALDDF H+RQEEVA LT +LASA
Sbjct  105  SGAKYIAYNYQDLVFAPYGPRWRLLRKVSSLHLFSGKALDDFRHLRQEEVAVLTHALASA  164

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
              + V LGQLLNVCTTNALARVMLG++VF DG   +DP
Sbjct  165  RDSLVNLGQLLNVCTTNALARVMLGKRVFGDGSGGADP  202



>gb|KJB51032.1| hypothetical protein B456_008G198200 [Gossypium raimondii]
Length=510

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 166/194 (86%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YGPL
Sbjct  5    VLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYGPL  64

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            MHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRWR+
Sbjct  65   MHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRWRL  124

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI+S+HLFS KALDDF  +R+EE+  L R+LASA KT V LGQLLNVCT NAL +VM+
Sbjct  125  LRKISSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQVMM  183

Query  544  GRKVFNDGGSKSDP  585
            G++VF DG   SDP
Sbjct  184  GKRVFGDGSGGSDP  197



>ref|XP_010030596.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW83708.1| hypothetical protein EUGRSUZ_B00582 [Eucalyptus grandis]
Length=514

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 157/194 (81%), Gaps = 1/194 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LI  T+  + FLY L L    R   PLPPGP+PWP++GNLPHLG  PH SIAA+A  YGP
Sbjct  6    LILATVAISAFLYSL-LGYLSRPARPLPPGPRPWPLVGNLPHLGPVPHHSIAALARTYGP  64

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASA+VAA+FLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  65   LMHLRLGFVDVVVAASASVAAEFLKTHDTNFSSRPPNSGAKHIAYNYQDLVFAPYGPRWR  124

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI+SVHLFS KAL+D+ HVRQEEVA LT +LA AG  P  L QLLNVCT NAL RVM
Sbjct  125  MLRKISSVHLFSGKALEDYRHVRQEEVAILTSALARAGSAPANLAQLLNVCTVNALGRVM  184

Query  541  LGRKVFNDGGSKSD  582
            LGR++F DG    D
Sbjct  185  LGRRMFGDGSGGGD  198



>gb|ACY06905.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
Length=510

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP +GNLPH+   PHQ +AAMA+ YGPL
Sbjct  5    VLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPSIGNLPHMSPVPHQGLAAMAKVYGPL  64

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            MHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRWR+
Sbjct  65   MHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRWRL  124

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRK++S+HLFS KALDDF  +R+EE+  L R+LASA KT V LGQLLNVCT NAL +VM+
Sbjct  125  LRKMSSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQVMM  183

Query  544  GRKVFNDGGSKSDP  585
            G++VF DG   SDP
Sbjct  184  GKRVFGDGSGGSDP  197



>gb|ADP24158.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
 gb|ADP24159.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
Length=510

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 166/194 (86%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YGPL
Sbjct  5    VLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYGPL  64

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            MHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRWR+
Sbjct  65   MHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRWRL  124

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRK++S+HLFS KALDDF  +R+EE+  L R+LASA KT V LGQLLNVCT NAL +VM+
Sbjct  125  LRKMSSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQVMM  183

Query  544  GRKVFNDGGSKSDP  585
            G++VF DG   SDP
Sbjct  184  GKRVFGDGSGGSDP  197



>gb|ACO35754.1| flavonoid 3'-hydroxylase [Dahlia pinnata]
Length=509

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 166/195 (85%), Gaps = 2/195 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            L+  T + +  LY L+L ++ R+P  LPPGP PWP++GNLPHLG  PH S+A +A +YGP
Sbjct  6    LLLYTSITSPVLY-LLLNLRTRHPNRLPPGPTPWPIVGNLPHLGTIPHHSLARLAVKYGP  64

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASA+VAAQFLK +D+ F++RPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  65   LMHLRLGFVDVVVAASASVAAQFLKTNDAIFASRPPNSGAKHIAYNYQDLVFAPYGPRWR  124

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI SVHLFSAKALDDF H+RQEEVA LTR+L  AG++ VKLGQLLNVCTTNALARVM
Sbjct  125  MLRKICSVHLFSAKALDDFRHIRQEEVAILTRALIGAGESTVKLGQLLNVCTTNALARVM  184

Query  541  LGRKVFNDGGS-KSD  582
            LGR+VF D G  K+D
Sbjct  185  LGRRVFGDTGDLKAD  199



>ref|XP_009771410.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'-monooxygenase-like 
[Nicotiana sylvestris]
Length=515

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 163/196 (83%), Gaps = 1/196 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  177
            LI  T++F+  L+  L L  ++RYPLPLPPGPKPWP++GNL H+G KPHQSIAAMA  YG
Sbjct  6    LILYTVIFSFLLHSILTLFFRKRYPLPLPPGPKPWPIIGNLVHMGPKPHQSIAAMARTYG  65

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            PLMHL++GFVDVVVAASA+VAAQFLK HD+NFS+RP NS  +H+AYN QDLVFAPYGPRW
Sbjct  66   PLMHLKMGFVDVVVAASASVAAQFLKTHDANFSSRPQNSCTKHLAYNSQDLVFAPYGPRW  125

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  537
            RMLRKI SVHLFSAK LDDF HVRQ EV  LTR+LASAG+ PVKLGQLLNVCTTNAL +V
Sbjct  126  RMLRKICSVHLFSAKPLDDFRHVRQNEVRILTRALASAGQKPVKLGQLLNVCTTNALTQV  185

Query  538  MLGRKVFNDGGSKSDP  585
            MLGR+VF       DP
Sbjct  186  MLGRRVFAGASGGVDP  201



>gb|ACO35756.1| flavonoid 3'-hydroxylase [Tagetes erecta]
Length=509

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 166/195 (85%), Gaps = 2/195 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            L+  T + +  LY L+L ++ R+P  LPPGP PWP++GNLPHLG  PH S+A +A +YGP
Sbjct  6    LLLYTSITSPVLY-LLLNLRTRHPNRLPPGPTPWPIVGNLPHLGTIPHHSLARLAVKYGP  64

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVAASA+VAAQFLK +D+ F++RPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  65   LMHLRLGFVDVVVAASASVAAQFLKTNDAIFASRPPNSGAKHIAYNYQDLVFAPYGPRWR  124

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI SVHLFSAKALDDF H+RQEEVA LTR+L  AG++ VKLGQLLNVCTTNALARVM
Sbjct  125  MLRKICSVHLFSAKALDDFRHIRQEEVAILTRALIGAGESTVKLGQLLNVCTTNALARVM  184

Query  541  LGRKVFNDGGS-KSD  582
            LGR+VF D G  K+D
Sbjct  185  LGRRVFGDTGDLKAD  199



>gb|ACO35755.1| chalcone 3-hydroxylase [Cosmos sulphureus]
Length=512

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG  PHQS+A +A +YGPLM+LRLGFVDVVVAASA+VAAQFLKVHD NF++RP +
Sbjct  42   GNLPHLGASPHQSLATLAAKYGPLMYLRLGFVDVVVAASASVAAQFLKVHDLNFASRPLS  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SG ++IAYNYQD+VFAPYGPRWRMLRKI SVH+FSAKA+D F HVRQEEVA LTR+L SA
Sbjct  102  SGGKYIAYNYQDMVFAPYGPRWRMLRKICSVHMFSAKAMDGFRHVRQEEVAILTRTLVSA  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
            GK+PVKLGQ+LNVCTTNALARV+LGR+VF DG +  DP
Sbjct  162  GKSPVKLGQILNVCTTNALARVVLGRRVFADGSAGGDP  199



>ref|XP_010258076.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nelumbo nucifera]
 ref|XP_010258077.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nelumbo nucifera]
Length=516

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 157/191 (82%), Gaps = 4/191 (2%)
 Frame = +1

Query  22   FAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLG  201
            F  FL +  L    RYP PLPPGPKPWP++GNLPHLG  PH +IAA+A  YGPL+HLRLG
Sbjct  12   FVAFLIYFFLNFSNRYPRPLPPGPKPWPIIGNLPHLGPVPHHTIAALARVYGPLLHLRLG  71

Query  202  FvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS  381
             V VVVAASA+VA+QFLK HD+NFS+RPPNSGA+HIAYNY DLVFAPYGPRWR+LRKI S
Sbjct  72   SVHVVVAASASVASQFLKTHDANFSSRPPNSGAKHIAYNYHDLVFAPYGPRWRLLRKICS  131

Query  382  VHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFN  561
            VHLFS KALDDF HVRQEEVA LTR+L+ +G +P+ +GQLLNVCTTNALARVMLGR+VF 
Sbjct  132  VHLFSGKALDDFRHVRQEEVAVLTRALSRSGTSPLNVGQLLNVCTTNALARVMLGRRVFE  191

Query  562  D----GGSKSD  582
                 G  KSD
Sbjct  192  SDDGTGNRKSD  202



>gb|AEX07282.1| F3'H [Arachis hypogaea]
Length=517

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 165/197 (84%), Gaps = 3/197 (2%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            + F T+  AI +Y  I++   R  LPLPPGPKPWP++GNLPHLG  PH +IAA+A+ +GP
Sbjct  7    IAFATIALAILIY-RIVKFVTRPSLPLPPGPKPWPIIGNLPHLGPVPHHAIAALAKVHGP  65

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLG VDVVVAASA VA QFLKVHD+NFS+RPPN+GA++IAYNYQDLVFAPYGPRWR
Sbjct  66   LMHLRLGMVDVVVAASAKVAEQFLKVHDANFSSRPPNAGAKYIAYNYQDLVFAPYGPRWR  125

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTP--VKLGQLLNVCTTNALAR  534
            MLRKI+S+HLFSAKALDDF H+RQ EVA LT+++AS+  T   V LGQLLNVCTTNALAR
Sbjct  126  MLRKISSLHLFSAKALDDFKHLRQGEVARLTKNIASSTDTSKAVNLGQLLNVCTTNALAR  185

Query  535  VMLGRKVFNDGGSKSDP  585
            VM+GR+VFNDG    DP
Sbjct  186  VMIGRRVFNDGNGGCDP  202



>gb|ADT63065.1| flavonoid 3'-hydroxylase, partial [Fagopyrum esculentum]
Length=457

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPH+G  PH S+AA+A+ YGPLMHLRLG V V++AASA+VA+QFLK HD+NFS+RPPN
Sbjct  6    GNLPHMGAVPHHSLAALAKVYGPLMHLRLGSVHVIIAASASVASQFLKTHDANFSSRPPN  65

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI  VHLFS KAL+DF  VR+EEV  LT +L+ A
Sbjct  66   SGAKHIAYNYQDLVFAPYGPRWRMLRKICQVHLFSGKALEDFRFVREEEVGILTGALSKA  125

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
            GK  V+LGQLLNVCTTNAL RVMLGR+VF DG  K+DP
Sbjct  126  GKNAVQLGQLLNVCTTNALGRVMLGRRVFGDGSGKADP  163



>gb|ACO35757.1| flavonoid 3'-hydroxylase [Rudbeckia hirta]
Length=509

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 142/158 (90%), Gaps = 1/158 (1%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG  PH S+A +A +YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+ F++RPPN
Sbjct  42   GNLPHLGTIPHHSLARLAAKYGPLMHLRLGFVDVVVAASASVAAQFLKTNDAIFASRPPN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI SVHLFSAKALDDF H+RQEEVA LTR+L  A
Sbjct  102  SGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSAKALDDFRHIRQEEVAILTRALIGA  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGS-KSD  582
            G++ VKLGQLLNVCTTNALARVMLGR+VF+D G  K+D
Sbjct  162  GESTVKLGQLLNVCTTNALARVMLGRRVFSDTGDLKAD  199



>gb|AAO47850.1| defective flavonoid 3'-hydroxylase [Glycine max]
Length=298

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
                V LGQLLNVCTTNALAR M+GR+VFNDG    DP
Sbjct  162  DTKAVNLGQLLNVCTTNALARAMIGRRVFNDGNGGCDP  199



>ref|XP_006440736.1| hypothetical protein CICLE_v10019637mg [Citrus clementina]
 gb|ESR53976.1| hypothetical protein CICLE_v10019637mg [Citrus clementina]
Length=538

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG  PHQSIA +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPN
Sbjct  69   GNLPHLGPMPHQSIAGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPN  128

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNYQD+VF PYGPRWRMLRKI+SVHLFS KALDD+ HVRQEE+A LTR+LASA
Sbjct  129  SGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASA  188

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
            G  PV L Q LN+C  NAL RVMLG +VF DG   SDP
Sbjct  189  GTEPVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGSDP  226



>gb|ACN65827.1| flavonoid 3'-hydroxylase [Centaurea cyanus]
Length=514

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLGK PH ++AAMA++YGPLMHLR G VDVVVAASA+VAAQFLKVHD+NF++RPPN
Sbjct  43   GNLPHLGKMPHHALAAMADKYGPLMHLRFGVVDVVVAASASVAAQFLKVHDANFASRPPN  102

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+H+AY+YQDLVFAPYG +WRMLRKI SVHLFS KALDDF HVR+EEVA LTR+LA A
Sbjct  103  SGAKHLAYDYQDLVFAPYGLKWRMLRKICSVHLFSNKALDDFRHVREEEVAVLTRALAGA  162

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
            G + V LGQLLNVCTTNALARVMLGR+VF DG    D
Sbjct  163  GGSTVALGQLLNVCTTNALARVMLGRRVFGDGSGGGD  199



>gb|ACM62746.1| flavonoid 3'-hydroxylase [Garcinia mangostana]
Length=507

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            I  +++ AI +Y LI          LPPGP+P P++GNLPHLG  PHQSIA++ ++YGPL
Sbjct  5    ILYSILIAILVYVLIKLGSLSSGRRLPPGPRPLPLVGNLPHLGSMPHQSIASLVKKYGPL  64

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            M+LRLG+VDVVVAASA+VAAQ  K HD+NFS+RPPNSGA+++AYNY DLVFAPYGPRWRM
Sbjct  65   MYLRLGYVDVVVAASASVAAQIFKNHDANFSSRPPNSGAKYVAYNYHDLVFAPYGPRWRM  124

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI+SVHLFS KALDDF H+R+ E+A LT++LASAGK PV LGQLLNVCTTNAL RVM+
Sbjct  125  LRKISSVHLFSNKALDDFRHIREAELAVLTQTLASAGKAPVNLGQLLNVCTTNALGRVMV  184

Query  544  GRKVFNDG  567
            GR+VFNDG
Sbjct  185  GRRVFNDG  192



>gb|AHZ31753.1| flavonoid 3'-hydroxylase [Viola x wittrockiana]
Length=508

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG  PH++IAA+A  YGPLMHLRLG V+VVVAASA+VAAQFLK HDSNFS+RPPN
Sbjct  40   GNLPHLGPAPHRNIAALARTYGPLMHLRLGSVNVVVAASASVAAQFLKTHDSNFSSRPPN  99

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI+SVHLFS KALDD  +VRQEEVA LTR+LASA
Sbjct  100  SGAKHIAYNYQDLVFAPYGPRWRMLRKISSVHLFSGKALDDGRYVRQEEVALLTRTLASA  159

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
            G   V L QLLN+C  NAL RVMLGR+VF+DG +  DP
Sbjct  160  GDAAVNLAQLLNICAANALGRVMLGRRVFSDGSACGDP  197



>gb|ACN65826.1| flavonoid 3'-hydroxylase [Echinops bannaticus]
Length=508

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG+ PH S+A +A +YGPL+HLRLGFVDVVVA SA+VAAQFLKVHD+NF++RPPN
Sbjct  44   GNLPHLGRVPHHSLADLATKYGPLLHLRLGFVDVVVAGSASVAAQFLKVHDANFASRPPN  103

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+H+AYNYQD+VFAPYGP+WRMLRKI SVHLFS KALDDF HVRQEEVA L R+L  A
Sbjct  104  SGAKHMAYNYQDMVFAPYGPKWRMLRKICSVHLFSTKALDDFRHVRQEEVAILARALVGA  163

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVF  558
            G++ VKLGQLLNVCTTNALARVMLGR+VF
Sbjct  164  GESTVKLGQLLNVCTTNALARVMLGRRVF  192



>ref|XP_006477655.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=516

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG  PHQSIA +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPN
Sbjct  47   GNLPHLGPMPHQSIAGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPN  106

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNYQD+VF PYGPRWRMLRKI+SVHLFS KALDD+ HVRQEE+A L R+LASA
Sbjct  107  SGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLARALASA  166

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
            G  PV L Q LN+C  NAL RVMLG +VF DG   SDP
Sbjct  167  GTEPVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGSDP  204



>gb|ABB53383.1| flavonoid-3'-hydroxylase [Antirrhinum majus]
Length=520

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 160/194 (82%), Gaps = 3/194 (2%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            L+ CT +    L +  L    R   PLPPGPKPWP++GNLPHLG KPHQS+AA+A  +GP
Sbjct  20   LVPCTFILGFLLLYSFL---NRKVKPLPPGPKPWPIVGNLPHLGPKPHQSMAALARVHGP  76

