BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS045G12

Length=619
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB18178.1|  hypothetical protein B456_003G038000                    345   5e-115   Gossypium raimondii
gb|KHG22139.1|  hypothetical protein F383_05782                         345   4e-114   Gossypium arboreum [tree cotton]
gb|KJB18181.1|  hypothetical protein B456_003G038000                    345   5e-114   Gossypium raimondii
ref|XP_007047791.1|  O-fucosyltransferase family protein isoform 1      345   2e-113   
gb|KJB18182.1|  hypothetical protein B456_003G038000                    345   2e-113   Gossypium raimondii
gb|KJB18179.1|  hypothetical protein B456_003G038000                    345   3e-113   Gossypium raimondii
gb|KDO60569.1|  hypothetical protein CISIN_1g009234mg                   342   1e-112   Citrus sinensis [apfelsine]
ref|XP_011097478.1|  PREDICTED: uncharacterized protein At1g04910...    343   2e-112   Sesamum indicum [beniseed]
ref|XP_006466306.1|  PREDICTED: uncharacterized protein At1g04910...    342   1e-111   Citrus sinensis [apfelsine]
gb|KHG05570.1|  hypothetical protein F383_31127                         341   1e-111   Gossypium arboreum [tree cotton]
ref|XP_006426272.1|  hypothetical protein CICLE_v10025329mg             342   1e-111   Citrus clementina [clementine]
ref|XP_007207425.1|  hypothetical protein PRUPE_ppa004921mg             338   4e-111   
ref|XP_007207426.1|  hypothetical protein PRUPE_ppa004921mg             338   4e-111   
gb|KJB44061.1|  hypothetical protein B456_007G232700                    335   9e-111   Gossypium raimondii
gb|KHG27420.1|  hypothetical protein F383_15612                         337   2e-110   Gossypium arboreum [tree cotton]
ref|XP_008385667.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    338   2e-110   Malus domestica [apple tree]
gb|EYU30936.1|  hypothetical protein MIMGU_mgv1a004530mg                337   4e-110   Erythranthe guttata [common monkey flower]
ref|XP_009623753.1|  PREDICTED: uncharacterized protein At1g04910...    336   5e-110   
ref|XP_009623754.1|  PREDICTED: uncharacterized protein At1g04910...    336   6e-110   Nicotiana tomentosiformis
gb|KJB44060.1|  hypothetical protein B456_007G232700                    333   6e-110   Gossypium raimondii
ref|XP_008236135.1|  PREDICTED: uncharacterized protein At1g04910...    337   7e-110   Prunus mume [ume]
ref|XP_008236140.1|  PREDICTED: uncharacterized protein At1g04910...    336   8e-110   Prunus mume [ume]
ref|XP_009797995.1|  PREDICTED: uncharacterized protein At1g04910...    335   1e-109   Nicotiana sylvestris
ref|XP_002533683.1|  conserved hypothetical protein                     335   1e-109   Ricinus communis
ref|XP_009797993.1|  PREDICTED: uncharacterized protein At1g04910...    335   1e-109   Nicotiana sylvestris
ref|XP_004288516.2|  PREDICTED: uncharacterized protein At1g04910       336   1e-109   Fragaria vesca subsp. vesca
ref|XP_008347789.1|  PREDICTED: uncharacterized protein At1g04910...    335   2e-109   
ref|XP_009364252.1|  PREDICTED: uncharacterized protein At1g04910...    335   2e-109   Pyrus x bretschneideri [bai li]
ref|XP_008347790.1|  PREDICTED: uncharacterized protein At1g04910...    335   2e-109   
ref|XP_009364251.1|  PREDICTED: uncharacterized protein At1g04910...    335   2e-109   Pyrus x bretschneideri [bai li]
ref|XP_011099984.1|  PREDICTED: uncharacterized protein At1g04910...    335   2e-109   Sesamum indicum [beniseed]
ref|XP_011099981.1|  PREDICTED: uncharacterized protein At1g04910...    335   3e-109   Sesamum indicum [beniseed]
gb|KJB44059.1|  hypothetical protein B456_007G232700                    334   5e-109   Gossypium raimondii
gb|AAK84479.1|  putative auxin growth promotor protein                  332   1e-108   Solanum lycopersicum
ref|XP_010312650.1|  PREDICTED: uncharacterized protein At1g04910...    332   1e-108   Solanum lycopersicum
ref|XP_010312649.1|  PREDICTED: uncharacterized protein At1g04910...    332   1e-108   Solanum lycopersicum
ref|XP_009350347.1|  PREDICTED: uncharacterized protein At1g04910...    333   2e-108   Pyrus x bretschneideri [bai li]
ref|XP_009350346.1|  PREDICTED: uncharacterized protein At1g04910...    333   2e-108   Pyrus x bretschneideri [bai li]
ref|XP_006353172.1|  PREDICTED: uncharacterized protein At1g04910...    332   2e-108   
ref|XP_006353173.1|  PREDICTED: uncharacterized protein At1g04910...    332   2e-108   Solanum tuberosum [potatoes]
ref|XP_006587571.1|  PREDICTED: uncharacterized protein At1g04910...    332   2e-108   Glycine max [soybeans]
ref|XP_003534239.1|  PREDICTED: uncharacterized protein At1g04910...    332   2e-108   Glycine max [soybeans]
ref|XP_010312647.1|  PREDICTED: uncharacterized protein At1g04910...    332   3e-108   
ref|XP_010312648.1|  PREDICTED: uncharacterized protein At1g04910...    332   3e-108   
ref|XP_004509777.1|  PREDICTED: uncharacterized protein At1g04910...    330   7e-108   Cicer arietinum [garbanzo]
gb|AGE09594.1|  UP7-like protein                                        323   1e-107   Eucalyptus cladocalyx
ref|XP_011021848.1|  PREDICTED: uncharacterized protein At1g04910       329   4e-107   Populus euphratica
gb|KDP29763.1|  hypothetical protein JCGZ_18698                         328   6e-107   Jatropha curcas
ref|XP_004143441.1|  PREDICTED: DUF246 domain-containing protein ...    328   6e-107   Cucumis sativus [cucumbers]
gb|EYU30935.1|  hypothetical protein MIMGU_mgv1a004530mg                328   9e-107   Erythranthe guttata [common monkey flower]
emb|CDP01562.1|  unnamed protein product                                328   1e-106   Coffea canephora [robusta coffee]
ref|XP_009783617.1|  PREDICTED: uncharacterized protein At1g04910...    327   3e-106   Nicotiana sylvestris
ref|XP_002268599.2|  PREDICTED: uncharacterized protein At1g04910       326   5e-106   Vitis vinifera
ref|XP_007158370.1|  hypothetical protein PHAVU_002G147300g             326   7e-106   Phaseolus vulgaris [French bean]
ref|XP_002310868.1|  hypothetical protein POPTR_0007s14280g             325   7e-106   Populus trichocarpa [western balsam poplar]
ref|XP_010277498.1|  PREDICTED: uncharacterized protein At1g04910...    322   8e-106   
ref|XP_008440542.1|  PREDICTED: uncharacterized protein At1g04910       326   8e-106   Cucumis melo [Oriental melon]
gb|KCW54611.1|  hypothetical protein EUGRSUZ_I00557                     325   9e-106   Eucalyptus grandis [rose gum]
ref|XP_010113429.1|  hypothetical protein L484_026763                   326   1e-105   
gb|KCW54609.1|  hypothetical protein EUGRSUZ_I00557                     325   2e-105   Eucalyptus grandis [rose gum]
gb|KHN14510.1|  DUF246 domain-containing protein                        325   2e-105   Glycine soja [wild soybean]
ref|XP_004237994.1|  PREDICTED: uncharacterized protein At1g04910       325   2e-105   Solanum lycopersicum
ref|XP_010680342.1|  PREDICTED: uncharacterized protein At1g04910       325   2e-105   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003517397.1|  PREDICTED: uncharacterized protein At1g04910...    325   2e-105   Glycine max [soybeans]
