BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS046G11

Length=532
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625190.1|  PREDICTED: BTB/POZ domain-containing protein...  89.4    3e-17   Nicotiana tomentosiformis
ref|XP_009764318.1|  PREDICTED: BTB/POZ domain-containing protein...  88.2    6e-17   Nicotiana sylvestris
ref|XP_009776135.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    6e-15   Nicotiana sylvestris
ref|XP_009626485.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    7e-15   Nicotiana tomentosiformis
ref|XP_006346315.1|  PREDICTED: BTB/POZ domain-containing protein...  80.1    4e-14   Solanum tuberosum [potatoes]
emb|CDO97269.1|  unnamed protein product                              79.0    9e-14   Coffea canephora [robusta coffee]
ref|XP_011088062.1|  PREDICTED: BTB/POZ domain-containing protein...  77.8    3e-13   Sesamum indicum [beniseed]
ref|XP_004230705.1|  PREDICTED: BTB/POZ domain-containing protein...  76.6    6e-13   
gb|EYU37575.1|  hypothetical protein MIMGU_mgv1a002858mg              75.9    1e-12   Erythranthe guttata [common monkey flower]
ref|XP_002264153.1|  PREDICTED: BTB/POZ domain-containing protein...  73.9    4e-12   Vitis vinifera
gb|KHG02234.1|  BTB/POZ domain-containing NPY2 -like protein          73.6    7e-12   Gossypium arboreum [tree cotton]
gb|KJB79441.1|  hypothetical protein B456_013G050000                  73.2    9e-12   Gossypium raimondii
emb|CAN66911.1|  hypothetical protein VITISV_035422                   71.6    3e-11   Vitis vinifera
ref|XP_004511848.1|  PREDICTED: BTB/POZ domain-containing protein...  71.2    4e-11   Cicer arietinum [garbanzo]
ref|XP_007042621.1|  Phototropic-responsive NPH3 family protein i...  71.2    4e-11   
ref|XP_007042620.1|  Phototropic-responsive NPH3 family protein i...  70.9    5e-11   
gb|KJB32266.1|  hypothetical protein B456_005G232400                  69.7    1e-10   Gossypium raimondii
ref|XP_006353967.1|  PREDICTED: BTB/POZ domain-containing protein...  69.3    2e-10   Solanum tuberosum [potatoes]
gb|KHF97345.1|  BTB/POZ domain-containing NPY5 -like protein          68.9    2e-10   Gossypium arboreum [tree cotton]
gb|KJB32267.1|  hypothetical protein B456_005G232400                  68.9    2e-10   Gossypium raimondii
ref|XP_010099608.1|  BTB/POZ domain-containing protein NPY2           67.4    7e-10   Morus notabilis
ref|XP_004248766.1|  PREDICTED: BTB/POZ domain-containing protein...  67.4    7e-10   Solanum lycopersicum
ref|XP_002284345.1|  PREDICTED: BTB/POZ domain-containing protein...  63.9    9e-09   Vitis vinifera
ref|XP_009347119.1|  PREDICTED: BTB/POZ domain-containing protein...  63.5    1e-08   Pyrus x bretschneideri [bai li]
ref|XP_008440372.1|  PREDICTED: BTB/POZ domain-containing protein...  63.5    1e-08   
ref|XP_004156852.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  62.8    2e-08   
ref|XP_004152268.1|  PREDICTED: BTB/POZ domain-containing protein...  62.8    2e-08   Cucumis sativus [cucumbers]
ref|XP_008454387.1|  PREDICTED: BTB/POZ domain-containing protein...  62.8    2e-08   Cucumis melo [Oriental melon]
ref|XP_010272331.1|  PREDICTED: BTB/POZ domain-containing protein...  62.8    2e-08   
ref|XP_011092513.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    3e-08   Sesamum indicum [beniseed]
ref|XP_011092512.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    3e-08   Sesamum indicum [beniseed]
ref|XP_003611607.1|  BTB/POZ domain-containing protein                62.0    4e-08   Medicago truncatula
ref|XP_008366255.1|  PREDICTED: BTB/POZ domain-containing protein...  61.6    5e-08   
ref|XP_006486926.1|  PREDICTED: BTB/POZ domain-containing protein...  60.8    9e-08   Citrus sinensis [apfelsine]
gb|KDO57872.1|  hypothetical protein CISIN_1g007080mg                 60.8    1e-07   Citrus sinensis [apfelsine]
ref|XP_004141870.1|  PREDICTED: BTB/POZ domain-containing protein...  60.8    1e-07   Cucumis sativus [cucumbers]
ref|XP_006422840.1|  hypothetical protein CICLE_v10028033mg           60.5    1e-07   Citrus clementina [clementine]
ref|XP_008236444.1|  PREDICTED: BTB/POZ domain-containing protein...  60.5    1e-07   Prunus mume [ume]
ref|XP_007201732.1|  hypothetical protein PRUPE_ppa002913mg           60.1    2e-07   Prunus persica
gb|EPS65621.1|  hypothetical protein M569_09155                       60.1    2e-07   Genlisea aurea
ref|XP_008346361.1|  PREDICTED: BTB/POZ domain-containing protein...  59.3    3e-07   
ref|XP_010277066.1|  PREDICTED: BTB/POZ domain-containing protein...  59.3    3e-07   Nelumbo nucifera [Indian lotus]
ref|XP_007047503.1|  Phototropic-responsive NPH3 family protein i...  58.5    4e-07   
ref|XP_009335385.1|  PREDICTED: BTB/POZ domain-containing protein...  58.5    5e-07   Pyrus x bretschneideri [bai li]
ref|XP_007047500.1|  Phototropic-responsive NPH3 family protein i...  58.5    5e-07   
emb|CBI22467.3|  unnamed protein product                              58.2    6e-07   Vitis vinifera
ref|XP_007143108.1|  hypothetical protein PHAVU_007G044300g           57.8    1e-06   Phaseolus vulgaris [French bean]
ref|XP_002306504.2|  hypothetical protein POPTR_0005s19010g           57.0    2e-06   
emb|CBI33702.3|  unnamed protein product                              55.8    3e-06   Vitis vinifera
gb|KHN42319.1|  BTB/POZ domain-containing protein NPY2                55.8    4e-06   Glycine soja [wild soybean]
ref|XP_003555987.1|  PREDICTED: BTB/POZ domain-containing protein...  55.8    4e-06   Glycine max [soybeans]
ref|XP_002300262.2|  hypothetical protein POPTR_0001s30270g           55.5    5e-06   
ref|XP_011030353.1|  PREDICTED: BTB/POZ domain-containing protein...  55.5    5e-06   Populus euphratica
gb|KHN23238.1|  BTB/POZ domain-containing protein NPY2                55.1    6e-06   Glycine soja [wild soybean]
ref|XP_003550011.1|  PREDICTED: BTB/POZ domain-containing protein...  55.1    6e-06   
ref|XP_011011590.1|  PREDICTED: BTB/POZ domain-containing protein...  55.1    8e-06   Populus euphratica
ref|XP_010086948.1|  BTB/POZ domain-containing protein NPY2           55.1    8e-06   Morus notabilis
gb|KJB43895.1|  hypothetical protein B456_007G222400                  54.7    9e-06   Gossypium raimondii
gb|KJB43899.1|  hypothetical protein B456_007G222400                  54.7    9e-06   Gossypium raimondii
gb|KJB43897.1|  hypothetical protein B456_007G222400                  54.7    9e-06   Gossypium raimondii
ref|XP_003536583.1|  PREDICTED: BTB/POZ domain-containing protein...  54.7    1e-05   Glycine max [soybeans]
gb|KDP32062.1|  hypothetical protein JCGZ_12523                       54.3    1e-05   Jatropha curcas
ref|XP_004289798.1|  PREDICTED: BTB/POZ domain-containing protein...  54.3    1e-05   Fragaria vesca subsp. vesca
ref|XP_006579937.1|  PREDICTED: BTB/POZ domain-containing protein...  54.3    1e-05   Glycine max [soybeans]
ref|XP_008238083.1|  PREDICTED: BTB/POZ domain-containing protein...  53.9    1e-05   Prunus mume [ume]
ref|XP_007204979.1|  hypothetical protein PRUPE_ppa002844mg           53.9    2e-05   Prunus persica
gb|KHG12565.1|  BTB/POZ domain-containing NPY2 -like protein          53.9    2e-05   Gossypium arboreum [tree cotton]
ref|XP_007155836.1|  hypothetical protein PHAVU_003G235700g           52.0    6e-05   Phaseolus vulgaris [French bean]
ref|XP_002525260.1|  signal transducer, putative                      52.0    6e-05   
emb|CDP02592.1|  unnamed protein product                              52.0    7e-05   Coffea canephora [robusta coffee]
ref|XP_006579940.1|  PREDICTED: BTB/POZ domain-containing protein...  52.0    7e-05   Glycine max [soybeans]
ref|XP_010679621.1|  PREDICTED: BTB/POZ domain-containing protein...  51.6    9e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009776107.1|  PREDICTED: BTB/POZ domain-containing protein...  51.2    1e-04   Nicotiana sylvestris
ref|XP_009776109.1|  PREDICTED: BTB/POZ domain-containing protein...  51.2    1e-04   Nicotiana sylvestris
gb|KHN06014.1|  BTB/POZ domain-containing protein NPY2                51.2    1e-04   Glycine soja [wild soybean]
ref|XP_009629742.1|  PREDICTED: BTB/POZ domain-containing protein...  50.8    2e-04   Nicotiana tomentosiformis
ref|XP_009629746.1|  PREDICTED: BTB/POZ domain-containing protein...  50.8    2e-04   
ref|XP_006600918.1|  PREDICTED: BTB/POZ domain-containing protein...  50.8    2e-04   Glycine max [soybeans]
ref|XP_006600919.1|  PREDICTED: BTB/POZ domain-containing protein...  50.4    2e-04   Glycine max [soybeans]
gb|KHN23237.1|  BTB/POZ domain-containing protein NPY2                50.4    2e-04   Glycine soja [wild soybean]
ref|XP_004288238.1|  PREDICTED: BTB/POZ domain-containing protein...  49.3    5e-04   Fragaria vesca subsp. vesca
ref|XP_004496882.1|  PREDICTED: BTB/POZ domain-containing protein...  48.9    7e-04   
ref|XP_010065907.1|  PREDICTED: BTB/POZ domain-containing protein...  48.9    8e-04   