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            L+HL++GFV VVVA+SA+VA +FLKVHD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRWR
Sbjct  77   LIHLKMGFVHVVVASSASVAEKFLKVHDANFSSRPPNSGAKHVAYNYQDLVFAPYGPRWR  136

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI ++HLFSAKAL+DF HVRQ+EV  LTR LA AG+TP+KLGQ++N C TNA+ARVM
Sbjct  137  MLRKICALHLFSAKALNDFTHVRQDEVGILTRVLADAGETPLKLGQMMNTCATNAIARVM  196

Query  541  LGRKVFNDGGSKSD  582
            LGR+V     SK++
Sbjct  197  LGRRVVGHADSKAE  210



>gb|AAO47844.1| gray pubescence flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47845.1| gray pubescence flavonoid 3'-hydroxylase [Glycine max]
Length=394

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
                V LGQLLNVCTTNALAR M+GR+VFNDG    DP
Sbjct  162  DTKAVNLGQLLNVCTTNALARAMIGRRVFNDGNGGCDP  199



>gb|AGL81348.1| flavanone 3' hydroxylase [Pyrus communis]
Length=511

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LI  T+VFA FLY +      R+ LPLPPGPKPWP+ GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIVFTVVFAFFLYRIFAPGWSRHSLPLPPGPKPWPIXGNLPHLGPVPHHSLAALARQYGP  63

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFVDVVVA SA+VA+QF K  D NFS+RPPNSGA+H+AYNYQ LVFAPYGPRWR
Sbjct  64   LMHLRLGFVDVVVAXSASVASQFXKTXDXNFSSRPPNSGAKHLAYNYQXLVFAPYGPRWR  123

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            M RKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV L QLLNVCT NAL RVM
Sbjct  124  MXRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSRPVNLAQLLNVCTVNALGRVM  183

Query  541  LGRKVFNDGGSKSDP  585
            +GR++F +G    DP
Sbjct  184  VGRRLFGNGKGGEDP  198



>dbj|BAE71221.1| putative flavonoid 3'-hydroxylase [Trifolium pratense]
Length=510

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 168/197 (85%), Gaps = 3/197 (2%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            ++F T+V AI +  L+  +K +  LPLPPGP PWP++GNLPH+G  PH ++AA+A ++GP
Sbjct  6    IVFVTIVAAILINRLLNLIK-KPTLPLPPGPSPWPIVGNLPHMGPVPHHALAALALKHGP  64

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHL+LGFVDV+VAASA+VA QFLKVHD+NFS+RPPNSGA++IAYNYQDLVFAPYGPRWR
Sbjct  65   LMHLQLGFVDVIVAASASVAEQFLKVHDANFSSRPPNSGAKYIAYNYQDLVFAPYGPRWR  124

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            +LRKI+ VH+FS+KALDDF H+RQ+EVA L R+L+++G     LGQ+LNVCTTNALARVM
Sbjct  125  LLRKISYVHMFSSKALDDFRHIRQDEVARLIRNLSNSGSKAANLGQMLNVCTTNALARVM  184

Query  541  LGRKVFND--GGSKSDP  585
            +GR+VFN+  GG + DP
Sbjct  185  IGRRVFNEGNGGCECDP  201



>ref|XP_011072866.1| PREDICTED: flavonoid 3'-monooxygenase [Sesamum indicum]
Length=511

 Score =   230 bits (587),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 159/185 (86%), Gaps = 3/185 (2%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LI  T +  +FLY  +   ++R  + LPPGP+PWP++GNL  LG KPHQS+AA+A  YGP
Sbjct  7    LIVYTSILCLFLYSFL---RRRRSVRLPPGPRPWPIVGNLLQLGPKPHQSMAALARVYGP  63

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHL++GFV+VVVAASA VA QFLKVHD+NFSNRPPN+GAE++AYNYQD+VFAPYGPRWR
Sbjct  64   LMHLKMGFVNVVVAASAGVAEQFLKVHDANFSNRPPNAGAEYVAYNYQDMVFAPYGPRWR  123

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            +LRKI +VH+FSAKALDDF HVRQEEV  LTR+LASAG+TP +LGQ+LNVC TNA+ARVM
Sbjct  124  LLRKICAVHVFSAKALDDFRHVRQEEVGILTRALASAGQTPARLGQMLNVCATNAIARVM  183

Query  541  LGRKV  555
            LGR+V
Sbjct  184  LGRRV  188



>ref|XP_007138248.1| hypothetical protein PHAVU_009G192400g [Phaseolus vulgaris]
 gb|ESW10242.1| hypothetical protein PHAVU_009G192400g [Phaseolus vulgaris]
Length=506

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  7    FCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLM  186
            F T+   I ++ LI  + +   LPLPPGPKPWPV+GN PH+G  PH S+AA+ + +GPLM
Sbjct  8    FATVAAVILVHRLIKFLTRNSSLPLPPGPKPWPVVGNFPHMGPVPHHSLAALVQVHGPLM  67

Query  187  HLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRML  366
            HLRLGFVD+VVAASA+VA QFLK+HDSNFS+RPPN+GA++IAYNYQDLVFAPYGPRWR+L
Sbjct  68   HLRLGFVDMVVAASASVAEQFLKIHDSNFSSRPPNAGAKYIAYNYQDLVFAPYGPRWRLL  127

Query  367  RKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLG  546
            RK+TSVHLFS KALD F H+R+EEV  LTR+L S+    V LGQ+LNVCTTNALARVM+G
Sbjct  128  RKLTSVHLFSGKALDVFRHLREEEVGRLTRNLGSSDAKAVNLGQVLNVCTTNALARVMIG  187

Query  547  RKVFNDGGSKSDP  585
            R+VFNDG    DP
Sbjct  188  RRVFNDGNGGCDP  200



>gb|KEH32010.1| flavonoid hydroxylase [Medicago truncatula]
Length=510

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 166/197 (84%), Gaps = 3/197 (2%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            ++F T+  AI +Y L L +  +  LPLPPGP PWP++GNLPH+G  PH ++A +A ++GP
Sbjct  6    IVFATIAAAILIYRL-LNLITKPSLPLPPGPSPWPIVGNLPHMGPVPHHALAVLALKHGP  64

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLG+VDV+VAASA+VA QFLKVHD+NFS+RP NSGA+++AYNYQDLVFAPYGPRWR
Sbjct  65   LMHLRLGYVDVIVAASASVAEQFLKVHDTNFSSRPTNSGAKYLAYNYQDLVFAPYGPRWR  124

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            +LRKI+ VH+FS+KALD+F H+RQEEVA L R+LAS+G   V LGQ+LNVCTTNALARVM
Sbjct  125  LLRKISYVHMFSSKALDEFRHIRQEEVARLIRNLASSGSKAVNLGQMLNVCTTNALARVM  184

Query  541  LGRKVFND--GGSKSDP  585
            +GR+VFN+  GG + DP
Sbjct  185  IGRRVFNEGNGGCECDP  201



>ref|XP_003598945.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
 gb|AES69196.1| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 139/160 (87%), Gaps = 2/160 (1%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GN+PHLG  PHQSIAA+A+ +GPLMHL+LGFVDV+VAAS +VA QFLKVHD+NFS+RPPN
Sbjct  43   GNMPHLGPAPHQSIAALAKIHGPLMHLKLGFVDVIVAASGSVAEQFLKVHDANFSSRPPN  102

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  468
            +GA++IAYNYQDLVFAPYGPRWRMLRKI+SVHLFS K +++F H+RQEEVA LT +LAS 
Sbjct  103  TGAKYIAYNYQDLVFAPYGPRWRMLRKISSVHLFSNKVMEEFKHLRQEEVARLTSNLASN  162

Query  469  -AGKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
             +    V LGQLLNVCTTNALARVMLGR+VFNDG    DP
Sbjct  163  YSNTKAVNLGQLLNVCTTNALARVMLGRRVFNDGNGGCDP  202



>gb|KEH33153.1| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 139/160 (87%), Gaps = 2/160 (1%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GN+PHLG  PHQSIAA+A+ +GPLMHL+LGFVDV+VAAS +VA QFLKVHD+NFS+RPPN
Sbjct  43   GNMPHLGPAPHQSIAALAKIHGPLMHLKLGFVDVIVAASGSVAEQFLKVHDANFSSRPPN  102

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  468
            +GA++IAYNYQDLVFAPYGPRWRMLRKI+SVHLFS K +++F H+RQEEVA LT +LAS 
Sbjct  103  TGAKYIAYNYQDLVFAPYGPRWRMLRKISSVHLFSNKVMEEFKHLRQEEVARLTSNLASN  162

Query  469  -AGKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
             +    V LGQLLNVCTTNALARVMLGR+VFNDG    DP
Sbjct  163  YSDTKAVNLGQLLNVCTTNALARVMLGRRVFNDGNGGCDP  202



>gb|AFI71898.1| flavonoid 3'-hydroxylase [Paeonia lactiflora]
Length=507

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG KPHQS+A++A  YGPLMHLRLG VDVVVAASA+VAAQFLK +D+NF NRPPN
Sbjct  40   GNLPHLGPKPHQSLASLARSYGPLMHLRLGSVDVVVAASASVAAQFLKTNDANFVNRPPN  99

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA++IAYNYQDLVFAPYGPRWR+LRK++S+HLFS KALDDF H+RQEEVA L  +L SA
Sbjct  100  SGAKYIAYNYQDLVFAPYGPRWRLLRKVSSLHLFSGKALDDFRHLRQEEVAVLVHALTSA  159

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
              + V LGQLLNVCTTNALARVMLG++VF DG    DP
Sbjct  160  SNSLVNLGQLLNVCTTNALARVMLGKRVFGDGSGGVDP  197



>ref|XP_006399285.1| hypothetical protein EUTSA_v10013289mg [Eutrema salsugineum]
 gb|ESQ40738.1| hypothetical protein EUTSA_v10013289mg [Eutrema salsugineum]
Length=510

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 153/190 (81%), Gaps = 0/190 (0%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            +F T++ A F++ L+L    R    LPPGP PWP++GNLPH+G KPHQ++AAM   YGP+
Sbjct  4    LFITILLATFIFLLVLLFSLRRNHRLPPGPNPWPIIGNLPHMGHKPHQTLAAMVTTYGPI  63

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            ++LRLGF DVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG RWRM
Sbjct  64   LYLRLGFADVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQRWRM  123

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI+SVHLFSAKAL+DF HVRQEEV TL R L+ AG  PV LGQL+N+C  NAL R M+
Sbjct  124  LRKISSVHLFSAKALEDFKHVRQEEVGTLMRELSRAGTKPVNLGQLVNMCVINALGREMI  183

Query  544  GRKVFNDGGS  573
            GR++F  G  
Sbjct  184  GRRLFGAGAD  193



>gb|ADZ28515.1| flavonoid-3'-hydroxylase [Camellia nitidissima]
Length=518

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 158/198 (80%), Gaps = 4/198 (2%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLI-LRVK--QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  174
            +  +L+   FLY L+ LR     R+P PLPPGPKPWPV+GNLPHLG  PH SIAAMA  Y
Sbjct  7    VLYSLLIGFFLYCLLNLRTLLFNRHPRPLPPGPKPWPVIGNLPHLGTMPHHSIAAMARTY  66

Query  175  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  354
            GPLMHLRLG VDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  67   GPLMHLRLGLVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPR  126

Query  355  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTR-SLASAGKTPVKLGQLLNVCTTNALA  531
            WRMLRKI SVHLFS KALDDF HVRQEE+A LTR   ++     V LGQLLNVCTTNAL 
Sbjct  127  WRMLRKICSVHLFSTKALDDFRHVRQEEIAILTRALASAGQAAAVNLGQLLNVCTTNALG  186

Query  532  RVMLGRKVFNDGGSKSDP  585
            RVMLG +VF DG    DP
Sbjct  187  RVMLGHRVFGDGSGSGDP  204



>dbj|BAD91808.1| flavonoid 3'-hydroxylase [Gentiana triflora]
Length=524

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GN+PHLG KPHQ++A MA+ YGPLMHL+ G  D VVA+SA+VA QFLK HD NFSNRPPN
Sbjct  52   GNIPHLGSKPHQTLAEMAKTYGPLMHLKFGLKDAVVASSASVAEQFLKKHDVNFSNRPPN  111

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNYQDLVFAPYGPRWR+LRKI SVHLFS+KALDDF HVR EE+  L R++AS 
Sbjct  112  SGAKHIAYNYQDLVFAPYGPRWRLLRKICSVHLFSSKALDDFQHVRHEEICILIRAIASG  171

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGS  573
            G  PV LG+LL VCTTNALARVMLGR+VF  DGG 
Sbjct  172  GHAPVNLGKLLGVCTTNALARVMLGRRVFEGDGGE  206



>gb|AIY51699.1| flavonoid 3'-hydroxylase [Penstemon barbatus]
Length=517

 Score =   228 bits (581),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 161/201 (80%), Gaps = 7/201 (3%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplpl---ppgpkpwpvlGNLPHLGKKPHQSIAAMAER  171
            L+ CT +    L + I +  QR        PPGP+PWP++GNLP LG KPHQ++AA+A  
Sbjct  7    LLICTSILGFLLLYWIFQRPQRKAKSTLPLPPGPRPWPIIGNLPQLGPKPHQTMAALARV  66

Query  172  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  351
            +GPLMHL++GFV VVVAASA++A QFLKV+D+NFS+RPPN+GA+++AYNYQDLVFAPYGP
Sbjct  67   HGPLMHLKMGFVHVVVAASASMAEQFLKVNDANFSSRPPNAGAKYVAYNYQDLVFAPYGP  126

Query  352  RWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALA  531
            RWR+LRKI ++HLFSAKALDDF HVRQEEV  LTR+LASAG+  +KLGQ+LN+C TNALA
Sbjct  127  RWRLLRKICALHLFSAKALDDFRHVRQEEVGILTRTLASAGEMQMKLGQMLNICATNALA  186

Query  532  RVMLGRKV----FNDGGSKSD  582
            RV LGR+V    F DG  K++
Sbjct  187  RVALGRRVVGHGFGDGEVKAE  207



>gb|KHN17812.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=513

 Score =   228 bits (581),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
                V LGQLLNVCTTNALAR M+GR+VFNDG    DP
Sbjct  162  DTKAVNLGQLLNVCTTNALARAMIGRRVFNDGNGGCDP  199



>gb|ACR33790.1| flavonoid 3'-hydroxylase [Glycine max]
Length=513

 Score =   228 bits (581),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
                V LGQLLNVCTTNALAR M+GR+VFNDG    DP
Sbjct  162  DTKAVNLGQLLNVCTTNALARAMIGRRVFNDGNGGCDP  199



>gb|AHY35313.1| flavonoid 3'-hydroxylase 1 [Morus notabilis]
Length=508

 Score =   228 bits (580),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 158/194 (81%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            I  +++FA+ +Y L+  +  R    LPPGP+ WPV+GNLPHLG+ PHQ++A +A ++GPL
Sbjct  7    ILLSILFAVLVYRLVNNLI-RSRRKLPPGPRQWPVIGNLPHLGQAPHQTMATLARKHGPL  65

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            MHLRLG VDVVVAASA++AAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVF PYG RWR+
Sbjct  66   MHLRLGQVDVVVAASASMAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFRPYGQRWRL  125

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKITSVHLFS KAL+DF HVRQEEVA L  +LA+ G T V LGQLLNVCT NAL R ML
Sbjct  126  LRKITSVHLFSGKALEDFRHVRQEEVAVLISALANRGSTAVNLGQLLNVCTVNALGRTML  185

Query  544  GRKVFNDGGSKSDP  585
            G +VF DG  KS+P
Sbjct  186  GYRVFGDGSGKSEP  199



>ref|NP_001237015.1| flavonoid 3'-hydroxylase [Glycine max]
 dbj|BAB83261.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47846.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47847.1| flavonoid 3'-hydroxylase [Glycine max]
 dbj|BAD97828.1| flavonoid 3'- hydroxylase [Glycine max]
 gb|ABW69385.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|ABW69386.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|ACN81827.1| flavonoid 3'-hydroxylase [Glycine max]
Length=513

 Score =   228 bits (580),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
                V LGQLLNVCTTNALAR M+GR+VFNDG    DP
Sbjct  162  DTKAVNLGQLLNVCTTNALARAMIGRRVFNDGNGGCDP  199



>gb|ABY89687.1| flavonoid 3` hydroxylase 1 protein [Brassica rapa subsp. oleifera]
Length=511

 Score =   228 bits (580),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 156/193 (81%), Gaps = 3/193 (2%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   YGP+
Sbjct  4    LYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTYGPI  63

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            +HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG RWRM
Sbjct  64   LHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQRWRM  123

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI+SVHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R M+
Sbjct  124  LRKISSVHLFSAKALEDFKHVRQEEVGTLVRELARANTKPVNLGQLVNMCVLNALGREMI  183