ref|XP_010027954.1|  PREDICTED: uncharacterized protein At1g04910       324   2e-105   Eucalyptus grandis [rose gum]
ref|XP_010523310.1|  PREDICTED: uncharacterized protein At1g04910...    322   2e-105   
ref|XP_006573005.1|  PREDICTED: uncharacterized protein At1g04910...    325   2e-105   Glycine max [soybeans]
gb|EYU39303.1|  hypothetical protein MIMGU_mgv1a004838mg                324   3e-105   Erythranthe guttata [common monkey flower]
ref|XP_010277497.1|  PREDICTED: uncharacterized protein At1g04910...    323   6e-105   Nelumbo nucifera [Indian lotus]
gb|AAB72114.1|  PsRT17-1                                                320   7e-105   Pisum sativum [garden pea]
ref|XP_006472461.1|  PREDICTED: uncharacterized protein At1g04910...    323   1e-104   Citrus sinensis [apfelsine]
gb|EPS72903.1|  hypothetical protein M569_01846                         322   2e-104   Genlisea aurea
ref|XP_007018221.1|  O-fucosyltransferase family protein                323   2e-104   
ref|XP_006472463.1|  PREDICTED: uncharacterized protein At1g04910...    322   3e-104   
ref|XP_010523312.1|  PREDICTED: uncharacterized protein At1g04910...    322   3e-104   Tarenaya hassleriana [spider flower]
ref|XP_006338062.1|  PREDICTED: uncharacterized protein At1g04910...    322   3e-104   Solanum tuberosum [potatoes]
ref|XP_003613049.1|  DUF246 domain-containing protein                   321   4e-104   Medicago truncatula
ref|XP_010523308.1|  PREDICTED: uncharacterized protein At1g04910...    322   4e-104   Tarenaya hassleriana [spider flower]
ref|XP_009624657.1|  PREDICTED: uncharacterized protein At1g04910...    321   5e-104   Nicotiana tomentosiformis
ref|XP_010937178.1|  PREDICTED: uncharacterized protein At1g04910...    322   5e-104   Elaeis guineensis
gb|AFK40388.1|  unknown                                                 320   1e-103   Lotus japonicus
ref|XP_006280335.1|  hypothetical protein CARUB_v10026260mg             320   2e-103   
ref|XP_006433827.1|  hypothetical protein CICLE_v10000880mg             319   3e-103   Citrus clementina [clementine]
ref|XP_010463027.1|  PREDICTED: uncharacterized protein At1g04910...    319   3e-103   Camelina sativa [gold-of-pleasure]
ref|XP_006433826.1|  hypothetical protein CICLE_v10000880mg             319   4e-103   
ref|XP_010444520.1|  PREDICTED: uncharacterized protein At1g04910...    318   8e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010254530.1|  PREDICTED: uncharacterized protein At1g04910...    318   1e-102   Nelumbo nucifera [Indian lotus]
ref|XP_008802622.1|  PREDICTED: uncharacterized protein At1g04910...    317   1e-102   Phoenix dactylifera
gb|ABJ96379.1|  expressed protein                                       317   2e-102   Prunus persica
ref|XP_007222858.1|  hypothetical protein PRUPE_ppa004255mg             317   2e-102   Prunus persica
ref|XP_010484355.1|  PREDICTED: uncharacterized protein At1g04910...    317   3e-102   Camelina sativa [gold-of-pleasure]
ref|XP_002864958.1|  hypothetical protein ARALYDRAFT_496780             316   3e-102   
ref|XP_010519195.1|  PREDICTED: uncharacterized protein At1g04910...    316   5e-102   Tarenaya hassleriana [spider flower]
ref|XP_010939815.1|  PREDICTED: uncharacterized protein At1g04910...    317   5e-102   
ref|NP_201350.2|  O-fucosyltransferase family protein                   315   6e-102   Arabidopsis thaliana [mouse-ear cress]
gb|AAM13166.1|  unknown protein                                         315   6e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004301363.1|  PREDICTED: uncharacterized protein At1g04910       316   6e-102   Fragaria vesca subsp. vesca
ref|XP_006852943.1|  hypothetical protein AMTR_s00033p00238220          313   6e-102   
gb|KDP41479.1|  hypothetical protein JCGZ_15886                         316   7e-102   Jatropha curcas
dbj|BAE71212.1|  hypothetical protein                                   312   8e-102   Trifolium pratense [peavine clover]
ref|XP_009785662.1|  PREDICTED: uncharacterized protein At1g04910...    315   8e-102   Nicotiana sylvestris
dbj|BAB11569.1|  unnamed protein product                                315   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008219267.1|  PREDICTED: uncharacterized protein At1g04910...    315   1e-101   Prunus mume [ume]
ref|XP_010547595.1|  PREDICTED: uncharacterized protein At1g04910...    313   6e-101   Tarenaya hassleriana [spider flower]
emb|CDY14569.1|  BnaC03g48900D                                          312   9e-101   Brassica napus [oilseed rape]
gb|KFK28724.1|  hypothetical protein AALP_AA7G039000                    312   2e-100   Arabis alpina [alpine rockcress]
ref|XP_002514041.1|  conserved hypothetical protein                     312   2e-100   Ricinus communis
ref|XP_009376221.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    312   2e-100   Pyrus x bretschneideri [bai li]
gb|KJB48896.1|  hypothetical protein B456_008G092600                    311   2e-100   Gossypium raimondii
gb|KJB58885.1|  hypothetical protein B456_009G229500                    308   2e-100   Gossypium raimondii
ref|XP_009150636.1|  PREDICTED: uncharacterized protein At1g04910       310   5e-100   Brassica rapa
ref|XP_010664406.1|  PREDICTED: uncharacterized protein At1g04910...    308   6e-100   Vitis vinifera
gb|EPS73888.1|  hypothetical protein M569_00867                         310   6e-100   Genlisea aurea
ref|XP_008368388.1|  PREDICTED: uncharacterized protein At1g04910...    311   6e-100   
ref|XP_003602912.1|  PsRT17-1 like protein                              311   6e-100   Medicago truncatula
ref|XP_006394027.1|  hypothetical protein EUTSA_v10004041mg             310   8e-100   Eutrema salsugineum [saltwater cress]
ref|XP_006394028.1|  hypothetical protein EUTSA_v10004041mg             310   8e-100   
ref|XP_010692399.1|  PREDICTED: uncharacterized protein At1g04910       309   1e-99    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB58881.1|  hypothetical protein B456_009G229500                    310   2e-99    Gossypium raimondii
ref|XP_002283844.1|  PREDICTED: uncharacterized protein At1g04910...    309   2e-99    Vitis vinifera
ref|XP_006413418.1|  hypothetical protein EUTSA_v10024936mg             309   3e-99    Eutrema salsugineum [saltwater cress]
ref|XP_007136338.1|  hypothetical protein PHAVU_009G0371000g            306   5e-99    Phaseolus vulgaris [French bean]
ref|XP_008378640.1|  PREDICTED: uncharacterized protein At1g04910...    306   6e-99    
ref|XP_003526543.1|  PREDICTED: uncharacterized protein At1g04910...    308   8e-99    Glycine max [soybeans]
ref|XP_009401410.1|  PREDICTED: uncharacterized protein At1g04910...    308   1e-98    
ref|XP_002867661.1|  predicted protein                                  307   1e-98    Arabidopsis lyrata subsp. lyrata
gb|KCW68511.1|  hypothetical protein EUGRSUZ_F02148                     306   2e-98    Eucalyptus grandis [rose gum]
ref|XP_010061545.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    307   2e-98    Eucalyptus grandis [rose gum]
ref|XP_009138156.1|  PREDICTED: uncharacterized protein At1g04910       307   2e-98    Brassica rapa