>ref|XP_009625190.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625197.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625203.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625209.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625213.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625220.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
Length=624

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 4/93 (4%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            AL+GELAALR+GN G  D+ANGD     + +D+ AA+S+MKGLL SKRIFSKIWS+KGG 
Sbjct  536  ALRGELAALRMGNGGTNDKANGDAK---SQADR-AAMSRMKGLLTSKRIFSKIWSNKGGQ  591

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GENSGSDSSESLGS  +EEAKSTPSRKGR+SVS
Sbjct  592  GENSGSDSSESLGSANLEEAKSTPSRKGRHSVS  624



>ref|XP_009764318.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
 ref|XP_009764381.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
 ref|XP_009764456.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
 ref|XP_009764516.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
Length=624

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 4/93 (4%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            AL+GELAALR+GN G  D+ NGD     + +D+AA +S+MKGLL+SKRIFSKIWS+KGG 
Sbjct  536  ALRGELAALRMGNGGTNDKVNGDAK---SHADRAA-MSRMKGLLMSKRIFSKIWSNKGGQ  591

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GENSGSDSSESLGS  +EEAKSTPSRKGR+SVS
Sbjct  592  GENSGSDSSESLGSANLEEAKSTPSRKGRHSVS  624



>ref|XP_009776135.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
Length=614

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 74/93 (80%), Gaps = 8/93 (9%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALK ELAAL+L N G+ D+ NGDT        K AA S+MKGLL SKRIFS+IWSSKGG 
Sbjct  530  ALKEELAALKLQNGGLIDKVNGDT--------KRAATSRMKGLLSSKRIFSRIWSSKGGQ  581

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GENSGSDSSESLGS ++EEAK TPSRKGR+SVS
Sbjct  582  GENSGSDSSESLGSASLEEAKYTPSRKGRHSVS  614



>ref|XP_009626485.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
Length=614

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 74/93 (80%), Gaps = 8/93 (9%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALK ELAAL+L N G+ D+ NGDT        K AA S+MKGLL SKRIFS+IWSSKGG 
Sbjct  530  ALKEELAALKLQNGGLIDKVNGDT--------KRAATSRMKGLLSSKRIFSRIWSSKGGQ  581

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GENSGSDSSESLGS ++EEAK TPSRKGR+SVS
Sbjct  582  GENSGSDSSESLGSASLEEAKYTPSRKGRHSVS  614



>ref|XP_006346315.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006346316.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006346317.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006346318.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X4 [Solanum tuberosum]
 ref|XP_006346319.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X5 [Solanum tuberosum]
 ref|XP_006346320.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X6 [Solanum tuberosum]
Length=626

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 64/94 (68%), Gaps = 4/94 (4%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWssk-gg  355
            AL+GELAALR+GN G  D+ N    K+ A     AA+SKMKGLL+SKR+FSKIWS+K G 
Sbjct  536  ALRGELAALRMGNGGTNDKVNVIDAKSHADR---AAMSKMKGLLMSKRLFSKIWSNKGGQ  592

Query  354  ngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
               +    S     +  +EEAKSTPSRKGR+SVS
Sbjct  593  GENSGSDSSESLGSANNLEEAKSTPSRKGRHSVS  626



>emb|CDO97269.1| unnamed protein product [Coffea canephora]
Length=622

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELAALRLGN  +++R  GD+    + ++  AAISKM+ LL+SK+IFSKIWSSKGG 
Sbjct  532  ALKGELAALRLGNGSISERNGGDSR---SHNNDRAAISKMRSLLMSKKIFSKIWSSKGGG  588

Query  351  gensgsdsseslgST-TMEEAKSTPSRKGRYSVS  253
               +    S     +  +EEAKSTPSR+GR+SVS
Sbjct  589  QGENSGSDSSESLGSANLEEAKSTPSRRGRHSVS  622



>ref|XP_011088062.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Sesamum indicum]
Length=624

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 4/93 (4%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            AL+GELAALRLG+  + DR  G+    +++SD+AA ISKMKGL++SKRIFSKIW S  G 
Sbjct  536  ALRGELAALRLGHVAVHDRNGGENR--ISNSDRAA-ISKMKGLIMSKRIFSKIW-SSKGG  591

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
               + SDSSESLGS   +E KSTP+R+GR+SVS
Sbjct  592  QAENSSDSSESLGSINHDEVKSTPTRRGRHSVS  624



>ref|XP_004230705.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315185.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315186.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315187.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315188.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315189.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
Length=626

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 63/94 (67%), Gaps = 4/94 (4%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWssk-gg  355
            AL+GELAALR+GN G  D+ N    K+ A     AA+SKMKGLL+SKR+FSKIWS+K G 
Sbjct  536  ALRGELAALRMGNGGTNDKVNVIDAKSHADR---AAMSKMKGLLMSKRLFSKIWSNKGGQ  592

Query  354  ngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
               +    S     +  +EEAKSTPSRK R+SVS
Sbjct  593  GENSGSDSSESLGSANNLEEAKSTPSRKVRHSVS  626



>gb|EYU37575.1| hypothetical protein MIMGU_mgv1a002858mg [Erythranthe guttata]
Length=630

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 74/93 (80%), Gaps = 5/93 (5%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            AL+GELAALRLGN    +   G  +++  +S++ AA+SKMKGL++S+RIFSKIWS+K   
Sbjct  543  ALRGELAALRLGN----EVVGGGESRS-GNSERGAAVSKMKGLIMSRRIFSKIWSNKAPA  597

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             ENSGSDSSESLGST  +EAK TP+R+GR+SVS
Sbjct  598  VENSGSDSSESLGSTNQDEAKCTPTRRGRHSVS  630



>ref|XP_002264153.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Vitis vinifera]
 ref|XP_010647924.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Vitis vinifera]
 ref|XP_010647925.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Vitis vinifera]
Length=626

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 5/94 (5%)
 Frame = -2

Query  531  ALKGELAALRLGN-AGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskgg  355
            ALKGELA+LRLGN  G ++R  GD+  ++   DKAA I+KMKGLL+SK+IF+K+WSSK G
Sbjct  537  ALKGELASLRLGNGVGASERNGGDSKGSI---DKAA-INKMKGLLMSKKIFTKLWSSKSG  592