Query  544  GRKVFNDGGSKSD  582
            GR++F   G+ +D
Sbjct  184  GRRLF---GADAD  193



>ref|XP_010105826.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|AHB19303.1| flavonoid 3'-hydroxylase, partial [Morus alba]
 gb|EXC06425.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=508

 Score =   228 bits (580),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 158/194 (81%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            I  +++FA+ +Y L+  +  R    LPPGP+ WPV+GNLPHLG+ PHQ++A +A ++GPL
Sbjct  7    ILLSILFAVLVYRLVNNLI-RSRRKLPPGPRQWPVIGNLPHLGQAPHQTMATLARKHGPL  65

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            MHLRLG VDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVF PYG RWR+
Sbjct  66   MHLRLGQVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFRPYGQRWRL  125

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKITSVHLFS KAL+DF HVRQEEVA L  +LA+ G T V LGQLLNVCT NAL R ML
Sbjct  126  LRKITSVHLFSGKALEDFRHVRQEEVAVLISALANRGSTAVNLGQLLNVCTVNALGRTML  185

Query  544  GRKVFNDGGSKSDP  585
            G +VF DG  KS+P
Sbjct  186  GYRVFGDGSGKSEP  199



>ref|XP_010491421.1| PREDICTED: flavonoid 3'-monooxygenase-like [Camelina sativa]
Length=509

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 157/193 (81%), Gaps = 3/193 (2%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            +F T+V A  L+ L+    +R    LPPGP PWP++GNLPH+G KPHQ++AAM   YGP+
Sbjct  4    LFLTVVLATVLFCLLFLFSRRRNPRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTYGPI  63

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            +HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG RWRM
Sbjct  64   LHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQRWRM  123

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI+SVHLFSAKAL+DF HVRQEEVAT+TR LA  G   V LGQL+N+C  NAL+R M+
Sbjct  124  LRKISSVHLFSAKALEDFKHVRQEEVATMTRELAQVGTKAVNLGQLVNMCVVNALSREMI  183

Query  544  GRKVFNDGGSKSD  582
            GR++F   G+ +D
Sbjct  184  GRRLF---GADAD  193



>emb|CDX69984.1| BnaA10g23330D [Brassica napus]
Length=511

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 156/193 (81%), Gaps = 3/193 (2%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   YGP+
Sbjct  4    LYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTYGPI  63

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            +HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG RWRM
Sbjct  64   LHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQRWRM  123

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI+SVHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R M+
Sbjct  124  LRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGREMI  183

Query  544  GRKVFNDGGSKSD  582
            GR++F   G+ +D
Sbjct  184  GRRLF---GADAD  193



>gb|ABC58722.1| flavonoid 3'-hydroxylase [Brassica napus]
 gb|ABC58723.1| flavonoid 3'-hydroxylase [Brassica napus]
Length=511

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 156/193 (81%), Gaps = 3/193 (2%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   YGP+
Sbjct  4    LYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTYGPI  63

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            +HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG RWRM
Sbjct  64   LHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQRWRM  123

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI+SVHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R M+
Sbjct  124  LRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGREMI  183

Query  544  GRKVFNDGGSKSD  582
            GR++F   G+ +D
Sbjct  184  GRRLF---GADAD  193



>ref|XP_004508739.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=503

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 160/196 (82%), Gaps = 4/196 (2%)
 Frame = +1

Query  7    FCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLM  186
            F T+  AI +Y  I ++  R  +PLPPGP+PWP++GNLPH+G  PH ++AA+A ++GPLM
Sbjct  8    FATIAAAILIY-RIFKLITRPSIPLPPGPRPWPIVGNLPHMGPVPHHALAALAHKHGPLM  66

Query  187  HLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRML  366
            HLRLGFVDV+VAASA VA QFLKVHD+NFS+RPPNSGA+++AYNYQDLVFAPYGPRWR+L
Sbjct  67   HLRLGFVDVIVAASATVAEQFLKVHDANFSSRPPNSGAKYVAYNYQDLVFAPYGPRWRLL  126

Query  367  RKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLG  546
            RKI  VH+FS KALDD  H+RQEEV  L R+LAS+G   V L Q+LNVCTTNALARVM+G
Sbjct  127  RKIAYVHMFSTKALDDVRHLRQEEVGRLIRNLASSGSKAVNLSQMLNVCTTNALARVMIG  186

Query  547  RKVFND---GGSKSDP  585
            R+VFN+    G + DP
Sbjct  187  RRVFNESNGSGCECDP  202



>gb|AGI16386.1| flavonoid 3' hydroxylase [Ribes nigrum]
Length=524

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 138/161 (86%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG KPHQSIA +A  YGPLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RP N
Sbjct  51   GNLPHLGTKPHQSIAELARTYGPLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPQN  110

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA++IAYNYQDLVFAPYGPRWRMLRKI+ VHLFS KALDDF HVRQEEVA LTR++ + 
Sbjct  111  SGAKYIAYNYQDLVFAPYGPRWRMLRKISQVHLFSNKALDDFRHVRQEEVAVLTRAIVNE  170

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGG----SKSD  582
            G   V L +LLNVCTTNALARVMLG++VF +G     +KSD
Sbjct  171  GDASVDLPRLLNVCTTNALARVMLGKRVFGEGSGSGNAKSD  211



>ref|XP_009122411.1| PREDICTED: flavonoid 3'-monooxygenase [Brassica rapa]
Length=511

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 156/193 (81%), Gaps = 3/193 (2%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   YGP+
Sbjct  4    LYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTYGPI  63

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            +HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG RWRM
Sbjct  64   LHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQRWRM  123

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI+SVHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R M+
Sbjct  124  LRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGREMI  183

Query  544  GRKVFNDGGSKSD  582
            GR++F   G+ +D
Sbjct  184  GRRLF---GADAD  193



>gb|ABY89688.1| flavonoid 3` hydroxylase 2 protein [Brassica rapa subsp. oleifera]
Length=511

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 156/193 (81%), Gaps = 3/193 (2%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   YGP+
Sbjct  4    LYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTYGPI  63

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            +HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG RWRM
Sbjct  64   LHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQRWRM  123

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI+SVHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R M+
Sbjct  124  LRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGREMI  183

Query  544  GRKVFNDGGSKSD  582
            GR++F   G+ +D
Sbjct  184  GRRLF---GADAD  193



>ref|XP_010423152.1| PREDICTED: flavonoid 3'-monooxygenase-like [Camelina sativa]
Length=509

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 155/193 (80%), Gaps = 3/193 (2%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            +F T+V A  L+ L+    +R    LPPGP PWP++GNLPH+G KPH+++ AM   YGP+
Sbjct  4    LFLTVVLATVLFCLLFLFSRRRNPRLPPGPNPWPIIGNLPHMGPKPHRTLTAMVTTYGPI  63

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            +HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG RWRM
Sbjct  64   LHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQRWRM  123

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI+SVHLFSAKALDDF HVRQEEVATLTR LA  G   V LGQL+N+C  NAL R M+
Sbjct  124  LRKISSVHLFSAKALDDFKHVRQEEVATLTRELAQVGTKAVNLGQLVNMCVVNALGREMI  183

Query  544  GRKVFNDGGSKSD  582
            GR++F   G+ +D
Sbjct  184  GRRLF---GADAD  193



>gb|AIT52346.1| flavonoid 3'-monooxygenase 1 [Daucus carota]
Length=524

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 150/198 (76%), Gaps = 7/198 (4%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLIL-------RVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  159
            LI  TLV A+ +Y L+        R       P P GPKPWP++GNLPHLG  PH S+A 
Sbjct  8    LILYTLVLALLIYCLLNLRTLFFNRRSSHPLPPGPKGPKPWPIIGNLPHLGAIPHHSLAE  67

Query  160  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  339
            MA+ YGPL+HLRLG V VVVA+SA VAAQFLK HD+ FSNRPPNSGA+HIAYNYQDLVFA
Sbjct  68   MAQTYGPLLHLRLGLVHVVVASSAGVAAQFLKTHDAKFSNRPPNSGAKHIAYNYQDLVFA  127

Query  340  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  519
            PYGP+WR LRKI SVHLFSAKALDDF HVRQEEV  L   LA AGK  V LGQLLN+C T
Sbjct  128  PYGPKWRKLRKICSVHLFSAKALDDFRHVRQEEVGVLVSGLAGAGKRAVHLGQLLNICAT  187

Query  520  NALARVMLGRKVFNDGGS  573
            NAL RVMLG++VF+ G S
Sbjct  188  NALGRVMLGKRVFSYGTS  205



>ref|XP_002871298.1| hypothetical protein ARALYDRAFT_487632 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47557.1| hypothetical protein ARALYDRAFT_487632 [Arabidopsis lyrata subsp. 
lyrata]
Length=514

 Score =   225 bits (574),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 156/195 (80%), Gaps = 1/195 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            ++  T++F   L    LR  + + + LPPGP PWP++GNLPH+G KPH+++AAM   YGP
Sbjct  8    ILLATVIFLFLLRVFSLRRNRSHNIRLPPGPNPWPIIGNLPHMGPKPHRTLAAMVSTYGP  67

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            ++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG RWR
Sbjct  68   ILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQRWR  127

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            +LRKI+SVHLFSAKAL+DF HVRQEEV TLTR LA  G  PV LGQL+N+C  NAL R M
Sbjct  128  LLRKISSVHLFSAKALEDFKHVRQEEVGTLTRELARVGTKPVNLGQLVNMCVVNALGREM  187

Query  541  LGRKVFN-DGGSKSD  582
            +GR++F  D   K+D
Sbjct  188  IGRRLFGADADHKAD  202



>gb|AAG49301.1|AF313491_1 flavonoid 3'-hydroxylase [Matthiola incana]
Length=513

 Score =   225 bits (573),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPH+G KPHQ++AAM   YGP++HLRLGFV+VVVAAS +VA QFLK+HD+NF++RPPN
Sbjct  43   GNLPHMGPKPHQTLAAMVTTYGPILHLRLGFVNVVVAASKSVAEQFLKIHDANFASRPPN  102

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+DF HVRQEE+  LTR +A A
Sbjct  103  SGAKHIAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDFKHVRQEEIGRLTREVARA  162

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGS  573
               PV LGQL+N+C  NAL R M+GR++F DG  
Sbjct  163  DTKPVNLGQLVNMCVVNALGREMIGRRLFGDGAD  196



>gb|AAG49315.1|AF315465_1 flavonoid 3'-hydroxylase [Pelargonium x hortorum]
Length=511

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPH+G  PHQ++AAMA  YGPL++LRLGFVDVVVA SA++A+QFLK HDSNFS+RPPN
Sbjct  44   GNLPHMGSMPHQNLAAMARTYGPLVYLRLGFVDVVVALSASMASQFLKTHDSNFSSRPPN  103

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            +GA+HIAYNY DLVFAPYGPRWR+ RKITS+HLFS KALDD+ HVRQEEV  L  +LA A
Sbjct  104  AGAKHIAYNYHDLVFAPYGPRWRLFRKITSIHLFSGKALDDYRHVRQEEVGVLASNLARA  163

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
              T V LGQLLN+C TNAL R ++G+KVF DG    DP
Sbjct  164  VSTIVNLGQLLNICATNALGRAVIGKKVFKDGTDDVDP  201



>gb|EYU23554.1| hypothetical protein MIMGU_mgv1a004224mg [Erythranthe guttata]
Length=538

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 136/158 (86%), Gaps = 1/158 (1%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG KPHQS+A +A+ +GPLMHL++G V VVVAASA VA QFLKVHD+NFS+RPPN
Sbjct  65   GNLPQLGPKPHQSMATLAQVHGPLMHLKMGVVHVVVAASAGVAEQFLKVHDANFSSRPPN  124

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+++AYNYQDLVFAPYGPRWRMLRKI ++HLFS KALDDF HVRQEEV  LTRSLASA
Sbjct  125  SGAKYMAYNYQDLVFAPYGPRWRMLRKICTLHLFSTKALDDFRHVRQEEVGILTRSLASA  184

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDG-GSKSD  582
            GKT   +GQ+LNVCTTNA+ARV+LGR+V   G G  +D
Sbjct  185  GKTAASIGQMLNVCTTNAIARVVLGRRVIGYGCGGGAD  222



>gb|ADE80941.1| flavonoid 3'-hydroxylase [Epimedium sagittatum]
Length=514

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            L+  TL+ +  LY LI  +    P  LPPGPKPWP++GNL HLG+ PH S+AA+A++YGP
Sbjct  6    LVLATLIISTILYTLINSLLNPAPRGLPPGPKPWPIIGNLLHLGRVPHHSLAALAKKYGP  65

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLG V V+VAAS++VA Q  K HD NFS+RPPNSGA+HIAYNYQDLVFAPYGP+WR
Sbjct  66   LMHLRLGSVHVIVAASSSVATQIFKTHDVNFSSRPPNSGAKHIAYNYQDLVFAPYGPKWR  125

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI SVHLFSAKALDDF H+RQEEV  L  +L  AGK P  L +LLNVCTTN L RVM
Sbjct  126  MLRKICSVHLFSAKALDDFRHIRQEEVLVLINALFQAGKAPTDLAKLLNVCTTNVLGRVM  185

Query  541  LGRKVFNDG  567
            LGR+VF DG
Sbjct  186  LGRRVFGDG  194



>gb|AIY51698.1| flavonoid 3'-hydroxylase [Penstemon neomexicanus]
Length=517

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 154/201 (77%), Gaps = 7/201 (3%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwp---vlGNLPHLGKKPHQSIAAMAER  171
            L+ CT +    L + I +  QR      P P       ++GNLP LG KPHQ++AA+A  
Sbjct  7    LLICTSILGFLLLYWIFQRPQRKAKLTLPLPPGPRPWPIIGNLPQLGPKPHQTMAALARV  66

Query  172  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  351
            +GPLMHL++GFV VVVAASA++A QFLKV+D+NFS+RPPN+GA+++AYNYQDLVFAPYGP
Sbjct  67   HGPLMHLKMGFVHVVVAASASMAEQFLKVNDANFSSRPPNAGAKYVAYNYQDLVFAPYGP  126

Query  352  RWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALA  531
            RWR+LRKI ++HLFSAKALDDF HVRQEEV  LTR+LASAG+  + LGQ+LN+C TNALA
Sbjct  127  RWRLLRKICALHLFSAKALDDFRHVRQEEVGILTRTLASAGEMQMILGQMLNICATNALA  186

Query  532  RVMLGRKV----FNDGGSKSD  582
            RV LGR+V    F DG  K++
Sbjct  187  RVALGRRVVGHGFGDGEVKAE  207



>gb|EPS57881.1| flavonoid 3'-hydroxylase, partial [Genlisea aurea]
Length=425

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 150/192 (78%), Gaps = 0/192 (0%)
 Frame = +1

Query  7    FCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLM  186
               +  A+FL+     +++R     PPGP PWP+LGN+P LG KPHQS+AA+A  YGPL+
Sbjct  4    LAIVTTALFLFLAYAFIRRRATKRFPPGPTPWPLLGNIPQLGVKPHQSMAALAGVYGPLL  63

Query  187  HLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRML  366
            HL++GF  VVVAASA+VA QFLKVHD+NFS+RPPN+G +++AYNYQDLVFAPYGPRWR+L
Sbjct  64   HLKMGFQHVVVAASASVAEQFLKVHDANFSSRPPNAGGKYVAYNYQDLVFAPYGPRWRLL  123

Query  367  RKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLG  546
            RKI ++HLFSAKALDDF HVRQEEV  L R L SAGK PV LGQ+LNVC TNA+ARVMLG
Sbjct  124  RKICALHLFSAKALDDFVHVRQEEVGILGRVLVSAGKNPVALGQVLNVCATNAIARVMLG  183

Query  547  RKVFNDGGSKSD  582
            R+V        D
Sbjct  184  RRVVGHSTGGGD  195



>gb|AIB06740.1| flavanone 3'-hydroxylase [Mangifera indica]
Length=515

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 158/198 (80%), Gaps = 4/198 (2%)
 Frame = +1

Query  4    IFCTLVFAIFLYFL--ILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  177
            I  +L+F + +YFL  I     R  L LPPGPKP P++GNLPH+G  PH S+AA+A  YG
Sbjct  5    ILVSLLFGVLIYFLFNIRSFFNRKSLRLPPGPKPRPIIGNLPHMGPMPHHSLAALARTYG  64

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            P+MHLRLGFVDV+VAASA+VAAQFLKVHD+NFS+RPPNSGA++IAYNYQDLVF PYG +W
Sbjct  65   PIMHLRLGFVDVIVAASASVAAQFLKVHDANFSSRPPNSGAKYIAYNYQDLVFRPYGAKW  124

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAG--KTPVKLGQLLNVCTTNALA  531
            R+LRKITSVHLFS KALDD+  VRQ EVA LTR+LASAG     V L QLLNVCT NAL+
Sbjct  125  RLLRKITSVHLFSGKALDDYRLVRQGEVAVLTRALASAGLKSELVNLAQLLNVCTVNALS  184