ref|XP_010448552.1|  PREDICTED: uncharacterized protein At1g04910...    307   2e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010439017.1|  PREDICTED: uncharacterized protein At1g04910...    307   2e-98    
ref|XP_010433755.1|  PREDICTED: uncharacterized protein At1g04910...    306   3e-98    Camelina sativa [gold-of-pleasure]
emb|CDY03446.1|  BnaC01g16360D                                          309   4e-98    
emb|CAA23010.1|  PsRT17-1 like protein                                  303   4e-98    Arabidopsis thaliana [mouse-ear cress]
gb|AGV54860.1|  O-fucosyltransferase family protein                     306   5e-98    Phaseolus vulgaris [French bean]
gb|KHN09000.1|  DUF246 domain-containing protein                        305   7e-98    Glycine soja [wild soybean]
ref|XP_010523344.1|  PREDICTED: uncharacterized protein At1g04910       305   7e-98    Tarenaya hassleriana [spider flower]
ref|XP_010107675.1|  hypothetical protein L484_007693                   305   1e-97    
emb|CDY37829.1|  BnaAnng04900D                                          304   2e-97    Brassica napus [oilseed rape]
emb|CDY33958.1|  BnaC02g43790D                                          304   2e-97    Brassica napus [oilseed rape]
gb|KHN08263.1|  DUF246 domain-containing protein                        304   3e-97    Glycine soja [wild soybean]
ref|XP_004501643.1|  PREDICTED: uncharacterized protein At1g04910...    303   3e-97    Cicer arietinum [garbanzo]
ref|XP_003523785.1|  PREDICTED: uncharacterized protein At1g04910...    303   6e-97    Glycine max [soybeans]
emb|CDP11502.1|  unnamed protein product                                303   6e-97    Coffea canephora [robusta coffee]
ref|XP_008444924.1|  PREDICTED: uncharacterized protein At1g04910...    303   7e-97    Cucumis melo [Oriental melon]
ref|NP_194184.2|  O-fucosyltransferase family protein                   303   8e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130513.1|  PREDICTED: uncharacterized protein At1g04910...    302   1e-96    Brassica rapa
ref|XP_009130514.1|  PREDICTED: uncharacterized protein At1g04910...    301   1e-96    Brassica rapa
emb|CDY34289.1|  BnaA01g13920D                                          309   2e-96    Brassica napus [oilseed rape]
gb|KJB18177.1|  hypothetical protein B456_003G038000                    296   3e-96    Gossypium raimondii
ref|XP_004152738.1|  PREDICTED: DUF246 domain-containing protein ...    301   4e-96    Cucumis sativus [cucumbers]
ref|XP_011016933.1|  PREDICTED: uncharacterized protein At1g04910...    301   4e-96    Populus euphratica
ref|XP_002301095.2|  hypothetical protein POPTR_0002s10600g             300   1e-95    
ref|XP_006285210.1|  hypothetical protein CARUB_v10006569mg             300   1e-95    Capsella rubella
ref|NP_001063155.1|  Os09g0412200                                       298   3e-95    
ref|XP_006661225.1|  PREDICTED: uncharacterized protein At1g04910...    296   1e-94    
ref|XP_008651492.1|  PREDICTED: LOC100283829 isoform X1                 293   8e-94    Zea mays [maize]
ref|XP_004956798.1|  PREDICTED: uncharacterized protein At1g04910...    294   2e-93    Setaria italica
ref|XP_002462371.1|  hypothetical protein SORBIDRAFT_02g024540          293   3e-93    Sorghum bicolor [broomcorn]
gb|EEE69695.1|  hypothetical protein OsJ_29339                          299   4e-93    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA61415.1|  TPA: hypothetical protein ZEAMMB73_640362              292   5e-93    
ref|NP_001150199.1|  LOC100283829                                       291   1e-92    Zea mays [maize]
ref|XP_010543952.1|  PREDICTED: uncharacterized protein At1g04910...    280   2e-92    Tarenaya hassleriana [spider flower]
dbj|BAK06980.1|  predicted protein                                      288   5e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KGN62755.1|  hypothetical protein Csa_2G370540                       300   2e-90    Cucumis sativus [cucumbers]
ref|XP_003578106.1|  PREDICTED: uncharacterized protein At1g04910...    286   2e-90    Brachypodium distachyon [annual false brome]
emb|CAN78778.1|  hypothetical protein VITISV_029752                     285   3e-90    Vitis vinifera
gb|EMT16885.1|  hypothetical protein F775_06176                         285   4e-90    
gb|KJB44062.1|  hypothetical protein B456_007G232700                    276   3e-89    Gossypium raimondii
gb|KJB58883.1|  hypothetical protein B456_009G229500                    280   3e-88    Gossypium raimondii
ref|XP_007047792.1|  O-fucosyltransferase family protein isoform 2      275   1e-87    
ref|XP_002967262.1|  hypothetical protein SELMODRAFT_87093              276   4e-87    
ref|XP_002960458.1|  hypothetical protein SELMODRAFT_75338              274   3e-86    
gb|EMS64135.1|  hypothetical protein TRIUR3_23110                       273   1e-85    Triticum urartu
gb|KDO81174.1|  hypothetical protein CISIN_1g020969mg                   263   1e-83    Citrus sinensis [apfelsine]
ref|XP_001777077.1|  predicted protein                                  263   3e-82    
ref|XP_011016934.1|  PREDICTED: uncharacterized protein At1g04910...    261   5e-81    Populus euphratica
gb|KJB58884.1|  hypothetical protein B456_009G229500                    255   1e-80    Gossypium raimondii
gb|EEC84568.1|  hypothetical protein OsI_31345                          260   2e-80    Oryza sativa Indica Group [Indian rice]
gb|AAX20003.1|  unknown protein                                         218   4e-67    Iris tectorum
ref|XP_002987806.1|  hypothetical protein SELMODRAFT_126689             190   2e-54    
ref|XP_002990403.1|  hypothetical protein SELMODRAFT_131659             189   3e-54    
ref|XP_006290838.1|  hypothetical protein CARUB_v10016949mg             180   2e-49    Capsella rubella
ref|XP_010425341.1|  PREDICTED: uncharacterized protein At1g04910...    179   2e-49    
gb|AAT08765.1|  auxin-independent growth protein                        171   3e-49    Hyacinthus orientalis [common hyacinth]
ref|XP_002875314.1|  hypothetical protein ARALYDRAFT_484400             179   4e-49    
ref|NP_566791.2|  O-fucosyltransferase family protein                   179   5e-49    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010506989.1|  PREDICTED: uncharacterized protein At1g04910...    179   5e-49    Camelina sativa [gold-of-pleasure]
ref|XP_010502552.1|  PREDICTED: uncharacterized protein At1g04910...    178   6e-49    Camelina sativa [gold-of-pleasure]
ref|XP_010514284.1|  PREDICTED: uncharacterized protein At1g04910...    178   6e-49    Camelina sativa [gold-of-pleasure]
ref|XP_009121525.1|  PREDICTED: uncharacterized protein At1g04910...    177   1e-48    Brassica rapa
ref|XP_009121532.1|  PREDICTED: uncharacterized protein At1g04910...    177   1e-48    Brassica rapa
emb|CDY56370.1|  BnaAnng14230D                                          177   1e-48    Brassica napus [oilseed rape]
emb|CDY22004.1|  BnaC09g01100D                                          177   1e-48    Brassica napus [oilseed rape]
emb|CDX83614.1|  BnaC07g23540D                                          177   1e-48    