Query  354  ngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             GENSGSDSS S GS   EEAKSTPSR  R+SVS
Sbjct  593  QGENSGSDSSGSSGSANPEEAKSTPSRNRRHSVS  626



>gb|KHG02234.1| BTB/POZ domain-containing NPY2 -like protein [Gossypium arboreum]
Length=624

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 74/94 (79%), Gaps = 5/94 (5%)
 Frame = -2

Query  531  ALKGELAALRLGNA-GMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskgg  355
            ALKGE+AALR+ N+ G ++R  GD+  +V   DK A ISKMKGLL SKRIFSKIWSSKG 
Sbjct  535  ALKGEIAALRMSNSIGGSERNGGDSRNSV---DKVA-ISKMKGLLKSKRIFSKIWSSKGA  590

Query  354  ngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             GENSGSDSSESLGS   EEAKSTPSR  R+SVS
Sbjct  591  QGENSGSDSSESLGSANPEEAKSTPSRNRRHSVS  624



>gb|KJB79441.1| hypothetical protein B456_013G050000 [Gossypium raimondii]
 gb|KJB79442.1| hypothetical protein B456_013G050000 [Gossypium raimondii]
 gb|KJB79443.1| hypothetical protein B456_013G050000 [Gossypium raimondii]
Length=624

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = -2

Query  531  ALKGELAALRLGNA-GMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskgg  355
            ALKGE+AALR+ N  G ++R  GD+  +V   DK A ISKMKGLL SKRIFSKIWSSKG 
Sbjct  535  ALKGEIAALRMSNGIGGSERNGGDSRNSV---DKVA-ISKMKGLLKSKRIFSKIWSSKGA  590

Query  354  ngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             GENSGSDSSESLGS   EEAKSTPSR  R+SVS
Sbjct  591  QGENSGSDSSESLGSANPEEAKSTPSRNRRHSVS  624



>emb|CAN66911.1| hypothetical protein VITISV_035422 [Vitis vinifera]
Length=621

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = -2

Query  531  ALKGELAALRLGN-AGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskgg  355
            ALKGELA+LRLGN  G ++R  GD+  ++   DKAA I+KMKGLL+SK+ F+K+WSSK G
Sbjct  532  ALKGELASLRLGNGVGASERNGGDSKGSI---DKAA-INKMKGLLMSKKXFTKLWSSKSG  587

Query  354  ngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             GENSGSDSS S GS   EEAKSTPSR  R+SVS
Sbjct  588  QGENSGSDSSGSSGSANPEEAKSTPSRNRRHSVS  621



>ref|XP_004511848.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Cicer 
arietinum]
Length=627

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 68/93 (73%), Gaps = 1/93 (1%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
             LKGELAAL+L + G +DR +     +  +++K AA +KMKG L+SK+IFSKIWS+K  N
Sbjct  536  VLKGELAALKLSSGGSSDRNSNSNDGSKGNAEKVAA-NKMKGFLMSKKIFSKIWSNKEKN  594

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GE + SD+SES  ST +EE KSTPSR  R+SVS
Sbjct  595  GEITSSDTSESPASTVVEETKSTPSRSRRHSVS  627



>ref|XP_007042621.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 ref|XP_007042622.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 gb|EOX98452.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 gb|EOX98453.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
Length=624

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = -2

Query  531  ALKGELAALRLGN-AGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskgg  355
            ALKGELAALRL N  G ++R   D   +V   DKAA ISKMKGLL SKRIF+KIWSSKG 
Sbjct  535  ALKGELAALRLSNGVGGSERNGVDGRNSV---DKAA-ISKMKGLLKSKRIFTKIWSSKGA  590

Query  354  ngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             GENSGSDSSESLGS   EEAKSTPSR  R+SVS
Sbjct  591  QGENSGSDSSESLGSANPEEAKSTPSRNRRHSVS  624



>ref|XP_007042620.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX98451.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
Length=640

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = -2

Query  531  ALKGELAALRLGN-AGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskgg  355
            ALKGELAALRL N  G ++R   D   +V   DKAA ISKMKGLL SKRIF+KIWSSKG 
Sbjct  551  ALKGELAALRLSNGVGGSERNGVDGRNSV---DKAA-ISKMKGLLKSKRIFTKIWSSKGA  606

Query  354  ngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             GENSGSDSSESLGS   EEAKSTPSR  R+SVS
Sbjct  607  QGENSGSDSSESLGSANPEEAKSTPSRNRRHSVS  640



>gb|KJB32266.1| hypothetical protein B456_005G232400 [Gossypium raimondii]
Length=619

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 66/93 (71%), Gaps = 10/93 (11%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALK ELAALRL       R  GD    V   D AAAISKMKGL+ SKRIF+KIWSSK   
Sbjct  537  ALKPELAALRL-------RNRGDNRNNV---DNAAAISKMKGLMKSKRIFTKIWSSKAAI  586

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GENSGSDSSESLGS   EEAKSTPSR  R+SVS
Sbjct  587  GENSGSDSSESLGSANPEEAKSTPSRNRRHSVS  619



>ref|XP_006353967.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Solanum 
tuberosum]
Length=610

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 60/93 (65%), Gaps = 12/93 (13%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALK ELAALRL N G+    NGDT + V   DKAA   +MK +L SK+IF+KIWSSKG  
Sbjct  530  ALKEELAALRLANGGL----NGDTKRHV---DKAAN-GRMKSILSSKKIFTKIWSSKGRK  581

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
               +    S      ++EEAK TPSRKGRYSVS
Sbjct  582  QGENSGSDSS----DSLEEAKYTPSRKGRYSVS  610



>gb|KHF97345.1| BTB/POZ domain-containing NPY5 -like protein [Gossypium arboreum]
Length=549

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 66/93 (71%), Gaps = 10/93 (11%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALK ELAALRL       R  GD    V   D AAAISKMKGL+ SKRIF+KIWSSK   
Sbjct  467  ALKTELAALRL-------RNRGDIRNNV---DNAAAISKMKGLMKSKRIFTKIWSSKAAI  516

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GENSGSDSSESLGS   EEAKSTPSR  R+SVS
Sbjct  517  GENSGSDSSESLGSANPEEAKSTPSRNRRHSVS  549



>gb|KJB32267.1| hypothetical protein B456_005G232400 [Gossypium raimondii]
Length=680

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 66/93 (71%), Gaps = 10/93 (11%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALK ELAALRL       R  GD    V   D AAAISKMKGL+ SKRIF+KIWSSK   
Sbjct  598  ALKPELAALRL-------RNRGDNRNNV---DNAAAISKMKGLMKSKRIFTKIWSSKAAI  647

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GENSGSDSSESLGS   EEAKSTPSR  R+SVS
Sbjct  648  GENSGSDSSESLGSANPEEAKSTPSRNRRHSVS  680



>ref|XP_010099608.1| BTB/POZ domain-containing protein NPY2 [Morus notabilis]
 gb|EXB80039.1| BTB/POZ domain-containing protein NPY2 [Morus notabilis]
Length=627

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 74/94 (79%), Gaps = 4/94 (4%)
 Frame = -2

Query  531  ALKGELAALRLGN-AGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskgg  355
            AL+GELA+LRL N  G ++R  GD  K+    DKAA ISKM+GLL SK+IF+K+WSSKGG
Sbjct  537  ALRGELASLRLSNGVGGSERNGGDGAKS--GVDKAA-ISKMRGLLKSKKIFTKLWSSKGG  593

Query  354  ngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             GENSGSDSSESLGS   EEAKSTPSR  R+SVS
Sbjct  594  QGENSGSDSSESLGSLNPEEAKSTPSRNRRHSVS  627



>ref|XP_004248766.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Solanum 
lycopersicum]
Length=611

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 60/93 (65%), Gaps = 11/93 (12%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALK ELAALRL N G+    NGDT + V   DKA    +MK +L SK+IF+KIWSSKG  
Sbjct  530  ALKEELAALRLANGGL----NGDTKRHV---DKATN-GRMKSILSSKKIFTKIWSSKGRR  581

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             +   S S       ++EEAK TPSRKGRYSVS
Sbjct  582  KQGENSGSDSP---DSLEEAKYTPSRKGRYSVS  611



>ref|XP_002284345.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Vitis vinifera]
 ref|XP_010652712.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Vitis vinifera]
 ref|XP_010652713.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Vitis vinifera]
 ref|XP_010652714.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Vitis vinifera]
 ref|XP_010652715.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Vitis vinifera]
 ref|XP_010652716.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Vitis vinifera]
Length=629