Query  532  RVMLGRKVFNDGGSKSDP  585
            RVMLGR+VF DG    DP
Sbjct  185  RVMLGRRVFGDGTGGKDP  202



>gb|ACJ85671.1| unknown [Medicago truncatula]
Length=418

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 158/197 (80%), Gaps = 2/197 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            + F + + +I +Y L+    +   LPLPPGPKPWP++GNLPHLG  PHQS+A +AE YGP
Sbjct  6    IAFSSCILSILIYRLVKFATRTSSLPLPPGPKPWPIIGNLPHLGPAPHQSLATLAETYGP  65

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHL+LG VDV+VAASA+VA QFLKVHD+NFS+RPPN+GA++I YNYQDLVF PYGPRWR
Sbjct  66   LMHLKLGSVDVIVAASASVAEQFLKVHDANFSSRPPNAGAKYIGYNYQDLVFGPYGPRWR  125

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS--AGKTPVKLGQLLNVCTTNALAR  534
            +LRKIT+VHLFS ++LD+F H+RQEEV  L  +LAS  +    V LGQLLNVCTTNALAR
Sbjct  126  LLRKITTVHLFSNQSLDEFKHLRQEEVTRLVNNLASNHSNSKVVNLGQLLNVCTTNALAR  185

Query  535  VMLGRKVFNDGGSKSDP  585
             ++GR+VFN+G    DP
Sbjct  186  AVIGRRVFNEGNGDFDP  202



>ref|XP_010452770.1| PREDICTED: flavonoid 3'-monooxygenase [Camelina sativa]
Length=509

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 155/193 (80%), Gaps = 3/193 (2%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            +F T+V A  L+ L+    +R    LPPGP PWP++GNLPH+G KPH+++ AM   YGP+
Sbjct  4    LFLTVVLATVLFCLLFLFSRRRNPRLPPGPNPWPIIGNLPHMGPKPHRALTAMVTTYGPI  63

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            +HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG RWRM
Sbjct  64   LHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQRWRM  123

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI+SVHLFSAKAL+DF HVRQEEVATLTR LA  G   V LGQL+N+C  NAL R M+
Sbjct  124  LRKISSVHLFSAKALEDFKHVRQEEVATLTRELAQVGTKAVNLGQLVNMCVVNALGREMI  183

Query  544  GRKVFNDGGSKSD  582
            GR++F   G+ +D
Sbjct  184  GRRLF---GADAD  193



>emb|CDX99037.1| BnaC09g47980D [Brassica napus]
Length=717

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 156/193 (81%), Gaps = 3/193 (2%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   YGP+
Sbjct  4    LYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTYGPI  63

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            +HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG RWRM
Sbjct  64   LHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQRWRM  123

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRKI+SVHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R M+
Sbjct  124  LRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGREMI  183

Query  544  GRKVFNDGGSKSD  582
            GR++F   G+ +D
Sbjct  184  GRRLF---GADAD  193


 Score = 57.4 bits (137),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = +1

Query  430  QEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
            QEEV TL R LA A   PV LGQL+N+C  NAL R M+GR++F   G+ +D
Sbjct  352  QEEVGTLMRELARANTKPVNLGQLVNMCVLNALGREMIGRRLF---GADAD  399


 Score = 28.9 bits (63),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  585  KAEEFKSMVEEMMVLA  632
            KAEEF+SMV EMM LA
Sbjct  401  KAEEFRSMVTEMMALA  416



>ref|XP_004515962.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=507

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GN+PHLG  PH S+AA+A+ YGPLMHL+LGFVDV+VAASA+VA QFLKVHD+NFS+RPPN
Sbjct  42   GNIPHLGPVPHHSLAALAKTYGPLMHLKLGFVDVIVAASASVAEQFLKVHDANFSSRPPN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            +GA+++AYNYQDLVFA YGPRWR+LRK++S+HLFS K+LD+F H+RQEEV+ LTR LA +
Sbjct  102  AGAKYMAYNYQDLVFASYGPRWRLLRKLSSIHLFSNKSLDEFKHMRQEEVSRLTRYLADS  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
                V LG LLNVCTTNAL+RVM+G++VFNDG    DP
Sbjct  162  DPKSVNLGPLLNVCTTNALSRVMIGKRVFNDGNGGCDP  199



>gb|AEE60888.1| flavonoid 3'-hydroxylase [Fragaria chiloensis]
Length=512

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 156/193 (81%), Gaps = 1/193 (1%)
 Frame = +1

Query  10   CTLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLM  186
             TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A ++GPLM
Sbjct  7    ITLLVALVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGVFPHHSLADLARKHGPLM  66

Query  187  HLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRML  366
            HLRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PYGPRWR  
Sbjct  67   HLRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYGPRWRQF  126

Query  367  RKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLG  546
            RKI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+G
Sbjct  127  RKISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKAVNLAQLLNLCTANALGRVMVG  186

Query  547  RKVFNDGGSKSDP  585
            R+VF DG    DP
Sbjct  187  RRVFGDGSGSDDP  199



>dbj|BAL63027.1| flavonoid 3'-hydroxylase [Fragaria x ananassa]
Length=510

 Score =   222 bits (566),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 156/196 (80%), Gaps = 1/196 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  177
            +   TL+ A+ L+ FL     QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A ++G
Sbjct  4    IAVITLLVALVLFRFLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGVFPHHSLADLARKHG  63

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            PLMHLRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PYGPRW
Sbjct  64   PLMHLRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYGPRW  123

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  537
            R  RKI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RV
Sbjct  124  RQFRKISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKAVNLAQLLNLCTVNALGRV  183

Query  538  MLGRKVFNDGGSKSDP  585
            M+GR+VF DG    DP
Sbjct  184  MVGRRVFGDGSGSDDP  199



>gb|AEE60886.1| flavonoid 3'-hydroxylase, partial [Fragaria x ananassa]
Length=511

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 156/193 (81%), Gaps = 1/193 (1%)
 Frame = +1

Query  10   CTLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLM  186
             TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLM
Sbjct  7    ITLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLM  66

Query  187  HLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRML  366
            HLRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  
Sbjct  67   HLRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQF  126

Query  367  RKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLG  546
            RKI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+G
Sbjct  127  RKISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRVMVG  186

Query  547  RKVFNDGGSKSDP  585
            R+VF DG    DP
Sbjct  187  RRVFGDGSGSDDP  199



>ref|NP_001274347.1| uncharacterized protein LOC101314754 [Fragaria vesca]
 gb|AEE60884.1| flavonoid 3'-hydroxylase [Fragaria vesca]
 gb|AGT28740.1| flavonoid 3'-hydroxylase [Fragaria vesca]
Length=512

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 156/193 (81%), Gaps = 1/193 (1%)
 Frame = +1

Query  10   CTLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLM  186
             TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLM
Sbjct  7    ITLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLM  66

Query  187  HLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRML  366
            HLRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  
Sbjct  67   HLRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQF  126

Query  367  RKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLG  546
            RKI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+G
Sbjct  127  RKISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRVMVG  186

Query  547  RKVFNDGGSKSDP  585
            R+VF DG    DP
Sbjct  187  RRVFGDGSGSDDP  199



>gb|AGO03825.1| flavonoid 3`5`-hydroxylase [Cichorium intybus]
Length=514

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG+ PH+S+AA+A +YGPL+HLRLGF+DVVVAASA+VAAQFLK HD+NF++RPPN
Sbjct  42   GNLPHLGQSPHRSLAALATKYGPLIHLRLGFIDVVVAASASVAAQFLKAHDANFASRPPN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNY D+VF PYGPRWRMLRK+  VHLFS KAL+DF H+RQEEVA LTR+L  A
Sbjct  102  SGAKHIAYNYNDMVFEPYGPRWRMLRKLCLVHLFSNKALNDFRHIRQEEVAILTRALGGA  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
            G++ V+L +LLN+C +NAL+RVMLG++VF DG    DP
Sbjct  162  GQSIVQLDKLLNLCISNALSRVMLGKRVFGDGSGGEDP  199



>gb|AEE60887.1| flavonoid 3'-hydroxylase [Fragaria virginiana]
Length=512

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 156/193 (81%), Gaps = 1/193 (1%)
 Frame = +1

Query  10   CTLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLM  186
             TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLM
Sbjct  7    ITLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLM  66

Query  187  HLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRML  366
            HLRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  
Sbjct  67   HLRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQF  126

Query  367  RKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLG  546
            RKI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+G
Sbjct  127  RKISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRVMVG  186

Query  547  RKVFNDGGSKSDP  585
            R+VF DG    DP
Sbjct  187  RRVFGDGSGSDDP  199



>gb|AEE60883.1| flavonoid 3'-hydroxylase [Fragaria vesca]
Length=512

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 156/193 (81%), Gaps = 1/193 (1%)
 Frame = +1

Query  10   CTLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLM  186
             TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLM
Sbjct  7    ITLLVAVVLFRLLFSGKPQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLM  66

Query  187  HLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRML  366
            HLRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  
Sbjct  67   HLRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQF  126

Query  367  RKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLG  546
            RKI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+G
Sbjct  127  RKISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRVMVG  186

Query  547  RKVFNDGGSKSDP  585
            R+VF DG    DP
Sbjct  187  RRVFGDGSGSDDP  199



>gb|AGT28741.1| flavonoid 3'-hydroxylase [Fragaria x ananassa]
Length=513

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 155/193 (80%), Gaps = 1/193 (1%)
 Frame = +1

Query  10   CTLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLM  186
             TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A ++GPLM
Sbjct  7    ITLLVALVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGVFPHHSLADLARKHGPLM  66

Query  187  HLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRML  366
            HLR G+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PYGPRWR  
Sbjct  67   HLRFGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYGPRWRQF  126

Query  367  RKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLG  546
            RKI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+G
Sbjct  127  RKISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKAVNLAQLLNLCTVNALGRVMVG  186

Query  547  RKVFNDGGSKSDP  585
            R+VF DG    DP
Sbjct  187  RRVFGDGSGSDDP  199



>gb|AGO03824.1| flavonoid 3`5`-hydroxylase [Echinops bannaticus]
Length=510

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPH+G  PHQS+AA+A +YGPLMHLRLGFVDVVVA SA+VAAQ  K HD NFSNRP  
Sbjct  44   GNLPHIGTAPHQSLAALATKYGPLMHLRLGFVDVVVAGSASVAAQIFKAHDVNFSNRPRV  103

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SG +HIAYNYQDLVFAPYGP+WRMLRKI SVHLFS KALDDF HVRQEE A L  +LA A
Sbjct  104  SGGKHIAYNYQDLVFAPYGPKWRMLRKICSVHLFSTKALDDFRHVRQEEAAILAGTLAGA  163

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
            G++ VKLG+L+NVC TNALARV+LGR+VF D     D
Sbjct  164  GESTVKLGELVNVCITNALARVVLGRRVFVDVSGDGD  200



>ref|NP_196416.1| Flavonoid 3'-monooxygenase [Arabidopsis thaliana]
 sp|Q9SD85.1|F3PH_ARATH RecName: Full=Flavonoid 3'-monooxygenase; AltName: Full=Cytochrome 
P450 75B1; AltName: Full=Flavonoid 3'-hydroxylase; Short=AtF3'H; 
AltName: Full=Protein TRANSPARENT TESTA 7 [Arabidopsis 
thaliana]
 gb|AAF73253.1|AF155171_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 gb|AAG16745.1|AF271650_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 gb|AAG16746.1|AF271651_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 emb|CAB62611.1| flavonoid 3'-hydroxylase-like protein [Arabidopsis thaliana]
 gb|AAF60189.1| flavonoid 3'hydroxylase [Arabidopsis thaliana]
 gb|AED91232.1| Flavonoid 3'-monooxygenase [Arabidopsis thaliana]
Length=513

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 158/199 (79%), Gaps = 7/199 (4%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRV-----KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  168
            +F T++ A  L FLILR+      + +   LPPGP PWP++GNLPH+G KPH++++AM  
Sbjct  4    LFLTILLATVL-FLILRIFSHRRNRSHNNRLPPGPNPWPIIGNLPHMGTKPHRTLSAMVT  62

Query  169  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  348
             YGP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG
Sbjct  63   TYGPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYG  122

Query  349  PRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL  528
             RWR+LRKI+SVHLFSAKAL+DF HVRQEEV TLTR L   G  PV LGQL+N+C  NAL
Sbjct  123  HRWRLLRKISSVHLFSAKALEDFKHVRQEEVGTLTRELVRVGTKPVNLGQLVNMCVVNAL  182

Query  529  ARVMLGRKVFN-DGGSKSD  582
             R M+GR++F  D   K+D
Sbjct  183  GREMIGRRLFGADADHKAD  201



>gb|AES69199.2| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 158/197 (80%), Gaps = 2/197 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            + F + + +I +Y L+    +   LPLPPGPKPWP++GNLPHLG  PHQS+A +AE YGP
Sbjct  6    IAFSSCILSILIYRLVKFATRTSSLPLPPGPKPWPIIGNLPHLGPAPHQSLATLAETYGP  65

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHL+LG VDV+VAASA+VA QFLKVHD+NFS+RPPN+GA++I YNYQDLVF PYGPRWR
Sbjct  66   LMHLKLGSVDVIVAASASVAEQFLKVHDANFSSRPPNAGAKYIGYNYQDLVFGPYGPRWR  125

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS--AGKTPVKLGQLLNVCTTNALAR  534
            +LRKIT+VHLFS ++LD+F H+RQEEV  L  +LAS  +    V LGQLLNVCTTNALAR
Sbjct  126  LLRKITTVHLFSNQSLDEFKHLRQEEVTRLVNNLASNHSNSKVVNLGQLLNVCTTNALAR  185

Query  535  VMLGRKVFNDGGSKSDP  585
             ++GR+VFN+G    DP
Sbjct  186  AVIGRRVFNEGNGDFDP  202



>gb|AEE60885.1| flavonoid 3'-hydroxylase, partial [Fragaria x ananassa]
Length=511

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 156/193 (81%), Gaps = 1/193 (1%)
 Frame = +1

Query  10   CTLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLM  186
             TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLM
Sbjct  7    ITLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLM  66

Query  187  HLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRML  366
            HLRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  
Sbjct  67   HLRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQF  126

Query  367  RKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLG  546
            RKI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+G
Sbjct  127  RKISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRVMVG  186

Query  547  RKVFNDGGSKSDP  585
            ++VF DG    DP
Sbjct  187  QRVFGDGSGSDDP  199



>dbj|BAB59005.1| flavonoid 3'-hydroxylase [Perilla frutescens var. crispa]
Length=523

 Score =   220 bits (561),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 152/189 (80%), Gaps = 1/189 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQ-RYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  177
            LI CT +  + +YFL LR        PLPPGP+PWP++GNLP LG KPHQS+AA+A  +G
Sbjct  8    LIICTSILGVLVYFLFLRRGGGSNGRPLPPGPRPWPIVGNLPQLGPKPHQSMAALARVHG  67

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            PLMHL++GFV VVVAASA VA +FLKVHD+NF +RPPNSGAEHIAYNY DLVFAP+GPRW
Sbjct  68   PLMHLKMGFVHVVVAASATVAEKFLKVHDTNFLSRPPNSGAEHIAYNYNDLVFAPHGPRW  127

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  537
            R+LRKI ++HLFS+KALDDF HVR+EEV  L R+LAS G+ P  +GQ++ VC TNA++RV
Sbjct  128  RLLRKICALHLFSSKALDDFRHVREEEVGILIRNLASVGEMPASIGQMMYVCATNAISRV  187

Query  538  MLGRKVFND  564
            MLGR V  D
Sbjct  188  MLGRHVLGD  196



>gb|AGY55961.1| flavonoid 3'-hydroxylase, partial [Punica granatum]
Length=332

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 1/114 (1%)
 Frame = +1

Query  244  QFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCH  423
            QFLK+HD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPRWRMLRKI+SVHLFSAKALDDF H
Sbjct  14   QFLKIHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPRWRMLRKISSVHLFSAKALDDFRH  73

Query  424  VRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGS-KSD  582
            VRQEEVA LTR+LASAGKTPVKLGQLLNVCTTNALARVMLGR+VF DGG  K+D
Sbjct  74   VRQEEVAILTRALASAGKTPVKLGQLLNVCTTNALARVMLGRRVFGDGGDPKAD  127



>gb|ABB43031.1| flavonoid 3'5'-hydroxylase [Osteospermum hybrid cultivar]
Length=508

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = +1

Query  22   FAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLG  201
              + +++++L ++ R+P  LPPGP PWP++GNLPHLG  PH ++AA A++YGPL+HLR G
Sbjct  13   ITVLVFYVLLNLRTRHPNRLPPGPTPWPIVGNLPHLGPLPHHTLAAFAKKYGPLIHLRFG  72