ref|XP_009152062.1|  PREDICTED: uncharacterized protein At1g04910       177   1e-48    Brassica rapa
emb|CDY13629.1|  BnaA06g32940D                                          177   2e-48    Brassica napus [oilseed rape]
ref|XP_008390090.1|  PREDICTED: uncharacterized protein At1g04910...    174   2e-48    
ref|XP_006395561.1|  hypothetical protein EUTSA_v10003920mg             177   2e-48    Eutrema salsugineum [saltwater cress]
gb|KFK33567.1|  hypothetical protein AALP_AA5G030400                    176   4e-48    Arabis alpina [alpine rockcress]
ref|XP_001765982.1|  predicted protein                                  173   8e-48    
gb|AFW75945.1|  hypothetical protein ZEAMMB73_097274                    166   1e-47    
gb|KJB50269.1|  hypothetical protein B456_008G161400                    173   2e-47    Gossypium raimondii
gb|EPS71835.1|  hypothetical protein M569_02912                         174   3e-47    Genlisea aurea
gb|EMS46071.1|  hypothetical protein TRIUR3_08015                       171   5e-47    Triticum urartu
gb|KHG25699.1|  hypothetical protein F383_04430                         173   6e-47    Gossypium arboreum [tree cotton]
gb|KJB50270.1|  hypothetical protein B456_008G161400                    172   6e-47    Gossypium raimondii
ref|XP_008799030.1|  PREDICTED: uncharacterized protein At1g04910...    172   8e-47    Phoenix dactylifera
ref|XP_007044839.1|  O-fucosyltransferase family protein isoform 1      172   9e-47    Theobroma cacao [chocolate]
gb|KJB78030.1|  hypothetical protein B456_012G173200                    172   1e-46    Gossypium raimondii
ref|XP_010682284.1|  PREDICTED: uncharacterized protein At1g04910       172   1e-46    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004135279.1|  PREDICTED: DUF246 domain-containing protein ...    172   1e-46    Cucumis sativus [cucumbers]
gb|AFW75944.1|  auxin-independent growth promoter-like protein, mRNA    168   2e-46    
ref|XP_009759798.1|  PREDICTED: uncharacterized protein At1g04910       171   2e-46    Nicotiana sylvestris
ref|XP_010248690.1|  PREDICTED: uncharacterized protein At1g04910       171   2e-46    Nelumbo nucifera [Indian lotus]
ref|XP_002969133.1|  hypothetical protein SELMODRAFT_90475              169   3e-46    
ref|XP_002973931.1|  hypothetical protein SELMODRAFT_100522             169   3e-46    
ref|XP_008446146.1|  PREDICTED: uncharacterized protein At1g04910       171   3e-46    Cucumis melo [Oriental melon]
ref|XP_010932070.1|  PREDICTED: uncharacterized protein At1g04910       171   3e-46    Elaeis guineensis
ref|XP_010100364.1|  hypothetical protein L484_027673                   171   3e-46    Morus notabilis
ref|XP_007222914.1|  hypothetical protein PRUPE_ppa003660mg             170   5e-46    Prunus persica
ref|XP_008221889.1|  PREDICTED: uncharacterized protein At1g04910       170   5e-46    Prunus mume [ume]
ref|XP_008340083.1|  PREDICTED: uncharacterized protein At1g04910       170   6e-46    Malus domestica [apple tree]
ref|XP_004951839.1|  PREDICTED: uncharacterized protein At1g04910...    170   6e-46    Setaria italica
ref|XP_009359192.1|  PREDICTED: uncharacterized protein At1g04910       170   7e-46    Pyrus x bretschneideri [bai li]
ref|XP_002438900.1|  hypothetical protein SORBIDRAFT_10g027900          170   7e-46    Sorghum bicolor [broomcorn]
ref|XP_006657268.1|  PREDICTED: uncharacterized protein At1g04910...    169   1e-45    
ref|XP_004298993.2|  PREDICTED: uncharacterized protein At1g04910       169   1e-45    Fragaria vesca subsp. vesca
ref|XP_010528094.1|  PREDICTED: uncharacterized protein At1g04910...    169   1e-45    Tarenaya hassleriana [spider flower]
gb|KDO82190.1|  hypothetical protein CISIN_1g008884mg                   167   2e-45    Citrus sinensis [apfelsine]
ref|NP_001169204.1|  hypothetical protein                               166   2e-45    Zea mays [maize]
ref|NP_001152550.1|  auxin-independent growth promoter-like protein     169   2e-45    
ref|XP_010023452.1|  PREDICTED: uncharacterized protein At1g04910       169   2e-45    Eucalyptus grandis [rose gum]
gb|EMT20301.1|  hypothetical protein F775_28818                         167   2e-45    
ref|XP_006438229.1|  hypothetical protein CICLE_v10031037mg             167   2e-45    
dbj|BAK05991.1|  predicted protein                                      167   2e-45    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP26681.1|  hypothetical protein JCGZ_17839                         168   2e-45    Jatropha curcas
dbj|BAJ98197.1|  predicted protein                                      169   2e-45    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT25019.1|  hypothetical protein F775_14193                         168   2e-45    
gb|ACF86391.1|  unknown                                                 168   2e-45    Zea mays [maize]
ref|XP_006648331.1|  PREDICTED: uncharacterized protein At1g04910...    168   2e-45    Oryza brachyantha
ref|XP_002285492.1|  PREDICTED: uncharacterized protein At1g04910       168   3e-45    Vitis vinifera
ref|XP_010556342.1|  PREDICTED: uncharacterized protein At1g04910       168   3e-45    Tarenaya hassleriana [spider flower]
gb|KHG19982.1|  hypothetical protein F383_25836                         169   3e-45    Gossypium arboreum [tree cotton]
ref|XP_006438227.1|  hypothetical protein CICLE_v10031037mg             168   4e-45    
ref|XP_002530048.1|  conserved hypothetical protein                     167   4e-45    Ricinus communis
ref|XP_006483965.1|  PREDICTED: uncharacterized protein At1g04910...    167   5e-45    Citrus sinensis [apfelsine]
gb|KDO82189.1|  hypothetical protein CISIN_1g008884mg                   167   5e-45    Citrus sinensis [apfelsine]
ref|XP_002451572.1|  hypothetical protein SORBIDRAFT_04g004090          167   5e-45    Sorghum bicolor [broomcorn]
ref|XP_004502388.1|  PREDICTED: uncharacterized protein At1g04910...    167   5e-45    Cicer arietinum [garbanzo]
ref|NP_001045959.1|  Os02g0158800                                       167   6e-45    
ref|XP_009602874.1|  PREDICTED: uncharacterized protein At1g04910       167   6e-45    Nicotiana tomentosiformis
ref|XP_003574806.1|  PREDICTED: uncharacterized protein At1g04910...    167   6e-45    Brachypodium distachyon [annual false brome]
ref|XP_006852387.1|  hypothetical protein AMTR_s00049p00231960          167   6e-45    Amborella trichopoda
ref|XP_006438228.1|  hypothetical protein CICLE_v10031037mg             167   7e-45    
gb|EEE56347.1|  hypothetical protein OsJ_05454                          167   1e-44    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006380002.1|  hypothetical protein POPTR_0008s18910g             166   1e-44    
gb|KEH35288.1|  growth regulator-like protein                           164   1e-44    Medicago truncatula
emb|CDP13245.1|  unnamed protein product                                166   2e-44    Coffea canephora [robusta coffee]
ref|XP_009387816.1|  PREDICTED: uncharacterized protein At1g04910       166   2e-44    Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC81207.1|  hypothetical protein OsI_24239                          166   2e-44    Oryza sativa Indica Group [Indian rice]