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 66/95 (69%), Gaps = 2/95 (2%)
 Frame = -2

Query  531  ALKGELAALRLGNA--GMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskg  358
            ALKGELA LRLG    G +DR+  +      S+ +  A SK+KGLL+SK+IFS++WSSK 
Sbjct  535  ALKGELATLRLGAGVGGGSDRSGNELNDGPKSNAENVAASKVKGLLMSKKIFSRLWSSKE  594

Query  357  gngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
              GENS SD+SES GS   EE KSTPSR  R+SVS
Sbjct  595  KLGENSSSDTSESPGSANAEETKSTPSRSRRHSVS  629



>ref|XP_009347119.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Pyrus 
x bretschneideri]
Length=626

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 74/95 (78%), Gaps = 7/95 (7%)
 Frame = -2

Query  531  ALKGELAALRLGN-AGMADRANGDTTKTVASSDKAAAISKMKGLLVSKR-IFSKIWsskg  358
            ALKGELA+LRL +  G+ DR NGD   +V   DKAA +SKM+GLL SK+ IF+K+WSSKG
Sbjct  537  ALKGELASLRLSSGVGLCDR-NGDGKGSV---DKAA-VSKMRGLLKSKKKIFAKLWSSKG  591

Query  357  gngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
              GENSGSDSSESLGS   EEAKSTPSR  R+SVS
Sbjct  592  VQGENSGSDSSESLGSGNPEEAKSTPSRNRRHSVS  626



>ref|XP_008440372.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440373.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440374.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440375.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440376.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440377.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440378.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440379.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440380.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
Length=626

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 68/93 (73%), Gaps = 6/93 (6%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELAAL+LGN    DR   D  K   +++K +  +KMKG+L+SK+IFSK+WS+K  N
Sbjct  540  ALKGELAALKLGNG---DRNGSDIAKN--NAEKVSG-NKMKGMLISKKIFSKLWSNKDRN  593

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GE S S++SES GS+  EE KSTPSR  R+S+S
Sbjct  594  GEISSSETSESPGSSNAEETKSTPSRSLRHSIS  626



>ref|XP_004156852.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
NPY2-like [Cucumis sativus]
Length=626

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 60/94 (64%), Gaps = 5/94 (5%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELA+LRL N   +   NGD    +   DKAA +SKMKGLL SK++F+K+WSSKGG 
Sbjct  537  ALKGELASLRLANGRGSSERNGDGKNGI---DKAA-LSKMKGLLKSKKLFTKLWSSKGGG  592

Query  351  gensgsdsseslgST-TMEEAKSTPSRKGRYSVS  253
               +    S     +   EEAKSTPSR  R+SVS
Sbjct  593  YGENSGSDSSESLGSANQEEAKSTPSRNRRHSVS  626



>ref|XP_004152268.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Cucumis 
sativus]
 gb|KGN52773.1| hypothetical protein Csa_4G000910 [Cucumis sativus]
Length=626

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 60/94 (64%), Gaps = 5/94 (5%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELA+LRL N   +   NGD    +   DKAA +SKMKGLL SK++F+K+WSSKGG 
Sbjct  537  ALKGELASLRLANGRGSSERNGDGKNGI---DKAA-LSKMKGLLKSKKLFTKLWSSKGGG  592

Query  351  gensgsdsseslgST-TMEEAKSTPSRKGRYSVS  253
               +    S     +   EEAKSTPSR  R+SVS
Sbjct  593  YGENSGSDSSESLGSANQEEAKSTPSRNRRHSVS  626



>ref|XP_008454387.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Cucumis melo]
 ref|XP_008454388.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Cucumis melo]
Length=623

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 60/94 (64%), Gaps = 5/94 (5%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELA+LRL N   +   NGD    +   DKAA +SKMKGLL SK++F+K+WSSKGG 
Sbjct  534  ALKGELASLRLANGRGSSERNGDGKNGI---DKAA-LSKMKGLLKSKKLFTKLWSSKGGG  589

Query  351  gensgsdsseslgST-TMEEAKSTPSRKGRYSVS  253
               +    S     +   EEAKSTPSR  R+SVS
Sbjct  590  YGENSGSDSSESLGSANQEEAKSTPSRNRRHSVS  623



>ref|XP_010272331.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nelumbo 
nucifera]
 ref|XP_010272334.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nelumbo 
nucifera]
Length=629

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 69/94 (73%), Gaps = 6/94 (6%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELA+LRLG  G A   N D     ++ DKAAA SK+KGLL+SK+IF+K+ SSKGG 
Sbjct  541  ALKGELASLRLGGRGSARNGNDDK----STIDKAAA-SKVKGLLMSKKIFTKLLSSKGGQ  595

Query  351  gensgsdsseslgST-TMEEAKSTPSRKGRYSVS  253
             ENS SD+S+S  ST  ME+ KSTPSR  R+SVS
Sbjct  596  SENSSSDTSDSPNSTNNMEDTKSTPSRNRRHSVS  629



>ref|XP_011092513.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Sesamum indicum]
Length=623

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 70/92 (76%), Gaps = 6/92 (7%)
 Frame = -2

Query  528  LKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggng  349
            L+GELAA RLGN+   DR++ +    ++++DK A I KMKGL++SK++ SKIWS+K G  
Sbjct  538  LRGELAAFRLGNS---DRSSAENR--MSNADKTA-IGKMKGLIMSKKMLSKIWSNKVGQA  591

Query  348  ensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            ENSGSDSS+SLGST  ++ K TP RKGR SVS
Sbjct  592  ENSGSDSSDSLGSTNQDDVKCTPPRKGRNSVS  623



>ref|XP_011092512.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Sesamum indicum]
Length=624

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 70/92 (76%), Gaps = 6/92 (7%)
 Frame = -2

Query  528  LKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggng  349
            L+GELAA RLGN+   DR++ +    ++++DK A I KMKGL++SK++ SKIWS+K G  
Sbjct  539  LRGELAAFRLGNS---DRSSAENR--MSNADKTA-IGKMKGLIMSKKMLSKIWSNKVGQA  592

Query  348  ensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            ENSGSDSS+SLGST  ++ K TP RKGR SVS
Sbjct  593  ENSGSDSSDSLGSTNQDDVKCTPPRKGRNSVS  624



>ref|XP_003611607.1| BTB/POZ domain-containing protein [Medicago truncatula]
 gb|AES94565.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=630

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = -2

Query  531  ALKGELAALRLGNAGM--ADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskg  358
             LKGELAAL+L + G   +DR + +       + +  A +KMKG L+SK++FSK+WSSK 
Sbjct  536  VLKGELAALKLSSGGSQSSDRNSNNNDGGGIGNAEKVAANKMKGFLMSKKLFSKLWSSKE  595

Query  357  gngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             NGE + SD+SES  ST +EE KSTPSR  R+SVS
Sbjct  596  KNGEITSSDTSESPASTVVEETKSTPSRSRRHSVS  630



>ref|XP_008366255.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Malus domestica]
Length=626

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 73/95 (77%), Gaps = 7/95 (7%)
 Frame = -2

Query  531  ALKGELAALRLGN-AGMADRANGDTTKTVASSDKAAAISKMKGLLVSKR-IFSKIWsskg  358
            ALKGELA+LRL +  G  DR NGD   +V   DKAA +SKM+GLL SK+ IF+K+WSSKG
Sbjct  537  ALKGELASLRLSSGVGSCDR-NGDGKGSV---DKAA-VSKMRGLLKSKKKIFAKLWSSKG  591

Query  357  gngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
              GENSGSDSSESLGS   EEAKSTPSR  R+SVS
Sbjct  592  VQGENSGSDSSESLGSGNPEEAKSTPSRNRRHSVS  626



>ref|XP_006486926.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006486927.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Citrus sinensis]
 ref|XP_006486928.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Citrus sinensis]
Length=619

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 68/93 (73%), Gaps = 9/93 (10%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELAALRL N       NG        SDKAA I+KMKGLL SK+IF+K+++SKGG 
Sbjct  536  ALKGELAALRLSNGVGGSERNG--------SDKAA-ITKMKGLLKSKKIFAKLFTSKGGQ  586