Query  202  FvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS  381
            FVDVVVA+S  VA+QFL+ +D NF++RPPNSGA+H+AYNYQDLVFAPYGPRW MLRKI  
Sbjct  73   FVDVVVASSPTVASQFLRDNDLNFASRPPNSGAKHMAYNYQDLVFAPYGPRWTMLRKICK  132

Query  382  VHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFN  561
             HLFS+KALD+F HVR+EEVA LTR LASAG++ VKL QLLNVCT N LAR+ML  ++F 
Sbjct  133  DHLFSSKALDNFRHVREEEVAILTRILASAGESTVKLSQLLNVCTANTLARMMLDMRLFG  192

Query  562  DGGSKSDP  585
            DG    DP
Sbjct  193  DGNGSGDP  200



>ref|XP_003598948.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
Length=597

 Score =   219 bits (559),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 158/197 (80%), Gaps = 2/197 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            + F + + +I +Y L+    +   LPLPPGPKPWP++GNLPHLG  PHQS+A +AE YGP
Sbjct  6    IAFSSCILSILIYRLVKFATRTSSLPLPPGPKPWPIIGNLPHLGPAPHQSLATLAETYGP  65

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHL+LG VDV+VAASA+VA QFLKVHD+NFS+RPPN+GA++I YNYQDLVF PYGPRWR
Sbjct  66   LMHLKLGSVDVIVAASASVAEQFLKVHDANFSSRPPNAGAKYIGYNYQDLVFGPYGPRWR  125

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS--AGKTPVKLGQLLNVCTTNALAR  534
            +LRKIT+VHLFS ++LD+F H+RQEEV  L  +LAS  +    V LGQLLNVCTTNALAR
Sbjct  126  LLRKITTVHLFSNQSLDEFKHLRQEEVTRLVNNLASNHSNSKVVNLGQLLNVCTTNALAR  185

Query  535  VMLGRKVFNDGGSKSDP  585
             ++GR+VFN+G    DP
Sbjct  186  AVIGRRVFNEGNGDFDP  202



>ref|XP_010030575.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW83703.1| hypothetical protein EUGRSUZ_B00578 [Eucalyptus grandis]
Length=514

 Score =   217 bits (553),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 151/195 (77%), Gaps = 1/195 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LI  T+  ++ LY L L    R   PLPPGPKPWP++GNLPHLG  PHQS+AA+A  YGP
Sbjct  6    LILATIAISVILYSL-LSYLARPARPLPPGPKPWPLVGNLPHLGPMPHQSMAALARAYGP  64

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            L+HLRLG VDVVVA+SA+VA+QFLK H++NF +RPP+S A+H++YNYQDLV  PYGPRWR
Sbjct  65   LLHLRLGLVDVVVASSASVASQFLKTHEANFLSRPPHSAAKHLSYNYQDLVSLPYGPRWR  124

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            MLRKI+S+HLFS KALDD+ HVR EEV  LT +LA    TP KL QLLNVCT N L RVM
Sbjct  125  MLRKISSIHLFSGKALDDYRHVRHEEVVVLTHALAHVSSTPKKLAQLLNVCTANVLGRVM  184

Query  541  LGRKVFNDGGSKSDP  585
            LG++VF DG    DP
Sbjct  185  LGKRVFGDGNGGGDP  199



>gb|AJD25177.1| cytochrome P450 CYP75B79 [Salvia miltiorrhiza]
Length=511

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 152/181 (84%), Gaps = 2/181 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            L+ C+ V    L + IL   +R P  LPPGP+PWP++GNLP LG KPHQS+AA+A+ YGP
Sbjct  8    LLVCSAVLGFLLLYSIL--VRRRPEKLPPGPRPWPIVGNLPQLGPKPHQSMAALAQVYGP  65

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHL++GFV VVVAASAAVA QFLK HD+NFS+RPPN+GA+++AYNYQDLVFAPYGPRWR
Sbjct  66   LMHLKMGFVHVVVAASAAVAQQFLKAHDANFSSRPPNAGAKYVAYNYQDLVFAPYGPRWR  125

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            +LRKI ++HLFSAKALDDF HVRQEE   L  +LASAG+ PV+LGQ+LNVC TNA++RVM
Sbjct  126  LLRKICALHLFSAKALDDFRHVRQEEAGILCGALASAGQMPVRLGQMLNVCATNAISRVM  185

Query  541  L  543
            L
Sbjct  186  L  186



>gb|AJD25178.1| cytochrome P450 CYP75B80 [Salvia miltiorrhiza]
Length=514

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 142/186 (76%), Gaps = 5/186 (3%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LI CT +  +  Y    + ++  P P P         GNLP LG KPHQS+AA+A  +GP
Sbjct  7    LIICTSILGLLFYLFFQKRRRLPPGPRPWPIV-----GNLPQLGAKPHQSMAALARVHGP  61

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            L+HL++GFV VVVAASA VA QFL+VHD+NF +RPPN+GAEH+AYNYQDLVFAPYGPRWR
Sbjct  62   LLHLKMGFVHVVVAASAGVAEQFLRVHDTNFLSRPPNAGAEHVAYNYQDLVFAPYGPRWR  121

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  540
            +LRKI ++HLFSAKALDDF HVR+EEV  + R+LA AG  PV++ + ++VC TNA+ARVM
Sbjct  122  LLRKICALHLFSAKALDDFRHVREEEVGIIVRTLADAGHKPVRISETVHVCATNAIARVM  181

Query  541  LGRKVF  558
            LGR+V 
Sbjct  182  LGRRVL  187



>ref|XP_006287545.1| hypothetical protein CARUB_v10000754mg [Capsella rubella]
 gb|EOA20443.1| hypothetical protein CARUB_v10000754mg [Capsella rubella]
Length=509

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPH+G KPHQ++AAM   YGP++HLRLGFVDVVVAAS +VA QFLK HD+NF++RPPN
Sbjct  40   GNLPHMGTKPHQTLAAMVTTYGPILHLRLGFVDVVVAASKSVAEQFLKTHDANFASRPPN  99

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+H+AYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+DF H+RQEEV TL+  LA  
Sbjct  100  SGAKHMAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDFKHIRQEEVGTLSGELARV  159

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVF  558
            G   V LGQL+N+C  N+L R M+GR++F
Sbjct  160  GTKAVNLGQLVNMCVINSLGREMIGRRLF  188



>emb|CDP16533.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +1

Query  160  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  339
            MA+ YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFA
Sbjct  1    MAKTYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHMAYNYQDLVFA  60

Query  340  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRS-LASAGKTPVKLGQLLNVCT  516
            PYGPRWR+LRKI SVHLFSAKALDDF  VR+EEVA LTR+ LAS GK  V LGQLLNVCT
Sbjct  61   PYGPRWRLLRKICSVHLFSAKALDDFHLVREEEVAILTRTLLASVGKDSVNLGQLLNVCT  120

Query  517  TNALARVMLGRKVFNDGGSKSD  582
            TNAL RVMLGR+VF+DG  K+D
Sbjct  121  TNALGRVMLGRRVFSDGDPKAD  142



>gb|ABB43030.1| flavonoid 3'5'-hydroxylase [Pericallis cruenta]
Length=504

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 151/193 (78%), Gaps = 1/193 (1%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            + CT +  +  Y L+  +  R    LPPGP PWP++GNL HLGK PH S+A +A++YGPL
Sbjct  6    LICTFITGLMFYGLV-NLLSRRASRLPPGPTPWPIIGNLMHLGKLPHHSLADLAKKYGPL  64

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            +H+RLG VDVVVA+SA+VA QFLKVHD+NF+NRPPNSGA+H+AYNY D+VFAPYGPRWRM
Sbjct  65   IHVRLGSVDVVVASSASVAGQFLKVHDANFANRPPNSGAKHMAYNYHDMVFAPYGPRWRM  124

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRK+ S+HLFSAKAL DF  VRQEEV  LTR LA  G++ VKL Q LNVC  N L+R+ML
Sbjct  125  LRKMCSMHLFSAKALTDFRQVRQEEVTILTRVLARTGQSAVKLDQQLNVCFANTLSRMML  184

Query  544  GRKVFNDGGSKSD  582
             R+VF DG  K+D
Sbjct  185  DRRVFGDGDPKAD  197



>gb|AAG49299.1|AF313489_1 flavonoid 3',5'-hydroxylase [Callistephus chinensis]
Length=510

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG  PH ++AA+A +YGPL++LRLGFV VVVA+S +VAAQFLKVHD  F++RPPN
Sbjct  43   GNLPHLGAIPHHTLAALATKYGPLVYLRLGFVHVVVASSPSVAAQFLKVHDLKFASRPPN  102

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNYQD+VFAPYGP+W M RKI   HLFS+KALDDF HVRQEEVA L R LA A
Sbjct  103  SGAKHIAYNYQDMVFAPYGPQWTMFRKICKDHLFSSKALDDFRHVRQEEVAILARGLAGA  162

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
            G++ V LGQ LN+CT N LAR+ML ++VF +     DP
Sbjct  163  GRSKVNLGQQLNMCTANTLARMMLDKRVFGNESGGDDP  200



>gb|AGT50310.1| flavonoid 3'-hydroxylase, partial [Meconopsis simplicifolia]
Length=468

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 130/161 (81%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  3    GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  62

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNYQDLVFAPYG RWRM RKI +VHL S KALD+F HVR+EEVA LT++LA +
Sbjct  63   SGAKHIAYNYQDLVFAPYGRRWRMFRKICAVHLLSGKALDEFRHVREEEVAVLTKALAQS  122

Query  472  GK----TPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
             K    +PV L  LLNVCTTNALARV+LG +V  DG   +D
Sbjct  123  NKNSKGSPVNLADLLNVCTTNALARVLLGTRVCGDGEGLAD  163



>gb|AGT50309.1| flavonoid 3'-hydroxylase, partial [Meconopsis delavayi]
Length=476

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 131/161 (81%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  3    GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  62

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNYQDLVFAPYG RWRM RKI +VHLFS KALD+F +VR+EEVA LT++LA +
Sbjct  63   SGAKHIAYNYQDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQS  122

Query  472  GK----TPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
             K    +PV L  LLNVCTTNALARV+LG +V  DG   +D
Sbjct  123  NKNSKGSPVNLADLLNVCTTNALARVLLGTRVCGDGEGLAD  163



>gb|AAX19888.1| flavonoid-3',5'-hydroxylase [Pericallis cruenta]
Length=504

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 150/193 (78%), Gaps = 1/193 (1%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            + CT +  +  Y L+  +  R    LPPGP PWP++GNL HLGK PH S+A +A++YGPL
Sbjct  6    LICTFITGLMFYGLV-NLLSRRASRLPPGPTPWPIIGNLMHLGKLPHHSLADLAKKYGPL  64

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            +H+RLG VDVVVA+SA+VA QFLKVHD+NF+NRPPNSGA+H+AYNY D+VFAPYGPRWRM
Sbjct  65   IHVRLGSVDVVVASSASVAGQFLKVHDANFANRPPNSGAKHMAYNYHDMVFAPYGPRWRM  124

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRK+ S+HLFSAKAL DF  VRQEEV  LTR LA   ++ VKL Q LNVC  N L+R+ML
Sbjct  125  LRKMCSMHLFSAKALADFRQVRQEEVMILTRVLAGTEQSAVKLDQQLNVCFANTLSRMML  184

Query  544  GRKVFNDGGSKSD  582
             R+VF DG  K+D
Sbjct  185  DRRVFGDGDPKAD  197



>gb|AGT50311.1| flavonoid 3'-hydroxylase, partial [Meconopsis horridula]
Length=484

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 131/161 (81%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  11   GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  70

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNYQDLVFAPYG RWRM RKI +VHLFS KALD+F +VR+EEVA LT++LA +
Sbjct  71   SGAKHIAYNYQDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQS  130

Query  472  GK----TPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
             K    +PV L  LLNVCTTNALARV+LG +V  DG   +D
Sbjct  131  NKNSKGSPVNLADLLNVCTTNALARVLLGTRVCGDGEGLAD  171



>ref|XP_010105825.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|AHB19304.1| flavonoid 3'-hydroxylase, partial [Morus alba]
 gb|EXC06424.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=517

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG  PHQ+IAA+A ++GPLMHLR G VDVV AASA+VAAQFLK HD+NF +RPP+
Sbjct  46   GNLPQLGPAPHQTIAALARKHGPLMHLRFGLVDVVAAASASVAAQFLKAHDTNFLSRPPS  105

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            S A+H+ YNY DLV APYGPRWR++RKI SVHL S KAL+DF +VRQEE A L R LA+A
Sbjct  106  SAAKHVGYNYHDLVLAPYGPRWRLMRKIASVHLLSGKALEDFRYVRQEEAAVLIRGLANA  165

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
            G T + L QLL++CTTN L R MLG +VF DG  KSDP
Sbjct  166  GPTAINLAQLLHLCTTNTLGRAMLGYRVFGDGSGKSDP  203



>ref|XP_010522799.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X6 [Tarenaya 
hassleriana]
Length=391

 Score =   204 bits (520),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 124/153 (81%), Gaps = 3/153 (2%)
 Frame = +1

Query  127  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  306
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  307  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  486
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  487  KLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
             L QL+NVC  NAL RVM+GR++F   G  +DP
Sbjct  121  NLSQLVNVCVVNALGRVMIGRRLF---GVGADP  150



>gb|AGT50313.1| flavonoid 3'-hydroxylase, partial [Meconopsis lancifolia]
Length=476

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 131/161 (81%), Gaps = 4/161 (2%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  3    GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  62

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYN+QDLVFAPYG RWRM RKI +VHLFS KALD+F +VR+EEVA LT++LA +
Sbjct  63   SGAKHIAYNHQDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQS  122

Query  472  GK----TPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
             K    +PV L  LLNVCTTNALARV+LG +V  DG   +D
Sbjct  123  NKNSKGSPVNLADLLNVCTTNALARVLLGTRVCGDGEGLAD  163



>ref|XP_010522791.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X5 [Tarenaya 
hassleriana]
Length=469

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 124/153 (81%), Gaps = 3/153 (2%)
 Frame = +1

Query  127  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  306
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  307  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  486
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  487  KLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
             L QL+NVC  NAL RVM+GR++F   G  +DP
Sbjct  121  NLSQLVNVCVVNALGRVMIGRRLF---GVGADP  150



>gb|AGO03826.1| flavonoid 3`5`-hydroxylase [Billardiera heterophylla]
Length=521

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 153/189 (81%), Gaps = 4/189 (2%)
 Frame = +1

Query  4    IFCTLVFAIFLYFLILRVK---QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  174
            I C  + A+   + IL ++    R+P  LPPGP+PWP++GNLPHLG KPH SIAAMA +Y
Sbjct  8    ILCFTITALPFLYCILNMRILLNRHPRSLPPGPRPWPIVGNLPHLGTKPHHSIAAMARKY  67

Query  175  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  354
            GPL+HLR+G V VVVAASA VAAQFLK +D+NFS+RPPNSGA+H+AYNY D+VFAPYGPR
Sbjct  68   GPLLHLRMGIVHVVVAASADVAAQFLK-NDANFSSRPPNSGAKHMAYNYHDMVFAPYGPR  126

Query  355  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  534
            WRMLRKI ++H+FSAKALDDF  VR+EEVA L R+LA AG+ PV LGQL + C  NAL+ 
Sbjct  127  WRMLRKICALHIFSAKALDDFHRVREEEVAILARTLAHAGQKPVNLGQLFSTCNANALSV  186

Query  535  VMLGRKVFN  561
            +MLGR++F+
Sbjct  187  LMLGRRLFS  195



>gb|AGT50318.1| flavonoid 3'-hydroxylase, partial [Meconopsis punicea]
Length=485

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 131/162 (81%), Gaps = 5/162 (3%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  11   GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  70

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+HIAYNYQDLVFAPYG RWRM RKI ++HLFS KALD+F +VR+EEVA LT++LA +
Sbjct  71   SGAKHIAYNYQDLVFAPYGRRWRMFRKICALHLFSGKALDEFRYVREEEVAVLTKALAQS  130

Query  472  GK-----TPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
             K     +PV L  LLNVCTTNALARV+LG +V  DG   +D
Sbjct  131  NKNSKAGSPVNLADLLNVCTTNALARVLLGTRVCGDGEGLAD  172



>ref|XP_010522758.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010522767.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X3 [Tarenaya 
hassleriana]
Length=489

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 124/153 (81%), Gaps = 3/153 (2%)
 Frame = +1

Query  127  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  306
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  307  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  486
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  487  KLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
             L QL+NVC  NAL RVM+GR++F   G  +DP
Sbjct  121  NLSQLVNVCVVNALGRVMIGRRLF---GVGADP  150



>ref|XP_010522775.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X4 [Tarenaya 
hassleriana]
 ref|XP_010522783.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X4 [Tarenaya 
hassleriana]
Length=488

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 124/153 (81%), Gaps = 3/153 (2%)
 Frame = +1