ref|XP_011016177.1|  PREDICTED: uncharacterized protein At1g04910...    164   2e-44    Populus euphratica
gb|AFW75942.1|  LOW QUALITY PROTEIN: auxin-independent growth pro...    169   2e-44    
ref|XP_011034053.1|  PREDICTED: uncharacterized protein At1g04910...    166   2e-44    Populus euphratica
ref|XP_006357586.1|  PREDICTED: uncharacterized protein At1g04910...    166   3e-44    Solanum tuberosum [potatoes]
ref|XP_004239143.1|  PREDICTED: uncharacterized protein At1g04910       165   3e-44    
ref|XP_011071301.1|  PREDICTED: uncharacterized protein At1g04910       167   3e-44    
ref|XP_010549414.1|  PREDICTED: uncharacterized protein At1g04910...    164   4e-44    Tarenaya hassleriana [spider flower]
ref|XP_003560475.2|  PREDICTED: uncharacterized protein At1g04910...    165   4e-44    
ref|NP_001151533.1|  LOC100285167                                       165   6e-44    
gb|AES72149.2|  growth regulator-like protein                           164   7e-44    Medicago truncatula
ref|XP_003551990.1|  PREDICTED: uncharacterized protein At1g04910...    163   1e-43    Glycine max [soybeans]
ref|XP_010549413.1|  PREDICTED: uncharacterized protein At1g04910...    164   1e-43    Tarenaya hassleriana [spider flower]
ref|XP_007163687.1|  hypothetical protein PHAVU_001G255600g             163   2e-43    Phaseolus vulgaris [French bean]
ref|XP_011042385.1|  PREDICTED: uncharacterized protein At1g04910       163   2e-43    Populus euphratica
ref|XP_002314587.1|  hypothetical protein POPTR_0010s05850g             163   2e-43    Populus trichocarpa [western balsam poplar]
gb|EYU22542.1|  hypothetical protein MIMGU_mgv1a020093mg                163   2e-43    Erythranthe guttata [common monkey flower]
gb|KHN44375.1|  DUF246 domain-containing protein                        162   3e-43    Glycine soja [wild soybean]
ref|XP_003538596.1|  PREDICTED: uncharacterized protein At1g04910...    162   5e-43    Glycine max [soybeans]
gb|KHN43981.1|  DUF246 domain-containing protein                        163   4e-42    
ref|XP_001768745.1|  predicted protein                                  157   2e-41    
ref|XP_002522229.1|  conserved hypothetical protein                     157   2e-41    
gb|EPS72365.1|  hypothetical protein M569_02392                         152   3e-41    
ref|XP_010061980.1|  PREDICTED: uncharacterized protein At1g04910...    154   9e-41    
ref|NP_001117378.1|  O-fucosyltransferase-like protein                  154   9e-41    
emb|CDY50783.1|  BnaA09g54120D                                          155   2e-40    
ref|XP_009115262.1|  PREDICTED: uncharacterized protein At1g04910...    155   2e-40    
ref|XP_002513766.1|  conserved hypothetical protein                     155   2e-40    
emb|CDX98087.1|  BnaA06g08380D                                          155   2e-40    
ref|NP_174215.2|  O-fucosyltransferase-like protein                     154   2e-40    
ref|XP_010061979.1|  PREDICTED: uncharacterized protein At1g04910...    154   3e-40    
gb|KCW69027.1|  hypothetical protein EUGRSUZ_F02582                     154   3e-40    
ref|XP_007025346.1|  O-fucosyltransferase family protein isoform 2      153   4e-40    
ref|NP_001117377.1|  O-fucosyltransferase-like protein                  154   4e-40    
ref|XP_002893554.1|  hypothetical protein ARALYDRAFT_473137             154   5e-40    
gb|KCW70567.1|  hypothetical protein EUGRSUZ_F03754                     151   6e-40    
gb|KCW70566.1|  hypothetical protein EUGRSUZ_F03754                     152   7e-40    
ref|XP_006664382.1|  PREDICTED: uncharacterized protein At1g04910...    152   8e-40    
ref|XP_010478287.1|  PREDICTED: uncharacterized protein At1g04910...    153   1e-39    
ref|XP_007025345.1|  O-fucosyltransferase family protein isoform 1      153   1e-39    
emb|CDY30045.1|  BnaC05g09750D                                          152   1e-39    
ref|XP_006415594.1|  hypothetical protein EUTSA_v10007505mg             151   2e-39    
ref|XP_010063352.1|  PREDICTED: uncharacterized protein At1g04910...    151   3e-39    
ref|XP_010655536.1|  PREDICTED: uncharacterized protein At1g04910...    150   5e-39    
ref|XP_006472723.1|  PREDICTED: uncharacterized protein At1g04910...    151   5e-39    
ref|XP_008443407.1|  PREDICTED: uncharacterized protein At1g04910...    149   6e-39    
ref|XP_006434133.1|  hypothetical protein CICLE_v10000652mg             150   7e-39    
ref|XP_010099160.1|  hypothetical protein L484_014158                   150   7e-39    
ref|XP_007214654.1|  hypothetical protein PRUPE_ppa002626mg             150   8e-39    
ref|XP_010655535.1|  PREDICTED: uncharacterized protein At1g04910...    150   9e-39    
ref|XP_006306191.1|  hypothetical protein CARUB_v10011821mg             150   1e-38    
ref|XP_002441904.1|  hypothetical protein SORBIDRAFT_08g004650          150   1e-38    
ref|XP_009379852.1|  PREDICTED: uncharacterized protein At1g04910...    150   1e-38    
ref|XP_007026176.1|  O-fucosyltransferase family protein isoform 2      148   1e-38    
ref|XP_010460701.1|  PREDICTED: uncharacterized protein At1g04910...    150   1e-38    
ref|XP_010499443.1|  PREDICTED: uncharacterized protein At1g04910...    149   2e-38    
ref|XP_006307011.1|  hypothetical protein CARUB_v10008597mg             149   2e-38    
ref|XP_004293322.1|  PREDICTED: uncharacterized protein At1g04910       149   2e-38    
gb|EEE66244.1|  hypothetical protein OsJ_22422                          149   2e-38    
ref|XP_006841300.1|  hypothetical protein AMTR_s00134p00086190          148   3e-38    
ref|XP_011101415.1|  PREDICTED: uncharacterized protein At1g04910...    148   3e-38    
ref|XP_011101413.1|  PREDICTED: uncharacterized protein At1g04910...    148   3e-38    
ref|XP_008224713.1|  PREDICTED: uncharacterized protein At1g04910...    149   3e-38    
ref|XP_009102867.1|  PREDICTED: uncharacterized protein At1g04910       149   3e-38    
ref|XP_008443399.1|  PREDICTED: uncharacterized protein At1g04910...    149   3e-38    
ref|XP_008443392.1|  PREDICTED: uncharacterized protein At1g04910...    149   4e-38    
gb|AFW56213.1|  hypothetical protein ZEAMMB73_697257                    148   4e-38    
gb|KDO78358.1|  hypothetical protein CISIN_1g007425mg                   147   4e-38    
ref|XP_007148031.1|  hypothetical protein PHAVU_006G174600g             148   4e-38    
ref|NP_001066285.2|  Os12g0174100                                       147   5e-38    
gb|KDP21114.1|  hypothetical protein JCGZ_21585                         147   5e-38    
ref|XP_008661414.1|  PREDICTED: uncharacterized protein LOC100193...    148   5e-38    
ref|XP_010478972.1|  PREDICTED: uncharacterized protein At1g04910...    148   5e-38    
ref|XP_010478971.1|  PREDICTED: uncharacterized protein At1g04910...    148   6e-38    
gb|KFK32890.1|  hypothetical protein AALP_AA6G300900                    148   6e-38    
ref|XP_010478969.1|  PREDICTED: uncharacterized protein At1g04910...    148   6e-38    
gb|EEE52851.1|  hypothetical protein OsJ_35390                          147   6e-38    
ref|XP_002893927.1|  hypothetical protein ARALYDRAFT_473732             147   7e-38    