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GENSGSDSSES+GS  +EE KSTPSR  R SVS
Sbjct  587  GENSGSDSSESVGSAVLEETKSTPSRNRRNSVS  619



>gb|KDO57872.1| hypothetical protein CISIN_1g007080mg [Citrus sinensis]
Length=619

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 68/93 (73%), Gaps = 9/93 (10%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELAALRL N       NG        SDKAA I+KMKGLL SK+IF+K+++SKGG 
Sbjct  536  ALKGELAALRLSNGVGGSERNG--------SDKAA-ITKMKGLLKSKKIFAKLFTSKGGQ  586

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GENSGSDSSES+GS  +EE KSTPSR  R SVS
Sbjct  587  GENSGSDSSESVGSAVLEETKSTPSRNRRNSVS  619



>ref|XP_004141870.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Cucumis 
sativus]
 ref|XP_004166812.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Cucumis 
sativus]
 gb|KGN48602.1| hypothetical protein Csa_6G495070 [Cucumis sativus]
Length=626

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 68/93 (73%), Gaps = 6/93 (6%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELAAL+LG+    DR   D  +   +++K +  +KMKG+L+SK+IFSK+WS+K  N
Sbjct  540  ALKGELAALKLGSG---DRNGSDIARN--NAEKVSG-NKMKGMLISKKIFSKLWSNKDRN  593

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GE S S++SES GS+  EE KSTPSR  R+S+S
Sbjct  594  GEISSSETSESPGSSNAEETKSTPSRSQRHSIS  626



>ref|XP_006422840.1| hypothetical protein CICLE_v10028033mg [Citrus clementina]
 gb|ESR36080.1| hypothetical protein CICLE_v10028033mg [Citrus clementina]
Length=619

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 68/93 (73%), Gaps = 9/93 (10%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELAALRL N       NG        SDKAA I+KMKGLL SK+IF+K+++SKGG 
Sbjct  536  ALKGELAALRLSNGVGGSERNG--------SDKAA-ITKMKGLLKSKKIFAKLFTSKGGQ  586

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GENSGSDSSESLGS  +EE KSTPSR  R SVS
Sbjct  587  GENSGSDSSESLGSAILEETKSTPSRNRRNSVS  619



>ref|XP_008236444.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Prunus 
mume]
Length=626

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 70/94 (74%), Gaps = 5/94 (5%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKR-IFSKIWsskgg  355
            ALKGELA+LRL +       NGD   +V   DKAA +SKM+GLL SK+ +F+K+WSSKG 
Sbjct  537  ALKGELASLRLSSGVGGSEKNGDGKGSV---DKAA-VSKMRGLLKSKKKVFAKLWSSKGV  592

Query  354  ngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             GENSGSDSSESLGS   EEAKSTPSR  R+SVS
Sbjct  593  QGENSGSDSSESLGSANPEEAKSTPSRNRRHSVS  626



>ref|XP_007201732.1| hypothetical protein PRUPE_ppa002913mg [Prunus persica]
 gb|EMJ02931.1| hypothetical protein PRUPE_ppa002913mg [Prunus persica]
Length=622

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 70/94 (74%), Gaps = 5/94 (5%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKR-IFSKIWsskgg  355
            ALKGELA+LRL +       NGD   +V   DKAA +SKM+GLL SK+ +F+K+WSSKG 
Sbjct  533  ALKGELASLRLSSGVGGGEKNGDGKGSV---DKAA-VSKMRGLLKSKKKVFAKLWSSKGV  588

Query  354  ngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             GENSGSDSSESLGS   EEAKSTPSR  R+SVS
Sbjct  589  QGENSGSDSSESLGSANPEEAKSTPSRNRRHSVS  622



>gb|EPS65621.1| hypothetical protein M569_09155 [Genlisea aurea]
Length=591

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 54/93 (58%), Gaps = 16/93 (17%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            AL+GELAALRL N G+AD+A                  K KGL++SKRI SKIW S    
Sbjct  515  ALRGELAALRLSNNGVADKATA---------------GKAKGLVLSKRILSKIW-SSSKG  558

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            G+    ++      +  E+AK+TP+R+GR+SVS
Sbjct  559  GQQQNENTGSDSSGSVGEDAKTTPARRGRHSVS  591



>ref|XP_008346361.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Malus 
domestica]
 ref|XP_008346362.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Malus 
domestica]
Length=626

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVS-KRIFSKIWsskgg  355
            ALKGELA+LRL ++  A   NGD   +V   DK AA+SKM+GLL S K+IF+K+WSSKG 
Sbjct  537  ALKGELASLRLSSSVGACNRNGDXKSSV---DK-AAVSKMRGLLKSKKKIFAKLWSSKGV  592

Query  354  ngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             GENSGSDSSESLGS   EEAKST SR  R+SVS
Sbjct  593  QGENSGSDSSESLGSANPEEAKSTHSRNRRHSVS  626



>ref|XP_010277066.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Nelumbo nucifera]
 ref|XP_010277067.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Nelumbo nucifera]
Length=630

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 70/94 (74%), Gaps = 4/94 (4%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELA+LRL   G     +G+  K+    DKAAA +K++GLL+SK+IF+K+WSSKGG 
Sbjct  540  ALKGELASLRLEGGGRGSNRHGNDDKSTI--DKAAA-NKIRGLLMSKKIFTKLWSSKGGQ  596

Query  351  gensgsdsseslgST-TMEEAKSTPSRKGRYSVS  253
             ENS SD+S+SLGST   E+ KSTPSR  R+SVS
Sbjct  597  SENSSSDTSDSLGSTNNPEDTKSTPSRSRRHSVS  630



>ref|XP_007047503.1| Phototropic-responsive NPH3 family protein isoform 4 [Theobroma 
cacao]
 ref|XP_007047504.1| Phototropic-responsive NPH3 family protein isoform 4 [Theobroma 
cacao]
 gb|EOX91660.1| Phototropic-responsive NPH3 family protein isoform 4 [Theobroma 
cacao]
 gb|EOX91661.1| Phototropic-responsive NPH3 family protein isoform 4 [Theobroma 
cacao]
Length=532

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 67/93 (72%), Gaps = 5/93 (5%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGEL  LRLG++G  DR   D  K+ A  +K AA ++MKGL++SK IFSK+WSSK  +
Sbjct  445  ALKGELVTLRLGSSG-TDRNGNDAAKSDA--EKIAA-NRMKGLVMSK-IFSKLWSSKERH  499

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GE S SD+SES GS   EE KSTPSR  R+S+S
Sbjct  500  GEISSSDTSESPGSVNAEETKSTPSRSRRHSLS  532



>ref|XP_009335385.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Pyrus 
x bretschneideri]
 ref|XP_009335386.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Pyrus 
x bretschneideri]
Length=617

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 7/93 (8%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            AL+GELA+LRL ++G+    +G +     S DKAA ++KM+GLL SK+IF+K+WSSKG  
Sbjct  532  ALRGELASLRL-SSGVGACKDGKS-----SVDKAA-VNKMRGLLKSKKIFAKLWSSKGVQ  584

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GENSGSDSSESLGS   EEAKSTPSR  R+SVS
Sbjct  585  GENSGSDSSESLGSANPEEAKSTPSRNRRHSVS  617



>ref|XP_007047500.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007047501.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007047502.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91657.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91658.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91659.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
Length=622

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 67/93 (72%), Gaps = 5/93 (5%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGEL  LRLG++G  DR   D  K+ A  +K AA ++MKGL++SK IFSK+WSSK  +
Sbjct  535  ALKGELVTLRLGSSG-TDRNGNDAAKSDA--EKIAA-NRMKGLVMSK-IFSKLWSSKERH  589

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GE S SD+SES GS   EE KSTPSR  R+S+S
Sbjct  590  GEISSSDTSESPGSVNAEETKSTPSRSRRHSLS  622



>emb|CBI22467.3| unnamed protein product [Vitis vinifera]
Length=526

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 44/55 (80%), Gaps = 5/55 (9%)
 Frame = -2

Query  531  ALKGELAALRLGN-AGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  370
            ALKGELA+LRLGN  G ++R  GD+  ++   DKAA I+KMKGLL+SK+IF+K+W
Sbjct  439  ALKGELASLRLGNGVGASERNGGDSKGSI---DKAA-INKMKGLLMSKKIFTKLW  489