Query  127  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  306
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  307  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  486
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  487  KLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
             L QL+NVC  NAL RVM+GR++F   G  +DP
Sbjct  121  NLSQLVNVCVVNALGRVMIGRRLF---GVGADP  150



>ref|XP_002514665.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF47771.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=461

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +1

Query  151  IAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDL  330
            +AA+A+ YGPLMHLR+GFVDV+VAASA+VAAQFLK HD NFS+RP N+GA+++AYN+QDL
Sbjct  1    MAALAQVYGPLMHLRMGFVDVIVAASASVAAQFLKTHDVNFSSRPTNAGAKYVAYNHQDL  60

Query  331  VFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNV  510
            VFAPYGPRWR+LRKI+SVHLFSAKALDDF HVR++EV  LT +LA A +TP+ LG+LLN 
Sbjct  61   VFAPYGPRWRLLRKISSVHLFSAKALDDFRHVREQEVGILTHALADACETPINLGRLLNT  120

Query  511  CTTNALARVMLGRKVFNDGGSKSD  582
            CTTNAL RVM+GR+VF DG    D
Sbjct  121  CTTNALGRVMIGRRVFGDGSGGGD  144



>gb|KHN18348.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=519

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 151/192 (79%), Gaps = 0/192 (0%)
 Frame = +1

Query  7    FCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLM  186
              T+V AI  Y L+  + +R  L LPPGP+PWPV+GNLPH+G   H+++A +A  YGPLM
Sbjct  9    LATIVAAILSYRLLKLIIRRPSLHLPPGPRPWPVVGNLPHIGPLLHRALAVLARTYGPLM  68

Query  187  HLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRML  366
            +LRLGFVDVVVAASA+VA QFLKVHD+NFS+RP NS   ++ YN +DL FAPYGPRWR L
Sbjct  69   YLRLGFVDVVVAASASVAEQFLKVHDANFSSRPLNSMTTYMTYNQKDLAFAPYGPRWRFL  128

Query  367  RKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLG  546
            RKI+SVH+FS KALDDF  +RQEEV  LT +LAS+G T V LGQL+NVCTTN LARVM+G
Sbjct  129  RKISSVHMFSVKALDDFRQLRQEEVERLTSNLASSGSTAVNLGQLVNVCTTNTLARVMIG  188

Query  547  RKVFNDGGSKSD  582
            R++FND  S  D
Sbjct  189  RRLFNDSRSSWD  200



>ref|XP_003525447.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=513

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 152/194 (78%), Gaps = 1/194 (1%)
 Frame = +1

Query  7    FCTLVFAIFLYFLILRVKQ-RYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  183
            F T++ A+ +Y ++  + +    LPLPPGP+PWP++GNLPH+G  PHQ +A +A+ +GPL
Sbjct  8    FATIIAAVLIYRVLKPISRPSSSLPLPPGPRPWPIVGNLPHMGPAPHQGLANLAQTHGPL  67

Query  184  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  363
            MHLRLGFVDVVVAASA+VA QFLK+HD+NF +RP N    ++AYN QDLVFAPYGP+WR 
Sbjct  68   MHLRLGFVDVVVAASASVAEQFLKIHDANFCSRPLNFRTTYLAYNKQDLVFAPYGPKWRF  127

Query  364  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  543
            LRK+T+VH+FSAKA+DDF  +RQEEVA LT  LA +    V L QLLNVCTTNAL R+M+
Sbjct  128  LRKLTTVHMFSAKAMDDFSQLRQEEVARLTCKLARSSSKAVNLRQLLNVCTTNALTRIMI  187

Query  544  GRKVFNDGGSKSDP  585
            GR++FND  S  DP
Sbjct  188  GRRIFNDDSSGCDP  201



>dbj|BAB87839.1| flavonoid 3'-hydroxalase [Torenia hybrid cultivar]
Length=457

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = +1

Query  160  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  339
            MA+ YGPLMHL+ G  D VVA+SA+VA QFLK HD NFSNRPPNSGA+HIAYNYQDLVFA
Sbjct  1    MAKTYGPLMHLKFGLKDAVVASSASVAEQFLKKHDVNFSNRPPNSGAKHIAYNYQDLVFA  60

Query  340  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  519
            PYGPRWR+LRKI SVHLFS+KALDDF HVR EE+  L R++AS G  PV LG+LL VCTT
Sbjct  61   PYGPRWRLLRKICSVHLFSSKALDDFQHVRHEEICILIRAIASGGHAPVNLGKLLGVCTT  120

Query  520  NALARVMLGRKVFN-DGGS  573
            NALARVMLGR+VF  DGG 
Sbjct  121  NALARVMLGRRVFEGDGGE  139



>ref|XP_010522750.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X2 [Tarenaya 
hassleriana]
Length=565

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 124/153 (81%), Gaps = 3/153 (2%)
 Frame = +1

Query  127  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  306
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  307  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  486
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  487  KLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
             L QL+NVC  NAL RVM+GR++F   G  +DP
Sbjct  121  NLSQLVNVCVVNALGRVMIGRRLF---GVGADP  150



>ref|XP_010522740.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Tarenaya 
hassleriana]
Length=589

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 124/153 (81%), Gaps = 3/153 (2%)
 Frame = +1

Query  127  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  306
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  307  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  486
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  487  KLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
             L QL+NVC  NAL RVM+GR++F   G  +DP
Sbjct  121  NLSQLVNVCVVNALGRVMIGRRLF---GVGADP  150



>ref|XP_003525448.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Glycine 
max]
Length=512

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPH+G  PHQ +AA+A+ +GPLMHLRLGFVDVVVA+SA+VA QFLK+HD+NF +RP N
Sbjct  42   GNLPHMGPAPHQGLAALAQTHGPLMHLRLGFVDVVVASSASVAEQFLKIHDANFCSRPCN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            S   ++ YN QDLVFAPYGPRWR LRK+++VH+FSAKA+DDF  +RQEEV  LT +LA +
Sbjct  102  SRTTYLTYNQQDLVFAPYGPRWRFLRKLSTVHMFSAKAMDDFRELRQEEVERLTCNLARS  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
                V L QLLNVCTTN LAR+M+GR++F+D  S  DP
Sbjct  162  SSKVVNLRQLLNVCTTNILARIMIGRRIFSDNSSNCDP  199



>dbj|BAE72874.1| flavonoid 3'-hydroxylase [Verbena x hybrida]
Length=465

 Score =   201 bits (510),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +1

Query  151  IAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDL  330
            +AA++  YGPLMHL++GFV VVVAASA  A QFLKV+D+NFSNRPPN+GA+++AYNYQDL
Sbjct  1    MAALSRVYGPLMHLKMGFVHVVVAASAGAAEQFLKVNDANFSNRPPNAGAKYVAYNYQDL  60

Query  331  VFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNV  510
            VFAPYGPRWR+LRKI ++HLFSAKAL+DF  VRQEEV  LTR+LASAG+TP  LGQ+LNV
Sbjct  61   VFAPYGPRWRLLRKICALHLFSAKALEDFRTVRQEEVGILTRALASAGQTPASLGQMLNV  120

Query  511  CTTNALARVMLGRKVFNDGGSKSD  582
            C TNA+ARVMLGR+V        D
Sbjct  121  CATNAIARVMLGRRVVGHSSGGGD  144



>gb|KHN48735.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=512

 Score =   201 bits (512),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPH+G  PHQ +AA+A+ +GPLMHLRLGFVDVVVA+SA+VA QFLK+HD+NF +RP N
Sbjct  42   GNLPHMGPAPHQGLAALAKTHGPLMHLRLGFVDVVVASSASVAEQFLKIHDANFCSRPCN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            S   ++ YN QDLVFAPYGPRWR LRK+++VH+FSAKA+DDF  +RQEEV  LT +LA +
Sbjct  102  SRTTYLTYNQQDLVFAPYGPRWRFLRKLSTVHMFSAKAMDDFRELRQEEVERLTCNLARS  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
                V L QLLNVCTTN LAR+M+GR++F+D  S  DP
Sbjct  162  SSKVVNLRQLLNVCTTNILARIMIGRRIFSDNSSNCDP  199



>ref|XP_003550701.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=526

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPH+G   H+++A +A  YGPLM+LRLGFVDVVVAASA+VA QFLKVHD+NFS+RP N
Sbjct  51   GNLPHIGPLLHRALAVLARTYGPLMYLRLGFVDVVVAASASVAEQFLKVHDANFSSRPLN  110

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            S   ++ YN +DL FAPYGPRWR LRKI+SVH+FS KALDDF  +RQEEV  LT +LAS+
Sbjct  111  SMTTYMTYNQKDLAFAPYGPRWRFLRKISSVHMFSVKALDDFRQLRQEEVERLTSNLASS  170

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
            G T V LGQL+NVCTTN LARVM+GR++FND  S  D
Sbjct  171  GSTAVNLGQLVNVCTTNTLARVMIGRRLFNDSRSSWD  207



>gb|AHL83556.1| flavonoid-3'-hydroxylase [Iris x hollandica]
Length=514

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 127/160 (79%), Gaps = 3/160 (2%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG KPHQ++AAM++ YGPL  LR G VDVVVAAS+ VAAQFL+ +D+NFSNRPPN
Sbjct  46   GNLPQLGTKPHQTLAAMSKLYGPLFRLRFGSVDVVVAASSTVAAQFLRTYDANFSNRPPN  105

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSL---  462
            SGAEH+AYNYQDLVFAPYGPRWRMLRK+ ++HLFS KALDD   VRQ EVA L  +L   
Sbjct  106  SGAEHVAYNYQDLVFAPYGPRWRMLRKLCALHLFSLKALDDLRLVRQGEVAALAANLHRH  165

Query  463  ASAGKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
            A+ G  PV LG+ LNVC TNALAR MLGRKVF +   + +
Sbjct  166  AANGHPPVNLGRALNVCATNALARAMLGRKVFTEEEGRGE  205



>dbj|BAB87838.1| flavonoid 3'-hydroxylase [Torenia hybrid cultivar]
Length=512

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG KPH S+A +A  YGPLMHL++GFV VVVA+SA+ A Q L+VHD+NF +RPPN
Sbjct  45   GNLPHLGPKPHASMAELARAYGPLMHLKMGFVHVVVASSASAAEQCLRVHDANFLSRPPN  104

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGA+H+AYNY+DLVF PYGP+WR+LRKI + H+FS KA+DDF  VR+EEVA L+R+L  A
Sbjct  105  SGAKHVAYNYEDLVFRPYGPKWRLLRKICAQHIFSVKAMDDFRRVREEEVAILSRAL--A  162

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
            GK  V +GQ+LNVC TNAL+RVM+GR+V       +D
Sbjct  163  GKRAVPIGQMLNVCATNALSRVMMGRRVVGHADGTND  199



>gb|AFK73718.1| cytochrome P450 [Papaver somniferum]
Length=475

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 125/151 (83%), Gaps = 4/151 (3%)
 Frame = +1

Query  142  HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNY  321
            HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNY
Sbjct  4    HQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNY  63

Query  322  QDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVK  489
            QDLVFAPYG RWRM RKI +VHLFS KALD+F +VR+EEVA LT++LA + K    +PV 
Sbjct  64   QDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAKSNKNGQGSPVN  123

Query  490  LGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
            L  LLNVCTTNALARV+LG +V  DG   +D
Sbjct  124  LADLLNVCTTNALARVLLGTRVCGDGEGYAD  154



>ref|XP_010030579.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
Length=514

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG  PH+S+AA+A  YGPL+HLRLG VDVVVAAS ++A QFLK HD+NF +RPP 
Sbjct  42   GNLPHLGPMPHRSMAALARSYGPLLHLRLGLVDVVVAASGSMATQFLKTHDANFLSRPPR  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            S  +H+ YN+Q +   PYG RWRMLRKI++VHLFS+KALDDF HVRQEEVA LT +LA  
Sbjct  102  SAGKHLGYNHQGIGAVPYGSRWRMLRKISTVHLFSSKALDDFRHVRQEEVAILTCALAHV  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
            G   V L QLLNVCT NAL RVMLG++V  +G  + +
Sbjct  162  GSASVNLAQLLNVCTANALGRVMLGKRVLGEGKGRDN  198



>dbj|BAM28972.1| flavonoid 3'-hydroxylase [Lilium hybrid division I]
Length=514

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 125/154 (81%), Gaps = 1/154 (1%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG KPHQ++ A+++ +GPL  LRLG  +V+VAASA++A++FL+ HD+NFSNRPPN
Sbjct  43   GNLPHLGPKPHQTMHALSKLHGPLFRLRLGSAEVIVAASASIASEFLRTHDTNFSNRPPN  102

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGAEHIAYNY DLVFAPYGPRWR LRK+ ++HLFS KAL+D C+VR++EVA L R LA +
Sbjct  103  SGAEHIAYNYNDLVFAPYGPRWRALRKLCALHLFSQKALEDLCYVREQEVAILARDLAGS  162

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGS  573
             + PV LG+ LNVC TNAL+R  +G +VF   G 
Sbjct  163  SR-PVNLGETLNVCATNALSRATIGWRVFVGKGE  195



>gb|AHY35314.1| flavonoid 3'-hydroxylase 2 [Morus notabilis]
Length=490

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = +1

Query  124  HLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAE  303
             LG  PHQ+IAA+A ++GPLMHLR G VDVV AASA+VAAQFLK HD+NF +RPP+S A+
Sbjct  23   QLGPAPHQTIAALARKHGPLMHLRFGLVDVVAAASASVAAQFLKAHDTNFLSRPPSSAAK  82

Query  304  HIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTP  483
            H+ Y+Y DLV APYGPRWR++RKI SVHL S KAL+DF +VRQEE A L R LA+AG T 
Sbjct  83   HVGYDYHDLVLAPYGPRWRLMRKIASVHLLSGKALEDFRYVRQEEAAVLIRGLANAGPTA  142

Query  484  VKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
            + L QLL++CTTN L R MLG +VF  G  KSDP
Sbjct  143  INLAQLLHLCTTNTLGRAMLGYRVFGGGSGKSDP  176



>dbj|BAM28971.1| flavonoid 3'-hydroxylase [Lilium hybrid division I]
Length=514

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 124/154 (81%), Gaps = 1/154 (1%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG KPHQ++ A+++ +GPL  LRLG  +V+VAASA +A++FL+ HD+NFSNRPPN
Sbjct  43   GNLPHLGPKPHQTMHALSKLHGPLFRLRLGSAEVIVAASAPIASEFLRTHDTNFSNRPPN  102

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGAEHIAYNY DLVFAPYGPRWR LRK+ ++HLFS KAL+D C+VR++EVA L R LA +
Sbjct  103  SGAEHIAYNYNDLVFAPYGPRWRTLRKLCALHLFSQKALEDLCYVREQEVAILARDLAGS  162

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGS  573
             + PV LG+ LNVC TNAL+R  +G +VF   G 
Sbjct  163  CR-PVNLGETLNVCATNALSRATIGWRVFVGKGE  195



>ref|XP_006665050.1| PREDICTED: flavonoid 3'-monooxygenase-like [Oryza brachyantha]
Length=522

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 123/159 (77%), Gaps = 3/159 (2%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG KPHQ++ A+A  YGPL  LR G  +VVVAASA VAAQFL+VHD+NFSNRPPN
Sbjct  46   GNLPQLGDKPHQTMCALAREYGPLFRLRFGCAEVVVAASADVAAQFLRVHDANFSNRPPN  105

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLA--  465
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSAKAL+D   VR+ EVA + R+LA  
Sbjct  106  SGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSAKALEDLRAVREGEVALMVRNLARQ  165

Query  466  SAGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  579
            +A   PV LGQ  NVC TN LAR  +GR+VF  DGG  +
Sbjct  166  AAATAPVVLGQEANVCATNTLARATIGRRVFAVDGGEGA  204



>ref|XP_008453263.1| PREDICTED: flavonoid 3'-monooxygenase [Cucumis melo]
Length=521

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 127/158 (80%), Gaps = 1/158 (1%)
 Frame = +1

Query  112  GNLPHLGKKP-HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPP  288
            GN+P +G  P H  +AAMA +YGPLM+LRLG VD+VVAASAAVA Q LK+HD+NF +RPP
Sbjct  43   GNMPQIGGAPLHSLLAAMAGKYGPLMYLRLGSVDMVVAASAAVAEQVLKIHDTNFLSRPP  102

Query  289  NSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS  468
            N+GA++IAYNYQD+VFAPYGPRWR+LRKI++VHLFS+KALDD   +RQ+E++ L ++LA 
Sbjct  103  NAGAKYIAYNYQDMVFAPYGPRWRLLRKISAVHLFSSKALDDHRRIRQDEISVLVQALAR  162

Query  469  AGKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
            +G+ P  LG LL VC  N+L R M+GR+VF DG    D
Sbjct  163  SGEAPANLGSLLTVCIANSLGRTMIGRRVFGDGSGSDD  200