gb|KDO78357.1|  hypothetical protein CISIN_1g007425mg                   146   7e-38    
ref|NP_849755.1|  O-fucosyltransferase-like protein                     147   7e-38    
ref|XP_008384256.1|  PREDICTED: uncharacterized protein At1g04910...    148   8e-38    
ref|XP_011039416.1|  PREDICTED: uncharacterized protein At1g04910...    146   8e-38    
ref|XP_004513833.1|  PREDICTED: uncharacterized protein At1g04910...    147   8e-38    
ref|XP_004977274.1|  PREDICTED: uncharacterized protein At1g04910...    147   8e-38    
ref|XP_009366982.1|  PREDICTED: uncharacterized protein At1g04910...    147   9e-38    
ref|XP_010912508.1|  PREDICTED: uncharacterized protein At1g04910...    147   9e-38    
ref|XP_006473172.1|  PREDICTED: uncharacterized protein At1g04910...    146   9e-38    
ref|XP_006596302.1|  PREDICTED: uncharacterized protein At1g04910...    147   9e-38    
ref|XP_010091349.1|  hypothetical protein L484_020151                   150   9e-38    
gb|KHN26036.1|  DUF246 domain-containing protein                        147   1e-37    
ref|XP_006467376.1|  PREDICTED: uncharacterized protein At1g04910...    147   1e-37    
ref|XP_006358125.1|  PREDICTED: uncharacterized protein At1g04910...    147   1e-37    
ref|XP_003614789.1|  Growth regulator-related protein                   147   1e-37    
ref|XP_010244143.1|  PREDICTED: uncharacterized protein At1g04910...    146   1e-37    
ref|XP_006467377.1|  PREDICTED: uncharacterized protein At1g04910...    147   1e-37    
ref|XP_006434582.1|  hypothetical protein CICLE_v10000533mg             146   1e-37    
ref|NP_683362.1|  O-fucosyltransferase-like protein                     147   1e-37    
ref|XP_010500090.1|  PREDICTED: uncharacterized protein At1g04910...    146   1e-37    
gb|KDO83868.1|  hypothetical protein CISIN_1g008308mg                   146   1e-37    
ref|XP_010500091.1|  PREDICTED: uncharacterized protein At1g04910...    146   1e-37    
ref|XP_007018985.1|  O-fucosyltransferase family protein isoform 2      147   1e-37    
gb|EEC68940.1|  hypothetical protein OsI_37646                          147   1e-37    
ref|XP_011101411.1|  PREDICTED: uncharacterized protein At1g04910...    147   1e-37    
ref|XP_006473173.1|  PREDICTED: uncharacterized protein At1g04910...    145   2e-37    
gb|KDO78355.1|  hypothetical protein CISIN_1g007425mg                   146   2e-37    
emb|CDY12942.1|  BnaA09g13320D                                          147   2e-37    
ref|XP_011101412.1|  PREDICTED: uncharacterized protein At1g04910...    147   2e-37    
gb|KHN28621.1|  DUF246 domain-containing protein                        146   2e-37    
ref|XP_006597482.1|  PREDICTED: uncharacterized protein At1g04910...    146   2e-37    
gb|KDO78356.1|  hypothetical protein CISIN_1g007425mg                   145   2e-37    
ref|XP_010461370.1|  PREDICTED: uncharacterized protein At1g04910...    146   2e-37    
ref|XP_006449803.1|  hypothetical protein CICLE_v10014653mg             145   2e-37    
ref|XP_010925619.1|  PREDICTED: uncharacterized protein At1g04910...    147   2e-37    
ref|XP_009113085.1|  PREDICTED: uncharacterized protein At1g04910       147   2e-37    
ref|XP_007026175.1|  O-fucosyltransferase family protein isoform 1      147   2e-37    
ref|XP_010461373.1|  PREDICTED: uncharacterized protein At1g04910...    146   2e-37    
ref|XP_010461371.1|  PREDICTED: uncharacterized protein At1g04910...    146   2e-37    
ref|XP_006358124.1|  PREDICTED: uncharacterized protein At1g04910...    146   2e-37    
ref|XP_011039415.1|  PREDICTED: uncharacterized protein At1g04910...    145   2e-37    
ref|XP_009367298.1|  PREDICTED: uncharacterized protein At1g04910...    146   2e-37    
ref|XP_008365206.1|  PREDICTED: uncharacterized protein At1g04910...    146   2e-37    
ref|XP_009341670.1|  PREDICTED: uncharacterized protein At1g04910...    146   2e-37    
ref|NP_172663.2|  O-fucosyltransferase family protein                   146   2e-37    
ref|XP_006434583.1|  hypothetical protein CICLE_v10000533mg             146   2e-37    
ref|XP_004150223.1|  PREDICTED: DUF246 domain-containing protein ...    146   2e-37    
ref|XP_004161210.1|  PREDICTED: DUF246 domain-containing protein ...    146   2e-37    
gb|KDO83867.1|  hypothetical protein CISIN_1g008308mg                   145   2e-37    
ref|XP_011460621.1|  PREDICTED: uncharacterized protein At1g04910...    145   3e-37    
ref|XP_006473171.1|  PREDICTED: uncharacterized protein At1g04910...    146   3e-37    
ref|XP_006434581.1|  hypothetical protein CICLE_v10000533mg             146   3e-37    
ref|XP_010686224.1|  PREDICTED: uncharacterized protein At1g04910...    145   3e-37    
ref|XP_007018984.1|  O-fucosyltransferase family protein isoform 1      146   3e-37    
ref|XP_011460620.1|  PREDICTED: uncharacterized protein At1g04910...    146   3e-37    
ref|XP_009604296.1|  PREDICTED: uncharacterized protein At1g04910...    146   3e-37    
ref|XP_009604295.1|  PREDICTED: uncharacterized protein At1g04910...    146   3e-37    
gb|KDO78354.1|  hypothetical protein CISIN_1g007425mg                   146   3e-37    
emb|CDY19543.1|  BnaC09g13600D                                          146   3e-37    
ref|XP_001753325.1|  predicted protein                                  145   3e-37    
ref|NP_001132314.1|  growth regulator                                   146   3e-37    
ref|XP_001766418.1|  predicted protein                                  144   3e-37    
gb|EMS55867.1|  hypothetical protein TRIUR3_34733                       145   3e-37    
ref|XP_002892668.1|  hypothetical protein ARALYDRAFT_471348             145   3e-37    
ref|XP_006449800.1|  hypothetical protein CICLE_v10014653mg             145   3e-37    
ref|NP_176423.3|  O-fucosyltransferase family protein                   146   3e-37    
dbj|BAD44565.1|  unnamed protein product                                146   4e-37    
gb|KJB59186.1|  hypothetical protein B456_009G243300                    144   4e-37    
ref|XP_006391902.1|  hypothetical protein EUTSA_v10023332mg             146   4e-37    
ref|XP_008798044.1|  PREDICTED: uncharacterized protein At1g04910...    145   4e-37    
gb|EMT33054.1|  hypothetical protein F775_09106                         145   4e-37    
ref|XP_009390063.1|  PREDICTED: uncharacterized protein At1g04910...    145   4e-37    
ref|XP_011039414.1|  PREDICTED: uncharacterized protein At1g04910...    145   5e-37    
ref|XP_010476149.1|  PREDICTED: uncharacterized protein At1g04910...    145   5e-37    
ref|XP_011012509.1|  PREDICTED: uncharacterized protein At1g04910...    145   5e-37    
emb|CDY57756.1|  BnaCnng32400D                                          145   5e-37    
ref|XP_002966670.1|  hypothetical protein SELMODRAFT_85972              144   5e-37    
ref|XP_004965561.1|  PREDICTED: uncharacterized protein At1g04910...    145   5e-37    
ref|XP_008338786.1|  PREDICTED: uncharacterized protein At1g04910       145   5e-37    
ref|XP_002518425.1|  conserved hypothetical protein                     145   5e-37    
ref|XP_006377544.1|  hypothetical protein POPTR_0011s07160g             145   5e-37    