>ref|XP_007143108.1| hypothetical protein PHAVU_007G044300g [Phaseolus vulgaris]
 gb|ESW15102.1| hypothetical protein PHAVU_007G044300g [Phaseolus vulgaris]
Length=624

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 65/93 (70%), Gaps = 4/93 (4%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            AL+ ELA+LRL N    +  +GD      S DKA  I KMKGLL SKR F K+W+SKGG 
Sbjct  536  ALRKELASLRLSNGVGNNDKDGDIK---PSMDKAV-IGKMKGLLKSKRSFIKLWASKGGQ  591

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GENSGSDSSES+ S   EEAKSTPSR  R+SVS
Sbjct  592  GENSGSDSSESISSANPEEAKSTPSRNRRHSVS  624



>ref|XP_002306504.2| hypothetical protein POPTR_0005s19010g [Populus trichocarpa]
 gb|EEE93500.2| hypothetical protein POPTR_0005s19010g [Populus trichocarpa]
Length=626

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 60/93 (65%), Gaps = 8/93 (9%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELAALRLG +G +DR   D  K  A  +K AA  K+KGL++SK IFSK+W      
Sbjct  537  ALKGELAALRLGGSG-SDRNLNDGAKNDA--EKVAA-GKLKGLVMSK-IFSKLW---SNK  588

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
              N    SS++ GS T EE KSTPSR  R+SVS
Sbjct  589  ERNGEISSSDTSGSATAEETKSTPSRSRRHSVS  621



>emb|CBI33702.3| unnamed protein product [Vitis vinifera]
Length=586

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 62/93 (67%), Gaps = 15/93 (16%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELA LRLG AG              S+ +  A SK+KGLL+SK+IFS++WSSK   
Sbjct  509  ALKGELATLRLG-AG--------------SNAENVAASKVKGLLMSKKIFSRLWSSKEKL  553

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GENS SD+SES GS   EE KSTPSR  R+SVS
Sbjct  554  GENSSSDTSESPGSANAEETKSTPSRSRRHSVS  586



>gb|KHN42319.1| BTB/POZ domain-containing protein NPY2 [Glycine soja]
Length=623

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 66/93 (71%), Gaps = 4/93 (4%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            AL+ ELA+LRL N    +  +GD      S DKA  +SK+KGLL SK+ F KIW+SKGG 
Sbjct  535  ALRKELASLRLSNGVGNNDKDGDNK---PSMDKAV-MSKVKGLLKSKKSFIKIWASKGGQ  590

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GENSGSDSSES+ S   EEAKSTPSR  R+SVS
Sbjct  591  GENSGSDSSESMSSANPEEAKSTPSRNRRHSVS  623



>ref|XP_003555987.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Glycine max]
 ref|XP_006605997.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Glycine max]
Length=623

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 66/93 (71%), Gaps = 4/93 (4%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            AL+ ELA+LRL N    +  +GD      S DKA  +SK+KGLL SK+ F KIW+SKGG 
Sbjct  535  ALRKELASLRLSNGVGNNDKDGDNK---PSMDKAV-MSKVKGLLKSKKSFIKIWASKGGQ  590

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GENSGSDSSES+ S   EEAKSTPSR  R+SVS
Sbjct  591  GENSGSDSSESMSSANPEEAKSTPSRNRRHSVS  623



>ref|XP_002300262.2| hypothetical protein POPTR_0001s30270g [Populus trichocarpa]
 gb|EEE85067.2| hypothetical protein POPTR_0001s30270g [Populus trichocarpa]
Length=599

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 65/93 (70%), Gaps = 14/93 (15%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALK E+A+LRL N       NG         DKAA+ +K+KG+L SK+IF+K+WS+KG  
Sbjct  521  ALKEEVASLRLANG-----RNG--------VDKAAS-NKLKGMLKSKKIFTKLWSNKGEK  566

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GE SGSDSSES GS  MEEAKSTPSR  R+SVS
Sbjct  567  GEKSGSDSSESTGSANMEEAKSTPSRNRRHSVS  599



>ref|XP_011030353.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Populus 
euphratica]
 ref|XP_011030354.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Populus 
euphratica]
 ref|XP_011030355.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Populus 
euphratica]
 ref|XP_011030356.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Populus 
euphratica]
Length=614

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 65/93 (70%), Gaps = 14/93 (15%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALK E+A+LRL N       NG         DKAA+ +K+KG+L SK+IF+K+WSS+G  
Sbjct  536  ALKEEVASLRLANG-----RNG--------VDKAAS-NKLKGMLKSKKIFTKLWSSRGEK  581

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GE SGSDSSES GS  MEEAKSTPSR  R+SVS
Sbjct  582  GEKSGSDSSESTGSANMEEAKSTPSRNRRHSVS  614



>gb|KHN23238.1| BTB/POZ domain-containing protein NPY2 [Glycine soja]
Length=629

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 69/96 (72%), Gaps = 7/96 (7%)
 Frame = -2

Query  531  ALKGELAALRL--GNAGMADRA-NGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWssk  361
            +LKGEL AL+L  G +G + R+ N D  K   +++K AA SKMKGL+ SK+I SKIWSSK
Sbjct  538  SLKGELDALKLSGGTSGASSRSDNNDGGKD--NAEKVAA-SKMKGLM-SKKIISKIWSSK  593

Query  360  ggngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
              +GE S SD+SES  ST +EE KSTPSR  R+S+S
Sbjct  594  ERSGELSSSDTSESPASTVVEETKSTPSRSRRHSLS  629



>ref|XP_003550011.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Glycine max]
 ref|XP_006600917.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Glycine max]
Length=629

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 69/96 (72%), Gaps = 7/96 (7%)
 Frame = -2

Query  531  ALKGELAALRL--GNAGMADRA-NGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWssk  361
            +LKGEL AL+L  G +G + R+ N D  K   +++K AA SKMKGL+ SK+I SKIWSSK
Sbjct  538  SLKGELDALKLSGGTSGASSRSDNNDGGKD--NAEKVAA-SKMKGLM-SKKIISKIWSSK  593

Query  360  ggngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
              +GE S SD+SES  ST +EE KSTPSR  R+S+S
Sbjct  594  ERSGELSSSDTSESPASTVVEETKSTPSRSRRHSLS  629



>ref|XP_011011590.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Populus 
euphratica]
Length=623

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 59/93 (63%), Gaps = 11/93 (12%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELAALRLG +G +DR   D  K    +D AA   K+KGL++SK IFSK+W      
Sbjct  537  ALKGELAALRLGGSG-SDRNLNDGAK----NDVAAG--KLKGLVMSK-IFSKLW---SNK  585

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
              N    SS+S GS T EE KSTPSR  R+SVS
Sbjct  586  ERNGEISSSDSSGSATAEETKSTPSRSRRHSVS  618



>ref|XP_010086948.1| BTB/POZ domain-containing protein NPY2 [Morus notabilis]
 gb|EXB25084.1| BTB/POZ domain-containing protein NPY2 [Morus notabilis]
Length=630

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKG+LA LRLG   +   +N        S+ + AA +K KGL++SKR+FSK+WSSK  +
Sbjct  538  ALKGKLATLRLGGGDVGVGSNRSGIDGAKSNAERAAANK-KGLIMSKRLFSKLWSSKERS  596

Query  351  gensgsdsseslgSTTMEEAKSTPS-RKGRYSVS  253
            GENS S++SES GST  EE KSTPS R GR+SVS
Sbjct  597  GENSSSETSESPGSTNAEETKSTPSARSGRHSVS  630



>gb|KJB43895.1| hypothetical protein B456_007G222400 [Gossypium raimondii]
 gb|KJB43896.1| hypothetical protein B456_007G222400 [Gossypium raimondii]
 gb|KJB43900.1| hypothetical protein B456_007G222400 [Gossypium raimondii]
Length=619

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 63/94 (67%), Gaps = 10/94 (11%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSD-KAAAISKMKGLLVSKRIFSKIWsskgg  355
            ALKGELA LRLG        + D+    A SD +  A S+MKGL++SK IFSK+WSSK  
Sbjct  535  ALKGELATLRLG--------SNDSGNEAAKSDVEKVAASRMKGLVMSK-IFSKLWSSKER  585

Query  354  ngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            +GE S SD+S+S GS   EE KSTPSR  R+S+S
Sbjct  586  HGEISSSDTSDSHGSVNAEETKSTPSRSRRHSLS  619