>ref|XP_009394321.1| PREDICTED: flavonoid 3'-monooxygenase [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG KPH+++ A+A+ +GPL  LR G VDVVVAASAAVA+Q L+ HD+ F +RPPN
Sbjct  42   GNLPQLGPKPHRTLHALAKVHGPLFRLRFGSVDVVVAASAAVASQLLRAHDAIFCDRPPN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGAEH+AYNYQDLVFAPYGPRWRMLRK+ SVHLFSAKALDD   VRQ EV  L  +L + 
Sbjct  102  SGAEHVAYNYQDLVFAPYGPRWRMLRKLCSVHLFSAKALDDLRWVRQGEVGLLVHALRAC  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKS  579
            G  PV LG  +NVC TNALAR  +GR+VF + GS+ 
Sbjct  162  GDAPVNLGYAVNVCATNALARATMGRRVFEEDGSRE  197



>gb|AAS48419.1| flavonoid 3'-hydroxylase [Allium cepa]
Length=510

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 123/160 (77%), Gaps = 3/160 (2%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG KPHQS+  ++  YGPL  LR G+VDVVVAASA VA QFL+VHD NFSNRPPN
Sbjct  42   GNLPQLGAKPHQSLCELSRTYGPLFGLRFGYVDVVVAASADVAEQFLRVHDVNFSNRPPN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSL---  462
            SGAEHIAYNYQDLVFAPYGPRWRMLRK+ ++HLFS KAL+D   VR  EVATL  +L   
Sbjct  102  SGAEHIAYNYQDLVFAPYGPRWRMLRKLCALHLFSPKALEDLSPVRSLEVATLANTLYLR  161

Query  463  ASAGKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
            A + +  V L Q+L  CTTNAL++ M+GR+VF +  + ++
Sbjct  162  AQSDQPTVNLAQMLTTCTTNALSKAMMGRRVFVNETTDTE  201



>gb|AFW72123.1| red aleurone1 [Zea mays]
Length=515

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 120/160 (75%), Gaps = 4/160 (3%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP +G KPH ++ AMA  YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  46   GNLPQVGAKPHHTMCAMAREYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPN  105

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLA--  465
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA  
Sbjct  106  SGAEHVAYNYQDLVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARQ  165

Query  466  -SAGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  579
               G+  V LGQ+ NVC TN LAR  +GR+VF  DGG  +
Sbjct  166  GERGRAAVALGQVANVCATNTLARATVGRRVFAVDGGEGA  205



>gb|AIC73642.1| flavonoid 3'-hydroxylase [Anthurium andraeanum]
Length=511

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG KPH ++AA++  YGPL+HLRLG V  VVA+SA+VAA FLK HD+NFS+RPPN
Sbjct  46   GNLPQLGAKPHHTLAALSRAYGPLLHLRLGRVHAVVASSASVAAAFLKTHDANFSSRPPN  105

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGAEH+AYNYQDLVFAPYGPRWR LRK+ SVHLF  +AL+ F HVR+EE   L R+L   
Sbjct  106  SGAEHVAYNYQDLVFAPYGPRWRTLRKLCSVHLFCTRALEGFRHVREEEAGVLARALLGR  165

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  567
              +   +G+ +NVC  NALAR ++GR+VF  G
Sbjct  166  RGSAADVGEEVNVCAANALARAVMGRRVFGGG  197



>ref|XP_004983036.1| PREDICTED: flavonoid 3'-monooxygenase-like [Setaria italica]
Length=515

 Score =   188 bits (478),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 119/157 (76%), Gaps = 1/157 (1%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG KPH ++AAMA  +GPL  LR G  +VVVAASAAVAAQFL+ HD+NFSNRPPN
Sbjct  46   GNLPQLGAKPHHTMAAMAREHGPLFRLRFGSAEVVVAASAAVAAQFLRAHDANFSNRPPN  105

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSA+ALDD   VR+ EVA + R LA  
Sbjct  106  SGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSARALDDLRAVREGEVALMVRELARQ  165

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  579
                V LGQ  NVC TN LAR  +GR+VF  DGG  +
Sbjct  166  RGPAVALGQAANVCATNTLARATVGRRVFAVDGGEGA  202



>ref|XP_004138192.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
 ref|XP_004154949.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=522

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 126/158 (80%), Gaps = 1/158 (1%)
 Frame = +1

Query  112  GNLPHLGKKP-HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPP  288
            GN+P +G+   H  +A MA +YGPLM+LRLG VD+VVAASAAVA Q LK+HD+NF +RPP
Sbjct  43   GNMPQIGEAHLHSLLATMAGKYGPLMYLRLGSVDMVVAASAAVAEQVLKIHDTNFLSRPP  102

Query  289  NSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS  468
            N+GA++IAYNYQD+VFAPYGPRWR+LRKI++VHLFS+KALDD   +R+EE++ L ++LA 
Sbjct  103  NAGAKYIAYNYQDMVFAPYGPRWRLLRKISTVHLFSSKALDDHRRIREEEISVLVQALAR  162

Query  469  AGKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
            +G+ P  LG LL VC  N+L R M+GR+VF DG    D
Sbjct  163  SGEAPANLGSLLTVCIANSLGRTMIGRRVFGDGSGSDD  200



>gb|KGN63720.1| Flavonoid 3' hydroxylase [Cucumis sativus]
Length=488

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 126/158 (80%), Gaps = 1/158 (1%)
 Frame = +1

Query  112  GNLPHLGKKP-HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPP  288
            GN+P +G+   H  +A MA +YGPLM+LRLG VD+VVAASAAVA Q LK+HD+NF +RPP
Sbjct  43   GNMPQIGEAHLHSLLATMAGKYGPLMYLRLGSVDMVVAASAAVAEQVLKIHDTNFLSRPP  102

Query  289  NSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS  468
            N+GA++IAYNYQD+VFAPYGPRWR+LRKI++VHLFS+KALDD   +R+EE++ L ++LA 
Sbjct  103  NAGAKYIAYNYQDMVFAPYGPRWRLLRKISTVHLFSSKALDDHRRIREEEISVLVQALAR  162

Query  469  AGKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSD  582
            +G+ P  LG LL VC  N+L R M+GR+VF DG    D
Sbjct  163  SGEAPANLGSLLTVCIANSLGRTMIGRRVFGDGSGSDD  200



>gb|AFP95893.1| F3'H [Narcissus tazetta]
Length=528

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 119/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNL  LG KPHQ++ A++  YGPL  LR G V+V+   SA VAAQFL+ HD+NFSNRPPN
Sbjct  63   GNLLQLGAKPHQTLCALSRVYGPLFSLRFGSVNVIAVTSADVAAQFLRTHDANFSNRPPN  122

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGAEH+ YNYQDLVFAPYGPRWRMLRK+ ++HLFSAKALDDF  VR  EVA L  +L S 
Sbjct  123  SGAEHVVYNYQDLVFAPYGPRWRMLRKLCALHLFSAKALDDFRPVRAGEVAILANTLYSH  182

Query  472  GKT--PVKLGQLLNVCTTNALARVMLGRKVFNDGGS  573
             ++     LG+LL +CTTNAL++ +LG +VF + G+
Sbjct  183  AQSRREANLGELLTICTTNALSKAVLGLRVFGEAGN  218



>ref|NP_001064338.1| Os10g0320100 [Oryza sativa Japonica Group]
 gb|AAM00948.1|AC021892_12 Putative flavonoid 3'-hydroxylase [Oryza sativa Japonica Group]
 gb|AAN04937.1| Putative chalcone flavonoid 3' - hydroxylase [Oryza sativa Japonica 
Group]
 gb|AAP52914.1| Flavonoid 3'-monooxygenase, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26252.1| Os10g0320100 [Oryza sativa Japonica Group]
 gb|EAY78007.1| hypothetical protein OsI_33047 [Oryza sativa Indica Group]
 gb|EAZ15637.1| hypothetical protein OsJ_31048 [Oryza sativa Japonica Group]
 dbj|BAG89180.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEK31169.1| flavonoid 3'-hydroxylase [Oryza sativa Japonica Group]
Length=526

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 118/157 (75%), Gaps = 1/157 (1%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG KPH ++ A+A +YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  52   GNLPQLGDKPHHTMCALARQYGPLFRLRFGCAEVVVAASAPVAAQFLRGHDANFSNRPPN  111

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R+LA  
Sbjct  112  SGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSAKALDDLRAVREGEVALMVRNLARQ  171

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  579
                V LGQ  NVC TN LAR  +G +VF  DGG  +
Sbjct  172  QAASVALGQEANVCATNTLARATIGHRVFAVDGGEGA  208



>gb|KCW83706.1| hypothetical protein EUGRSUZ_B00580 [Eucalyptus grandis]
Length=465

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +1

Query  139  PHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYN  318
            PH+S+AA+A  YGPL+HLRLG VDVVVAAS ++A QFLK HD+NF +RPP S  +H+ YN
Sbjct  2    PHRSMAALARSYGPLLHLRLGLVDVVVAASGSMATQFLKTHDANFLSRPPRSAGKHLGYN  61

Query  319  YQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ  498
            +Q +   PYG RWRMLRKI++VHLFS+KALDDF HVRQEEVA LT +LA  G   V L Q
Sbjct  62   HQGIGAVPYGSRWRMLRKISTVHLFSSKALDDFRHVRQEEVAILTCALAHVGSASVNLAQ  121

Query  499  LLNVCTTNALARVMLGRKVFNDGGSKSD  582
            LLNVCT NAL RVMLG++V  +G  + +
Sbjct  122  LLNVCTANALGRVMLGKRVLGEGKGRDN  149



>gb|AGG40645.1| flavanone 3'-hydroxylase [Narcissus tazetta]
Length=529

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            G+L  LG KPHQ++ A++  YGPL  LR G V+V+   SA VAAQFL+ HD+NFSNRPPN
Sbjct  63   GSLLQLGAKPHQTLCALSRVYGPLFSLRFGSVNVIAVTSADVAAQFLRTHDANFSNRPPN  122

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGAEH+AYNYQDLVFAPYGPRWRMLRK+ ++HLFS KALDD   VR  EVA L  +L + 
Sbjct  123  SGAEHVAYNYQDLVFAPYGPRWRMLRKLCALHLFSPKALDDLRPVRAGEVAILANTLYNH  182

Query  472  GKT--PVKLGQLLNVCTTNALARVMLGRKVFNDGGS  573
             +T     LG+LL +CTTNAL++ MLG +VF + G+
Sbjct  183  AQTHGEANLGELLTICTTNALSKAMLGLRVFGEAGN  218



>ref|XP_003525450.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=511

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 117/158 (74%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPH+G  PHQ +AA+A+ +GPLMHLRLGFV VVVAASAAVA QFLKVHD+NF NRP N
Sbjct  42   GNLPHMGPAPHQGLAALAKTHGPLMHLRLGFVHVVVAASAAVAEQFLKVHDANFCNRPYN  101

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
                ++ YN +D+ F PYGPRWR LRKI +VH+FS KA+D+F  +RQEEV  L  +L  +
Sbjct  102  FRTTYMTYNKKDIAFYPYGPRWRFLRKICTVHMFSGKAMDNFSQLRQEEVERLACNLTRS  161

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
                V L QLLNVC TN +AR+ +GR++FND     DP
Sbjct  162  NSKAVNLRQLLNVCITNIMARITIGRRIFNDDSCNCDP  199



>gb|AGJ50589.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
 gb|AGL98427.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
 gb|AGL98428.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
Length=510

 Score =   183 bits (465),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 120/154 (78%), Gaps = 1/154 (1%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG KPHQ++ A+++ +GPL  L+LG  +VVVAAS+ VAA+FL+ HD+NFSNRPPN
Sbjct  45   GNLPQLGTKPHQTMHALSKVHGPLFRLKLGSAEVVVAASSTVAAEFLRSHDANFSNRPPN  104

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SGAEHIAYNY DLVFAPYGPRWR LRK+ ++HLFS KAL+D  +VR++EV  L   LAS 
Sbjct  105  SGAEHIAYNYNDLVFAPYGPRWRALRKLCALHLFSQKALEDLRYVREQEVGILAGDLAST  164

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGS  573
             + PV LG+ LNVC TNAL+R  +G +VF   G 
Sbjct  165  SR-PVNLGEALNVCATNALSRATVGWRVFVGKGE  197



>gb|KCW83705.1| hypothetical protein EUGRSUZ_B00580 [Eucalyptus grandis]
Length=478

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +1

Query  139  PHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYN  318
            PH+S+AA+A  YGPL+HLRLG VDVVVAAS ++A QFLK HD+NF +RPP S  +H+ YN
Sbjct  2    PHRSMAALARSYGPLLHLRLGLVDVVVAASGSMATQFLKTHDANFLSRPPRSAGKHLGYN  61

Query  319  YQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ  498
            +Q +   PYG RWRMLRKI++VHLFS+KALDDF HVRQEEVA LT +LA  G   V L Q
Sbjct  62   HQGIGAVPYGSRWRMLRKISTVHLFSSKALDDFRHVRQEEVAILTCALAHVGSASVNLAQ  121

Query  499  LLNVCTTNALARVMLGRKVFNDGGSKSD  582
            LLNVCT NAL RVMLG++V  +G  + +
Sbjct  122  LLNVCTANALGRVMLGKRVLGEGKGRDN  149



>gb|KHN48734.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=506

 Score =   183 bits (465),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 117/158 (74%), Gaps = 0/158 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPH+G  PHQ +AA+A+ +GPLMHLRLGFV VVVAASAAVA QFLKVHD+NF NRP N
Sbjct  37   GNLPHMGPAPHQGLAALAKTHGPLMHLRLGFVHVVVAASAAVAEQFLKVHDANFCNRPYN  96

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
                ++ YN +D+ F PYGPRWR LRKI +VH+FS KA+D+F  +RQEEV  L  +L  +
Sbjct  97   FRTTYMTYNKKDIAFYPYGPRWRFLRKICTVHMFSGKAMDNFSQLRQEEVERLACNLTRS  156

Query  472  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKSDP  585
                V L QLLNVC TN +AR+ +GR++FND     DP
Sbjct  157  NSKAVNLRQLLNVCITNIMARITIGRRIFNDDSCNCDP  194



>gb|AGT50323.1| flavonoid 3'-hydroxylase, partial [Meconopsis pseudohorridula]
Length=452

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 115/139 (83%), Gaps = 4/139 (3%)
 Frame = +1

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  525
            RM RKI +VHLFS KALD+F +VR+EEVA LT++LA   K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQTNKNSKGSPVNLADLLNVCTTNA  120

Query  526  LARVMLGRKVFNDGGSKSD  582
            LARV+LGR+V  DG   +D
Sbjct  121  LARVLLGRRVCGDGEGLAD  139



>dbj|BAH22519.1| flavonoid 3' hydroxylase [Tricyrtis hirta]
Length=505

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 134/189 (71%), Gaps = 6/189 (3%)
 Frame = +1

Query  13   TLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHL  192
            TLVFA  LY L+     R P      P      GNLP LG KPHQ++ A+++ +GPL  L
Sbjct  11   TLVFASLLYHLLSGPAHRLPPGPRGWPIL----GNLPQLGPKPHQTLHALSKAHGPLFLL  66

Query  193  RLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRK  372
            RLG VDVVVAASAAVAA FL+ HD+ FSNRPPNSGAEHIAYNYQDLVFAPYGPRWR LRK
Sbjct  67   RLGSVDVVVAASAAVAAAFLRQHDAIFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRHLRK  126

Query  373  ITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRK  552
            + S+HLFS+KALDD   +R++E+  LTRSL      PV LG+ +NVC TNALAR  +G +
Sbjct  127  LCSLHLFSSKALDDLRPIREQEIQRLTRSLLVG--RPVNLGEAVNVCATNALARATVGWR  184

Query  553  VFNDGGSKS  579
            VF   G  +
Sbjct  185  VFVGEGEDT  193



>emb|CDP16353.1| unnamed protein product [Coffea canephora]
Length=151

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = +1

Query  1    LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  180
            LIF + + A FL + IL+        LPPGPKPWP++GNLPHLG KPH S+AAMA+ YGP
Sbjct  6    LIFISSLLA-FLLYSILKKAGNPSKSLPPGPKPWPIVGNLPHLGTKPHHSLAAMAKTYGP  64

Query  181  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  360
            LMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPRWR
Sbjct  65   LMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPRWR  124

Query  361  MLRKITSVHLFSAKALDDFCHVRQEEV  441
            +LRKI S+HLFSAKALDDF  VRQ ++
Sbjct  125  LLRKICSIHLFSAKALDDFHLVRQVKI  151



>ref|XP_002439914.1| hypothetical protein SORBIDRAFT_09g022480 [Sorghum bicolor]
 gb|EES18344.1| hypothetical protein SORBIDRAFT_09g022480 [Sorghum bicolor]
Length=535