ref|XP_010530190.1|  PREDICTED: uncharacterized protein At1g04910...    145   5e-37    
ref|XP_004965562.1|  PREDICTED: uncharacterized protein At1g04910...    145   6e-37    
gb|AAF70834.1|AC003113_1  F24O1.5                                       146   6e-37    
ref|XP_011039411.1|  PREDICTED: uncharacterized protein At1g04910...    145   6e-37    
gb|KFK40606.1|  hypothetical protein AALP_AA2G017600                    145   6e-37    
ref|XP_004965564.1|  PREDICTED: uncharacterized protein At1g04910...    144   6e-37    
ref|XP_002316818.2|  hypothetical protein POPTR_0011s07160g             145   6e-37    
ref|XP_009799750.1|  PREDICTED: uncharacterized protein At1g04910...    144   7e-37    
ref|XP_010476147.1|  PREDICTED: uncharacterized protein At1g04910...    145   7e-37    
gb|AHH02360.1|  hypothetical protein                                    135   7e-37    
ref|XP_004965563.1|  PREDICTED: uncharacterized protein At1g04910...    145   7e-37    
ref|XP_006449801.1|  hypothetical protein CICLE_v10014653mg             144   7e-37    
ref|XP_006449796.1|  hypothetical protein CICLE_v10014653mg             144   7e-37    
ref|XP_010476148.1|  PREDICTED: uncharacterized protein At1g04910...    145   7e-37    
ref|XP_010686223.1|  PREDICTED: uncharacterized protein At1g04910...    145   8e-37    
gb|KEH36621.1|  GDP-fucose protein O-fucosyltransferase                 145   8e-37    
gb|ACG28723.1|  growth regulator                                        145   8e-37    
emb|CDY50845.1|  BnaC08g47910D                                          144   8e-37    
gb|EPS69385.1|  hypothetical protein M569_05376                         144   9e-37    
ref|XP_010244142.1|  PREDICTED: uncharacterized protein At1g04910...    145   9e-37    
ref|XP_010227672.1|  PREDICTED: uncharacterized protein At1g04910       144   9e-37    
ref|XP_006449797.1|  hypothetical protein CICLE_v10014653mg             144   1e-36    
ref|XP_010244141.1|  PREDICTED: uncharacterized protein At1g04910...    145   1e-36    
ref|NP_001057817.1|  Os06g0545900                                       144   1e-36    
gb|KJB59187.1|  hypothetical protein B456_009G243300                    144   1e-36    
ref|XP_006449802.1|  hypothetical protein CICLE_v10014653mg             144   1e-36    
dbj|BAJ97328.1|  predicted protein                                      144   1e-36    
gb|EEC80777.1|  hypothetical protein OsI_23300                          144   1e-36    
gb|KJB28878.1|  hypothetical protein B456_005G074200                    143   1e-36    
ref|XP_010493605.1|  PREDICTED: uncharacterized protein At1g04910...    144   1e-36    
ref|XP_002888034.1|  hypothetical protein ARALYDRAFT_475111             145   1e-36    
ref|XP_010274355.1|  PREDICTED: uncharacterized protein At1g04910...    144   1e-36    
ref|XP_010057887.1|  PREDICTED: uncharacterized protein At1g04910...    144   1e-36    
ref|XP_006449798.1|  hypothetical protein CICLE_v10014653mg             144   1e-36    
emb|CDY15638.1|  BnaA07g08090D                                          144   1e-36    
ref|XP_011027600.1|  PREDICTED: uncharacterized protein At1g04910...    144   1e-36    
ref|XP_009379526.1|  PREDICTED: uncharacterized protein At1g04910...    143   1e-36    
ref|XP_009799748.1|  PREDICTED: uncharacterized protein At1g04910...    144   1e-36    
ref|XP_011027599.1|  PREDICTED: uncharacterized protein At1g04910...    144   1e-36    
gb|KJB59188.1|  hypothetical protein B456_009G243300                    144   1e-36    
ref|XP_002325978.2|  hypothetical protein POPTR_0019s11020g             144   1e-36    
ref|XP_002967060.1|  hypothetical protein SELMODRAFT_408430             144   1e-36    
ref|XP_004485909.1|  PREDICTED: uncharacterized protein At1g04910...    144   1e-36    
ref|XP_002489034.1|  hypothetical protein SORBIDRAFT_0344s002010        144   1e-36    
ref|XP_010258886.1|  PREDICTED: uncharacterized protein At1g04910...    144   2e-36    
emb|CDX99802.1|  BnaC05g22240D                                          144   2e-36    
ref|XP_008378761.1|  PREDICTED: uncharacterized protein At1g04910       143   2e-36    
ref|XP_009799749.1|  PREDICTED: uncharacterized protein At1g04910...    144   2e-36    
emb|CDY53645.1|  BnaA08g30350D                                          143   2e-36    
gb|KJB28879.1|  hypothetical protein B456_005G074200                    143   2e-36    
ref|XP_004233041.1|  PREDICTED: uncharacterized protein At1g04910...    144   2e-36    
ref|XP_011003993.1|  PREDICTED: uncharacterized protein At1g04910       144   2e-36    
ref|XP_008444126.1|  PREDICTED: uncharacterized protein At1g04910...    143   2e-36    
ref|XP_008781542.1|  PREDICTED: uncharacterized protein At1g04910...    142   2e-36    
gb|KJB28877.1|  hypothetical protein B456_005G074200                    143   2e-36    
gb|KFK43461.1|  hypothetical protein AALP_AA1G128400                    143   2e-36    
ref|XP_006349651.1|  PREDICTED: uncharacterized protein At1g04910...    143   2e-36    
ref|XP_010316827.1|  PREDICTED: uncharacterized protein At1g04910...    144   2e-36    
gb|EMT12043.1|  hypothetical protein F775_07612                         143   3e-36    
emb|CDX90501.1|  BnaA03g42800D                                          143   3e-36    
ref|XP_006300315.1|  hypothetical protein CARUB_v10019899mg             144   3e-36    
ref|XP_009379518.1|  PREDICTED: uncharacterized protein At1g04910...    143   3e-36    
ref|XP_002960947.1|  hypothetical protein SELMODRAFT_402444             143   3e-36    
gb|KDP20702.1|  hypothetical protein JCGZ_21173                         143   3e-36    
ref|XP_008798042.1|  PREDICTED: uncharacterized protein At1g04910...    144   3e-36    
emb|CDY40517.1|  BnaC01g19950D                                          143   3e-36    
dbj|BAJ93371.1|  predicted protein                                      143   4e-36    
ref|XP_008669810.1|  PREDICTED: uncharacterized protein At1g04910...    141   4e-36    
ref|XP_010473452.1|  PREDICTED: uncharacterized protein At1g04910...    143   4e-36    
ref|XP_009136801.1|  PREDICTED: uncharacterized protein At1g04910...    142   4e-36    
gb|KJB51854.1|  hypothetical protein B456_008G234600                    141   4e-36    
ref|XP_010546573.1|  PREDICTED: uncharacterized protein At1g04910...    143   4e-36    
ref|XP_002978066.1|  hypothetical protein SELMODRAFT_108165             142   4e-36    
ref|XP_004142690.1|  PREDICTED: DUF246 domain-containing protein ...    142   4e-36    
ref|XP_009145647.1|  PREDICTED: uncharacterized protein At1g04910...    142   4e-36    
ref|XP_006414319.1|  hypothetical protein EUTSA_v10024831mg             142   5e-36    
ref|XP_010913450.1|  PREDICTED: uncharacterized protein At1g04910...    142   5e-36    
emb|CDP12443.1|  unnamed protein product                                142   5e-36    
ref|XP_007214626.1|  hypothetical protein PRUPE_ppa002927mg             142   5e-36    
ref|XP_002301007.2|  hypothetical protein POPTR_0002s08790g             142   5e-36    
ref|XP_010461317.1|  PREDICTED: uncharacterized protein At1g04910...    142   5e-36    