>gb|KJB43899.1| hypothetical protein B456_007G222400 [Gossypium raimondii]
Length=623

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 63/94 (67%), Gaps = 10/94 (11%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSD-KAAAISKMKGLLVSKRIFSKIWsskgg  355
            ALKGELA LRLG        + D+    A SD +  A S+MKGL++SK IFSK+WSSK  
Sbjct  539  ALKGELATLRLG--------SNDSGNEAAKSDVEKVAASRMKGLVMSK-IFSKLWSSKER  589

Query  354  ngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            +GE S SD+S+S GS   EE KSTPSR  R+S+S
Sbjct  590  HGEISSSDTSDSHGSVNAEETKSTPSRSRRHSLS  623



>gb|KJB43897.1| hypothetical protein B456_007G222400 [Gossypium raimondii]
 gb|KJB43898.1| hypothetical protein B456_007G222400 [Gossypium raimondii]
Length=589

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 63/94 (67%), Gaps = 10/94 (11%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSD-KAAAISKMKGLLVSKRIFSKIWsskgg  355
            ALKGELA LRLG        + D+    A SD +  A S+MKGL++SK IFSK+WSSK  
Sbjct  505  ALKGELATLRLG--------SNDSGNEAAKSDVEKVAASRMKGLVMSK-IFSKLWSSKER  555

Query  354  ngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            +GE S SD+S+S GS   EE KSTPSR  R+S+S
Sbjct  556  HGEISSSDTSDSHGSVNAEETKSTPSRSRRHSLS  589



>ref|XP_003536583.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Glycine max]
 ref|XP_006589617.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Glycine max]
 ref|XP_006589618.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Glycine max]
 ref|XP_006589619.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X4 [Glycine max]
 gb|KHN06801.1| BTB/POZ domain-containing protein NPY2 [Glycine soja]
Length=624

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 66/93 (71%), Gaps = 4/93 (4%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            AL+ ELA+LRL N    +  +GDT     S DKA  + K+KGLL SK+ F K+W+SKGG 
Sbjct  536  ALRKELASLRLSNGVGNNDKDGDTK---PSMDKAV-MGKVKGLLKSKKSFIKLWASKGGQ  591

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GENSGSDSSES+ S   EEAKSTPSR  R+SVS
Sbjct  592  GENSGSDSSESMSSANPEEAKSTPSRNRRHSVS  624



>gb|KDP32062.1| hypothetical protein JCGZ_12523 [Jatropha curcas]
Length=623

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 65/93 (70%), Gaps = 7/93 (8%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELA L+LG    +DR   D  KT    +KAAA +K KG+++SK IFSK+WSSK  N
Sbjct  538  ALKGELATLQLGG---SDRNLNDNAKT--DPEKAAA-NKTKGVVMSK-IFSKLWSSKERN  590

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GE S SD+SES GS   EE KSTPSR  R+SVS
Sbjct  591  GEISSSDTSESPGSAAAEETKSTPSRSMRHSVS  623



>ref|XP_004289798.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011457862.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Fragaria vesca 
subsp. vesca]
Length=621

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 70/94 (74%), Gaps = 9/94 (10%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELA+LRL ++      NGD    V   DKAA +SKM+GLL SK++F+K++SSKGG 
Sbjct  536  ALKGELASLRLASS----ERNGDGKSNV---DKAA-VSKMRGLLNSKKVFAKLFSSKGGQ  587

Query  351  gensgsdsseslgSTTMEE-AKSTPSRKGRYSVS  253
            GENSGSDSS SLGS   EE AKSTPSR  R+SVS
Sbjct  588  GENSGSDSSGSLGSANPEEAAKSTPSRNRRHSVS  621



>ref|XP_006579937.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Glycine max]
 ref|XP_006579938.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Glycine max]
 ref|XP_006579939.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Glycine max]
 gb|KHN06013.1| BTB/POZ domain-containing protein NPY2 [Glycine soja]
Length=628

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 65/95 (68%), Gaps = 6/95 (6%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANG--DTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskg  358
            +LKGE+ AL+L  +G   RA+G  D      ++D  AA SKMKG  +SK+I SKIWSSK 
Sbjct  538  SLKGEVDALKL--SGGTGRASGRKDNNGDKGNADNVAA-SKMKGF-ISKKILSKIWSSKE  593

Query  357  gngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             +G+ S SD+SES  ST +EE KSTPSR  R+SVS
Sbjct  594  KSGDLSSSDTSESPASTVVEETKSTPSRSRRHSVS  628



>ref|XP_008238083.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Prunus 
mume]
Length=628

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 42/56 (75%), Gaps = 4/56 (7%)
 Frame = -2

Query  531  ALKGELAALRLGNA--GMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  370
            ALKGELA LRLG+A  G+ +  N +   T  +S+K AA SKMKGLL+SK+IFSK+W
Sbjct  534  ALKGELATLRLGDANRGVGNDRNANHGAT-NNSEKVAA-SKMKGLLMSKKIFSKLW  587



>ref|XP_007204979.1| hypothetical protein PRUPE_ppa002844mg [Prunus persica]
 gb|EMJ06178.1| hypothetical protein PRUPE_ppa002844mg [Prunus persica]
Length=628

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 42/56 (75%), Gaps = 4/56 (7%)
 Frame = -2

Query  531  ALKGELAALRLGNA--GMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  370
            ALKGELA LRLG+A  G+ +  N +   T  +S+K AA SKMKGLL+SK+IFSK+W
Sbjct  534  ALKGELATLRLGDANRGVGNDRNANHGAT-NNSEKVAA-SKMKGLLMSKKIFSKLW  587



>gb|KHG12565.1| BTB/POZ domain-containing NPY2 -like protein [Gossypium arboreum]
Length=619

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 62/93 (67%), Gaps = 8/93 (9%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELA LRLG+    + A     + VA+       S+MKGL++SK IFSK+WSSK  +
Sbjct  535  ALKGELATLRLGSNDSGNEAAKSEVEKVAA-------SRMKGLVMSK-IFSKLWSSKERH  586

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GE S SD+S+S GS   EE KSTPSR  R+S+S
Sbjct  587  GEISSSDTSDSHGSVNAEETKSTPSRSRRHSLS  619



>ref|XP_007155836.1| hypothetical protein PHAVU_003G235700g [Phaseolus vulgaris]
 ref|XP_007155837.1| hypothetical protein PHAVU_003G235700g [Phaseolus vulgaris]
 gb|ESW27830.1| hypothetical protein PHAVU_003G235700g [Phaseolus vulgaris]
 gb|ESW27831.1| hypothetical protein PHAVU_003G235700g [Phaseolus vulgaris]
Length=628

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            +LKGEL AL+L           +      +++  AA SKMKGL+ SK+I SKIWSSK  +
Sbjct  538  SLKGELDALKLSGGINGASGGNNNNCGKGNAENVAA-SKMKGLM-SKKIMSKIWSSKEKS  595

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GE + SD+SES  ST +EE KSTPSR  R+SVS
Sbjct  596  GELTSSDTSESPASTVVEETKSTPSRSRRHSVS  628



>ref|XP_002525260.1| signal transducer, putative [Ricinus communis]
 gb|EEF37088.1| signal transducer, putative [Ricinus communis]
Length=488

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 62/95 (65%), Gaps = 11/95 (12%)
 Frame = -2

Query  531  ALKGELAALRLG--NAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskg  358
            ALKGEL  LRLG  +    D A  D  K        AA +KM+GL++SK IFSK+WS+K 
Sbjct  403  ALKGELTTLRLGRSDTNANDGAKNDAEK--------AAANKMRGLVMSK-IFSKLWSNKE  453

Query  357  gngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             NGE S +D+SES GS + E+ KSTPSR  R+SVS
Sbjct  454  RNGEISSTDTSESPGSASAEDTKSTPSRSRRHSVS  488



>emb|CDP02592.1| unnamed protein product [Coffea canephora]
Length=623

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKG LA +RL      +  +G+ +     + +  A++K+KGL++SK+IFSK+WS+K  +
Sbjct  538  ALKGGLANIRLKE----ETEHGNDSNLAKINSEKVAMTKVKGLIMSKKIFSKLWSNKERD  593

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRY  262
             ENS SD+SES  S+T EE KSTPSR  R+
Sbjct  594  SENSSSDTSESPASSTAEETKSTPSRSRRH  623