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 117/153 (76%), Gaps = 4/153 (3%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG K HQ++  + + YGPL+ LR G  DVVVA SAAVA QFL+VHD+NFS RPPN
Sbjct  58   GNLPQLGGKTHQTLHELTKVYGPLLRLRFGSSDVVVAGSAAVAEQFLRVHDANFSCRPPN  117

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  471
            SG E +AYNYQD+VFAPYGPRWR +RK+ +V+LFSA+ALDD C VR+ E A + RSLA  
Sbjct  118  SGGELMAYNYQDVVFAPYGPRWRAMRKVCAVNLFSARALDDICDVREREAALMVRSLAEQ  177

Query  472  G----KTPVKLGQLLNVCTTNALARVMLGRKVF  558
                  TPV LG+ +NVCTTNAL+R  +GR+VF
Sbjct  178  AARDRNTPVALGKAVNVCTTNALSRAAVGRRVF  210



>gb|ABG54319.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 121/162 (75%), Gaps = 9/162 (6%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP +G  PH ++ A+A+ YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQVGSHPHHTMCALAKEYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPN  107

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  468
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA  
Sbjct  108  SGAEHVAYNYQDLVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARH  167

Query  469  ----AGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  579
                AG   V LGQ+ NVC TN LAR  +GR+VF  DGG ++
Sbjct  168  QHQHAG---VPLGQVANVCATNTLARATVGRRVFAVDGGEEA  206



>ref|XP_008678758.1| PREDICTED: flavonoid 3'-monooxygenase-like [Zea mays]
 gb|AFW62811.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=521

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 120/163 (74%), Gaps = 7/163 (4%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP +G KPH ++ A+A  YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  46   GNLPQVGAKPHHTMCALAREYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPN  105

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLA--  465
            SGAEH+AYNY+DLVFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA  
Sbjct  106  SGAEHVAYNYRDLVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARP  165

Query  466  ---SAGK-TPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  579
                 G+   V LGQ+ NVC TN LAR  +GR+VF  DGG  +
Sbjct  166  RRGEGGRAAAVALGQVANVCATNTLARATVGRRVFAVDGGEGA  208



>ref|XP_002452380.1| hypothetical protein SORBIDRAFT_04g024710 [Sorghum bicolor]
 gb|EES05356.1| hypothetical protein SORBIDRAFT_04g024710 [Sorghum bicolor]
Length=517

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 121/162 (75%), Gaps = 9/162 (6%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG  PH ++ A+A++YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQLGSHPHHTMCALAKKYGPLFRLRFGSAEVVVAASARVAAQFLRTHDANFSNRPPN  107

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  468
            SGAEH+AYNYQD+ FAPYG RWR LRK+ ++HLFSAKALDD   +R+ EVA L R L+  
Sbjct  108  SGAEHVAYNYQDMAFAPYGSRWRALRKLCALHLFSAKALDDLRSIREGEVALLVRELSRH  167

Query  469  ----AGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  579
                AG   V LGQ+ NVC TN LAR  +GR+VF  DGG ++
Sbjct  168  QHQHAG---VPLGQVANVCATNTLARATVGRRVFAVDGGEEA  206



>gb|ABG54320.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 121/162 (75%), Gaps = 9/162 (6%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG  PH ++ A+A++YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQLGSHPHHTMCALAKKYGPLFRLRFGSAEVVVAASARVAAQFLRTHDANFSNRPPN  107

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  468
            SGAEH+AYNYQD+ FAPYG RWR LRK+ ++HLFSAKALDD   +R+ EVA L R L+  
Sbjct  108  SGAEHVAYNYQDMAFAPYGSRWRALRKLCALHLFSAKALDDLRSIREGEVALLVRELSRH  167

Query  469  ----AGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  579
                AG   V LGQ+ NVC TN LAR  +GR+VF  DGG ++
Sbjct  168  QHQHAG---VPLGQVANVCATNTLARATVGRRVFAVDGGEEA  206



>dbj|BAM28973.1| flavonoid 3'-hydroxylase, partial [Lilium hybrid division I]
Length=453

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 117/145 (81%), Gaps = 1/145 (1%)
 Frame = +1

Query  139  PHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYN  318
            PHQ++ A+++ +GPL  LRLG  +V+VAASA++A++FL+ HD+NFSNRPPNSGAEHIAYN
Sbjct  1    PHQTMHALSKLHGPLFRLRLGSAEVIVAASASIASEFLRTHDTNFSNRPPNSGAEHIAYN  60

Query  319  YQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ  498
            Y DLVFAPYGPRWR LRK+ ++HLFS KAL+D C+VR++EVA L R LA + + PV LG+
Sbjct  61   YNDLVFAPYGPRWRALRKLCALHLFSQKALEDLCYVREQEVALLARDLAGSSR-PVNLGE  119

Query  499  LLNVCTTNALARVMLGRKVFNDGGS  573
             LNVC TNAL+R  +G +VF   G 
Sbjct  120  TLNVCATNALSRATIGWRVFVGKGE  144



>gb|AGT50312.1| flavonoid 3'-hydroxylase, partial [Meconopsis racemosa]
Length=445

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 115/139 (83%), Gaps = 4/139 (3%)
 Frame = +1

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  525
            RM RKI +VHLFS KALD+F +VR+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLADLLNVCTTNA  120

Query  526  LARVMLGRKVFNDGGSKSD  582
            LARV+LG +V  DG   +D
Sbjct  121  LARVLLGTRVCGDGEGLAD  139



>gb|AGT50315.1| flavonoid 3'-hydroxylase, partial [Meconopsis betonicifolia]
Length=452

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 115/139 (83%), Gaps = 4/139 (3%)
 Frame = +1

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  525
            RM RKI +VHLFS KALD+F +VR+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLADLLNVCTTNA  120

Query  526  LARVMLGRKVFNDGGSKSD  582
            LARV+LG +V  DG   +D
Sbjct  121  LARVLLGTRVCGDGEGLAD  139



>gb|AGT50317.1| flavonoid 3'-hydroxylase, partial [Meconopsis zangnanensis]
Length=442

 Score =   179 bits (453),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 115/141 (82%), Gaps = 4/141 (3%)
 Frame = +1

Query  172  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  351
            YGP+++LR G V+VVVA SA++A+QFLK  DSNFSNRPPNSGA+HIAYNYQDLVFAPYG 
Sbjct  4    YGPIIYLRFGSVNVVVACSASIASQFLKTRDSNFSNRPPNSGAKHIAYNYQDLVFAPYGR  63

Query  352  RWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTT  519
            RWRM RKI +VHLFS KALD+F +VR+EEVA LT++LA + +    +PV L  LLNVCTT
Sbjct  64   RWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNENSKGSPVNLADLLNVCTT  123

Query  520  NALARVMLGRKVFNDGGSKSD  582
            NALARV+LG +V  DG   +D
Sbjct  124  NALARVLLGTRVCGDGEGLAD  144



>gb|AGT50314.1| flavonoid 3'-hydroxylase, partial [Meconopsis henrici]
Length=445

 Score =   179 bits (453),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 115/139 (83%), Gaps = 4/139 (3%)
 Frame = +1

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  525
            RM RKI +VHLFS KALD+F +VR+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLADLLNVCTTNA  120

Query  526  LARVMLGRKVFNDGGSKSD  582
            LARV+LG +V  DG   +D
Sbjct  121  LARVLLGTRVCGDGEGFAD  139



>gb|AII26680.1| flavonoid 3'-hydroxylase [Indosasa hispida]
Length=521

 Score =   180 bits (457),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 135/188 (72%), Gaps = 5/188 (3%)
 Frame = +1

Query  19   VFAIFLYFLILRV-KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLR  195
            V AI  Y L  R  K R   PLPPGP+ WPVLGNLP LG K HQ++  M + YGPL+ LR
Sbjct  14   VSAIVCYVLFFRAGKARRRAPLPPGPRGWPVLGNLPQLGGKTHQTLHVMTKVYGPLLRLR  73

Query  196  LGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKI  375
             G  DVVVA SAAVA QFL++HD+ FSNRPPNSG EH+AYNYQD+VF PYGPRWR +RK+
Sbjct  74   FGSSDVVVAGSAAVAEQFLRIHDAKFSNRPPNSGGEHMAYNYQDVVFGPYGPRWRAMRKV  133

Query  376  TSVHLFSAKALDDFCHVRQEEVATLTRSLASA----GKTPVKLGQLLNVCTTNALARVML  543
             +V+LFSA+ALDD   VR+ E A + RSL  A    G   V LG+ +NVCTTNAL+R  +
Sbjct  134  CAVNLFSARALDDLRAVREREAALMVRSLVEASAPRGAPAVPLGKAVNVCTTNALSRAAV  193

Query  544  GRKVFNDG  567
            GR+VF  G
Sbjct  194  GRRVFAAG  201



>gb|AEF33624.1| flavonoid 3' hydroxylase [Zea mays]
Length=517

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 120/162 (74%), Gaps = 9/162 (6%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG  PH ++ A+A++YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQLGSHPHHTMCALAKKYGPLFRLRFGSAEVVVAASARVAAQFLRTHDANFSNRPPN  107

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  468
            SGAEH+AYNYQD+ FAPYG RWR LRK+ ++HLFSAKALDD   +R+ EVA L R L+  
Sbjct  108  SGAEHVAYNYQDMAFAPYGSRWRALRKLCALHLFSAKALDDLRSIREGEVALLVRELSRH  167

Query  469  ----AGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  579
                AG   V LGQ+ NVC TN LAR   GR+VF  DGG ++
Sbjct  168  QHQHAG---VPLGQVANVCATNTLARATAGRRVFAVDGGEEA  206



>gb|AGT50324.1| flavonoid 3'-hydroxylase, partial [Papaver nudicaule]
Length=449

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 115/139 (83%), Gaps = 4/139 (3%)
 Frame = +1

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            P+++LRLG V+VVVA SA++A+QFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  525
            RM RKI +VHLFS KALD+F ++R+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFWYIREEEVAVLTKALAQSSKNNKGSPVNLADLLNVCTTNA  120

Query  526  LARVMLGRKVFNDGGSKSD  582
            LARV+LG +V  DG   +D
Sbjct  121  LARVLLGTRVCGDGEGLAD  139



>gb|ABG54321.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=515

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 118/159 (74%), Gaps = 3/159 (2%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP +G  PH ++ A+A+ YGPL  LR G  DVVVAASA VA QFL+ HD+NFSNRPPN
Sbjct  46   GNLPQVGSHPHHTMYALAKEYGPLFRLRFGSADVVVAASARVAVQFLRAHDANFSNRPPN  105

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLA--  465
            SGAEH+AYNYQD+VFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA  
Sbjct  106  SGAEHMAYNYQDMVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRQLALH  165

Query  466  SAGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  579
                  V LGQ+ NVC TN LAR  +GR+VF  DGG ++
Sbjct  166  QHQHAGVPLGQVANVCATNTLARATVGRRVFAVDGGEEA  204



>ref|XP_002452385.1| hypothetical protein SORBIDRAFT_04g024730 [Sorghum bicolor]
 gb|EES05361.1| hypothetical protein SORBIDRAFT_04g024730 [Sorghum bicolor]
Length=517

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 118/159 (74%), Gaps = 3/159 (2%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP +G  PH ++ A+A+ YGPL  LR G  DVVVAASA VA QFL+ HD+NFSNRPPN
Sbjct  48   GNLPQVGSHPHHTMYALAKEYGPLFRLRFGSADVVVAASARVAVQFLRAHDANFSNRPPN  107

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLA--  465
            SGAEH+AYNYQD+VFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA  
Sbjct  108  SGAEHMAYNYQDMVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRQLALH  167

Query  466  SAGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  579
                  V LGQ+ NVC TN LAR  +GR+VF  DGG ++
Sbjct  168  QHQHAGVPLGQVANVCATNTLARATVGRRVFAVDGGEEA  206



>ref|XP_002454110.1| hypothetical protein SORBIDRAFT_04g024750 [Sorghum bicolor]
 gb|EES07086.1| hypothetical protein SORBIDRAFT_04g024750 [Sorghum bicolor]
Length=517

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 121/162 (75%), Gaps = 9/162 (6%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP +G  P+ ++ A+A+ YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQVGSHPYHTMCALAKEYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPN  107

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  468
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA  
Sbjct  108  SGAEHVAYNYQDLVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARH  167

Query  469  ----AGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  579
                AG   V LGQ+ NVC TN LAR  +GR+VF  DGG ++
Sbjct  168  QHQHAG---VPLGQVANVCATNTLARATVGRRVFAVDGGEEA  206



>gb|AGT50325.1| flavonoid 3'-hydroxylase, partial [Papaver radicatum]
Length=449

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 115/139 (83%), Gaps = 4/139 (3%)
 Frame = +1

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            P+++LRLG V+VVVA SA++A+QFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  525
            RM RKI +VHLFS KALD+F ++R+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYIREEEVAVLTKALAQSSKNNKGSPVNLADLLNVCTTNA  120

Query  526  LARVMLGRKVFNDGGSKSD  582
            LARV+LG +V  DG   +D
Sbjct  121  LARVLLGTRVCGDGEGLAD  139



>gb|AGT50316.1| flavonoid 3'-hydroxylase, partial [Meconopsis integrifolia]
Length=445

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 115/139 (83%), Gaps = 4/139 (3%)
 Frame = +1

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPP+SGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPDSGAKHIAYNYQDLVFAPYGRRW  60

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  525
            RM RKI +VHLFS KALD+F +VR+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLSDLLNVCTTNA  120

Query  526  LARVMLGRKVFNDGGSKSD  582
            LARV+LG +V  DG   +D
Sbjct  121  LARVLLGTRVCGDGEGLAD  139



>gb|AGT50319.1| flavonoid 3'-hydroxylase, partial [Meconopsis quintuplinervia]
Length=454

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 115/140 (82%), Gaps = 5/140 (4%)
 Frame = +1

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK-----TPVKLGQLLNVCTTN  522
            RM RKI ++HLFS KALD+F +VR+EEVA LT++LA + K     +PV L  LLNVCTTN
Sbjct  61   RMFRKICALHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKAGSPVNLADLLNVCTTN  120

Query  523  ALARVMLGRKVFNDGGSKSD  582
            ALARV+LG +V  DG   +D
Sbjct  121  ALARVLLGTRVCGDGEGLAD  140



>gb|AGT50321.1| flavonoid 3'-hydroxylase, partial [Meconopsis wilsonii]
Length=445

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 113/139 (81%), Gaps = 4/139 (3%)
 Frame = +1

Query  178  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  357
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGARHIAYNYQDLVFAPYGRRW  60

Query  358  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  525
            RM RKI +VHLFS KALD+F + R+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYAREEEVAVLTKALAQSNKNSKGSPVNLADLLNVCTTNA  120

Query  526  LARVMLGRKVFNDGGSKSD  582
            LARV+LG +V  DG   +D
Sbjct  121  LARVLLGTRVCGDGEGFAD  139



>gb|ADX95997.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=132

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLPHLG  PH ++AA+A++YGPLMHLRLG+VDVVVAA+A+VAAQFLKVHD+NF++RPPN
Sbjct  26   GNLPHLGPIPHHALAALAQKYGPLMHLRLGYVDVVVAATASVAAQFLKVHDANFASRPPN  85

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQ  432
            SGA+H+AYNYQDLVFAPYGPRWR+LRKI SVHLFSAKALDDF HVRQ
Sbjct  86   SGAKHVAYNYQDLVFAPYGPRWRLLRKICSVHLFSAKALDDFRHVRQ  132



>gb|AFW62812.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=944

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 119/161 (74%), Gaps = 7/161 (4%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP +G KPH ++ A+A  YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  46   GNLPQVGAKPHHTMCALAREYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPN  105

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLA--  465
            SGAEH+AYNY+DLVFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA  
Sbjct  106  SGAEHVAYNYRDLVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARP  165

Query  466  ---SAGK-TPVKLGQLLNVCTTNALARVMLGRKVFN-DGGS  573
                 G+   V LGQ+ NVC TN LAR  +GR+VF  DGG 
Sbjct  166  RRGEGGRAAAVALGQVANVCATNTLARATVGRRVFAVDGGE  206



>gb|AAV74194.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
 gb|AAV74195.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 120/162 (74%), Gaps = 9/162 (6%)
 Frame = +1

Query  112  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  291
            GNLP LG  PH ++ A+A++YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQLGSHPHHTMCALAKKYGPLFRLRFGSAEVVVAASARVAAQFLRTHDANFSNRPPN  107

Query  292  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  468
            SGAEH+AYNYQD+ FAPYG RWR LRK+ ++HLFSAKALDD   +R+ EVA L R L+  
Sbjct  108  SGAEHVAYNYQDMAFAPYGSRWRALRKLCALHLFSAKALDDLRSIREGEVALLVRELSRF  167

Query  469  ----AGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  579
                AG   V L Q+ NVC TN LAR  +GR+VF  DGG ++
Sbjct  168  QHQHAG---VPLFQVANVCATNTLARATVGRRVFAVDGGEEA  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875