>ref|XP_006579940.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Glycine max]
 ref|XP_006579941.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Glycine max]
Length=624

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 61/93 (66%), Gaps = 1/93 (1%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            +LKGEL AL+L        +  +   +   + ++ A SKMKG LVSK+I SKIWSSK  +
Sbjct  533  SLKGELIALKLSGGTRGASSRSNNNDSSKGNSESVAASKMKG-LVSKKIISKIWSSKERS  591

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GE S SD+SES  ST +EE KSTPSR  R+S+S
Sbjct  592  GELSSSDTSESPASTVVEETKSTPSRSRRHSLS  624



>ref|XP_010679621.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010679622.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Beta vulgaris 
subsp. vulgaris]
Length=625

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 62/91 (68%), Gaps = 7/91 (8%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGE+A LR+G         G +     S  + AA++K++GLL+SKR+FSK+WSSK  +
Sbjct  541  ALKGEIANLRVGGG------EGSSVDVPKSDAEKAAVNKVRGLLMSKRLFSKLWSSKEKD  594

Query  351  gensgsdsseslgST-TMEEAKSTPSRKGRY  262
            GENS SD+SES  ST   EE++STPSR  ++
Sbjct  595  GENSSSDTSESPASTNNAEESRSTPSRNRKH  625



>ref|XP_009776107.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009776108.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana sylvestris]
Length=627

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 62/93 (67%), Gaps = 3/93 (3%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELA LRL +    + +N    K +  S +  A  K KGL++SK+IFSK+WS+K   
Sbjct  538  ALKGELATLRLRDK---EGSNDSNLKDMKLSAEKVAGGKTKGLIMSKKIFSKLWSNKDRV  594

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             ENS SD+SES GS+   E+KSTPSR  R+S+S
Sbjct  595  SENSSSDTSESPGSSNAGESKSTPSRSRRHSLS  627



>ref|XP_009776109.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X2 [Nicotiana sylvestris]
Length=620

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 62/93 (67%), Gaps = 3/93 (3%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELA LRL +    + +N    K +  S +  A  K KGL++SK+IFSK+WS+K   
Sbjct  531  ALKGELATLRLRDK---EGSNDSNLKDMKLSAEKVAGGKTKGLIMSKKIFSKLWSNKDRV  587

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             ENS SD+SES GS+   E+KSTPSR  R+S+S
Sbjct  588  SENSSSDTSESPGSSNAGESKSTPSRSRRHSLS  620



>gb|KHN06014.1| BTB/POZ domain-containing protein NPY2 [Glycine soja]
Length=625

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 61/93 (66%), Gaps = 1/93 (1%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            +LKGEL AL+L        +  +   +   + ++ A SKMKG LVSK+I SKIWSSK  +
Sbjct  534  SLKGELIALKLSGGTRGASSRSNNNDSSKGNAESVAASKMKG-LVSKKIISKIWSSKERS  592

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GE S SD+SES  ST +EE KSTPSR  R+S+S
Sbjct  593  GELSSSDTSESPASTVVEETKSTPSRSRRHSLS  625



>ref|XP_009629742.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009629743.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009629744.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=627

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 62/93 (67%), Gaps = 3/93 (3%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELA LRL +    + +N    K +  S +  A  K KGL++SK+IFSK+WS+K   
Sbjct  538  ALKGELATLRLRDK---EGSNDSNLKDMKLSAEKVAGGKAKGLIMSKKIFSKLWSNKDRL  594

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             ENS SD+SES GS+   E+KSTPSR  R+S+S
Sbjct  595  SENSSSDTSESPGSSNAGESKSTPSRSRRHSLS  627



>ref|XP_009629746.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=620

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 62/93 (67%), Gaps = 3/93 (3%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            ALKGELA LRL +    + +N    K +  S +  A  K KGL++SK+IFSK+WS+K   
Sbjct  531  ALKGELATLRLRDK---EGSNDSNLKDMKLSAEKVAGGKAKGLIMSKKIFSKLWSNKDRL  587

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
             ENS SD+SES GS+   E+KSTPSR  R+S+S
Sbjct  588  SENSSSDTSESPGSSNAGESKSTPSRSRRHSLS  620



>ref|XP_006600918.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X1 
[Glycine max]
Length=630

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 62/94 (66%), Gaps = 4/94 (4%)
 Frame = -2

Query  531  ALKGELAALRL-GNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskgg  355
            +LKGE+ AL+L G  G A  +  D      ++D  AA SKMKG + SK+I SKIWSSK  
Sbjct  540  SLKGEVDALKLSGGTGRAS-SGKDNNSGKGNADNIAA-SKMKGFM-SKKILSKIWSSKEK  596

Query  354  ngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            + + S SD+SES  ST +EE KSTP+R  R+SVS
Sbjct  597  SVDISSSDTSESPASTVVEETKSTPARSRRHSVS  630



>ref|XP_006600919.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X2 
[Glycine max]
Length=614

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 62/94 (66%), Gaps = 4/94 (4%)
 Frame = -2

Query  531  ALKGELAALRL-GNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskgg  355
            +LKGE+ AL+L G  G A  +  D      ++D  AA SKMKG + SK+I SKIWSSK  
Sbjct  524  SLKGEVDALKLSGGTGRAS-SGKDNNSGKGNADNIAA-SKMKGFM-SKKILSKIWSSKEK  580

Query  354  ngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            + + S SD+SES  ST +EE KSTP+R  R+SVS
Sbjct  581  SVDISSSDTSESPASTVVEETKSTPARSRRHSVS  614



>gb|KHN23237.1| BTB/POZ domain-containing protein NPY2 [Glycine soja]
Length=587

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 62/94 (66%), Gaps = 4/94 (4%)
 Frame = -2

Query  531  ALKGELAALRL-GNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskgg  355
            +LKGE+ AL+L G  G A  +  D      ++D  AA SKMKG + SK+I SKIWSSK  
Sbjct  497  SLKGEVDALKLSGGTGRAS-SGKDNNSGKGNADNIAA-SKMKGFM-SKKILSKIWSSKEK  553

Query  354  ngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            + + S SD+SES  ST +EE KSTP+R  R+SVS
Sbjct  554  SVDISSSDTSESPASTVVEETKSTPARSRRHSVS  587



>ref|XP_004288238.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011465947.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011465950.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Fragaria 
vesca subsp. vesca]
Length=625

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 4/56 (7%)
 Frame = -2

Query  531  ALKGELAALRLG--NAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  370
            ALKGE++ LRLG  N G+ +  N D       S+K AA SKMKGLL+SK+IFSK+W
Sbjct  535  ALKGEISTLRLGDGNEGVGNDRN-DHHGAKNQSEKVAA-SKMKGLLMSKKIFSKLW  588



>ref|XP_004496882.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Cicer arietinum]
 ref|XP_004496883.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Cicer arietinum]
 ref|XP_004496884.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Cicer arietinum]
Length=611

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 60/93 (65%), Gaps = 12/93 (13%)
 Frame = -2

Query  531  ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggn  352
            AL+ ELA LRL N            +   S DKA  I KMKGLL SK+ F K+W+SKGG 
Sbjct  531  ALRKELATLRLSNG-----------EAKPSMDKAV-IGKMKGLLRSKKSFIKLWASKGGQ  578

Query  351  gensgsdsseslgSTTMEEAKSTPSRKGRYSVS  253
            GENSGSDSSES+ S   EE KSTPSR  R+SVS
Sbjct  579  GENSGSDSSESVVSANPEEVKSTPSRNRRHSVS  611



>ref|XP_010065907.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065908.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065909.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065910.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065911.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065912.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 gb|KCW63621.1| hypothetical protein EUGRSUZ_G01249 [Eucalyptus grandis]
Length=625

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 9/97 (9%)
 Frame = -2

Query  531  ALKGELAALRL--GNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskg  358
            ALK ELA+LRL  G  G  +R NG+    V   DKAA I+KMKGLL SK++F K++SSK 
Sbjct  534  ALKTELASLRLSIGARGGPER-NGEGKPNV---DKAA-ITKMKGLLRSKKVFMKMFSSKS  588

Query  357  gngensgsdsses--lgSTTMEEAKSTPSRKGRYSVS  253
             +  NSGSDSSES   G+  ++E KSTPS+  RYSVS
Sbjct  589  QSENNSGSDSSESLGSGNGNVDEVKSTPSQNRRYSVS  625



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200