>gb|KJB18178.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=401

 Score =   345 bits (886),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 181/211 (86%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFI VLKDDISIVKELPD+FSWSTREYY+
Sbjct  11   KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFINVLKDDISIVKELPDDFSWSTREYYA  70

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIRPTRIK APVHASANWY ENVLPVL+S GIAAI+PFSHRL+F+N+P +IQ LRCKVN
Sbjct  71   TAIRPTRIKRAPVHASANWYLENVLPVLQSNGIAAISPFSHRLSFNNLPSEIQKLRCKVN  130

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-----------------PQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDAL+HRLRYP ++ +                  PQKFV VHLRFDK
Sbjct  131  FKALVFVPHIRALGDALVHRLRYPPTESQPLITDDLTGTTDRNVKQMPQKFVVVHLRFDK  190

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  191  DMAAHSACDFGGGKAEKLALAKYRQRIWGGR  221



>gb|KHG22139.1| hypothetical protein F383_05782 [Gossypium arboreum]
Length=467

 Score =   345 bits (886),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 181/211 (86%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFI V+KDDISIVKELPD+FSWSTREYY+
Sbjct  128  KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFINVMKDDISIVKELPDDFSWSTREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIRPTRIK APVHASANWY ENVLPVL+S GIAAI+PFSHRL+FDN+P +IQ LRCKVN
Sbjct  188  TAIRPTRIKRAPVHASANWYLENVLPVLQSNGIAAISPFSHRLSFDNLPSEIQKLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-----------------PQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDAL+HRLRYP ++ +                  PQKFV VHLRFDK
Sbjct  248  FKALVFVPHIRALGDALVHRLRYPPTESQPLITDDLTGTTDRNVKQMPQKFVVVHLRFDK  307

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQRIWGGR  338



>gb|KJB18181.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=451

 Score =   345 bits (884),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 181/211 (86%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFI VLKDDISIVKELPD+FSWSTREYY+
Sbjct  128  KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFINVLKDDISIVKELPDDFSWSTREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIRPTRIK APVHASANWY ENVLPVL+S GIAAI+PFSHRL+F+N+P +IQ LRCKVN
Sbjct  188  TAIRPTRIKRAPVHASANWYLENVLPVLQSNGIAAISPFSHRLSFNNLPSEIQKLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-----------------PQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDAL+HRLRYP ++ +                  PQKFV VHLRFDK
Sbjct  248  FKALVFVPHIRALGDALVHRLRYPPTESQPLITDDLTGTTDRNVKQMPQKFVVVHLRFDK  307

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQRIWGGR  338



>ref|XP_007047791.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOX91948.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
Length=518

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 179/211 (85%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSS+FMDIFDVDHFI VLKDDISIVKELPDEFSWSTREYY+
Sbjct  128  KILNATLVIPHLEVNPVWQDSSTFMDIFDVDHFINVLKDDISIVKELPDEFSWSTREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIK APVHASANWY ENVLPVL SYGIAAI+PFSHRL+FDN+P +IQ LRCKVN
Sbjct  188  TAIRATRIKRAPVHASANWYLENVLPVLESYGIAAISPFSHRLSFDNLPSEIQKLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-----------------PQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDAL+HRLRYP  + E                  PQKFV VHLRFDK
Sbjct  248  FKALVFVPHIRALGDALVHRLRYPPGESEALSTNYLRETTGQNDKRRPQKFVVVHLRFDK  307

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQTIWQGR  338



>gb|KJB18182.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=519

 Score =   345 bits (885),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 181/211 (86%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFI VLKDDISIVKELPD+FSWSTREYY+
Sbjct  129  KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFINVLKDDISIVKELPDDFSWSTREYYA  188

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIRPTRIK APVHASANWY ENVLPVL+S GIAAI+PFSHRL+F+N+P +IQ LRCKVN
Sbjct  189  TAIRPTRIKRAPVHASANWYLENVLPVLQSNGIAAISPFSHRLSFNNLPSEIQKLRCKVN  248

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-----------------PQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDAL+HRLRYP ++ +                  PQKFV VHLRFDK
Sbjct  249  FKALVFVPHIRALGDALVHRLRYPPTESQPLITDDLTGTTDRNVKQMPQKFVVVHLRFDK  308

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  309  DMAAHSACDFGGGKAEKLALAKYRQRIWGGR  339



>gb|KJB18179.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18180.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18183.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18184.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=518

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 181/211 (86%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFI VLKDDISIVKELPD+FSWSTREYY+
Sbjct  128  KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFINVLKDDISIVKELPDDFSWSTREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIRPTRIK APVHASANWY ENVLPVL+S GIAAI+PFSHRL+F+N+P +IQ LRCKVN
Sbjct  188  TAIRPTRIKRAPVHASANWYLENVLPVLQSNGIAAISPFSHRLSFNNLPSEIQKLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-----------------PQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDAL+HRLRYP ++ +                  PQKFV VHLRFDK
Sbjct  248  FKALVFVPHIRALGDALVHRLRYPPTESQPLITDDLTGTTDRNVKQMPQKFVVVHLRFDK  307

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQRIWGGR  338



>gb|KDO60569.1| hypothetical protein CISIN_1g009234mg [Citrus sinensis]
Length=473

 Score =   342 bits (877),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 179/211 (85%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSFMDI+DVDHFI VLKDDISIVKELP+EFSWSTREYY+
Sbjct  83   KILNATLVIPYLEVNPVWQDSSSFMDIYDVDHFINVLKDDISIVKELPNEFSWSTREYYA  142

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIKTAPVHASANWY ENVLPVL+SYG+AAI+PFSHRL FDN+P DIQ LRCK N
Sbjct  143  TAIRATRIKTAPVHASANWYLENVLPVLQSYGVAAISPFSHRLTFDNLPMDIQRLRCKAN  202

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-----------------PQKFVAVHLRFDK  491
            F+AL+FVPHIRALGDAL+ RLRYP+ K+ G                 P KFV +HLRFDK
Sbjct  203  FQALIFVPHIRALGDALVSRLRYPSIKNRGLDDVHLEETAYTNKIQEPLKFVVLHLRFDK  262

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  263  DMAAHSACDFGGGKAEKLALAKYRQMIWQGR  293



>ref|XP_011097478.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
Length=516

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 179/211 (85%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATL+IP+LEVNPVWQDSS+FMDIFDVDHFI VLKDDISIVKELPDE+ WSTREYY+
Sbjct  126  KILNATLIIPHLEVNPVWQDSSTFMDIFDVDHFINVLKDDISIVKELPDEYFWSTREYYA  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIKTAPVHASANWY ENVLPVL+SYGIAAIAPFSHRLAFDNMP+DIQ LRCKVN
Sbjct  186  TAIRATRIKTAPVHASANWYIENVLPVLQSYGIAAIAPFSHRLAFDNMPEDIQRLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDAL+ RLRYP S  E                 G  KFV +HLRFDK
Sbjct  246  FQALVFVPHIRALGDALVTRLRYPPSTSEVDGSNYLRQVSDSKDKQGTGKFVVLHLRFDK  305

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  306  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  336



>ref|XP_006466306.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=539

 Score =   342 bits (876),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 179/211 (85%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSFMDI+DVDHFI VLKDDISIVKELP+EFSWSTREYY+
Sbjct  149  KILNATLVIPYLEVNPVWQDSSSFMDIYDVDHFINVLKDDISIVKELPNEFSWSTREYYA  208

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIKTAPVHASANWY ENVLPVL+SYG+AAI+PFSHRL FDN+P DIQ LRCK N
Sbjct  209  TAIRATRIKTAPVHASANWYLENVLPVLQSYGVAAISPFSHRLTFDNLPMDIQRLRCKAN  268

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-----------------PQKFVAVHLRFDK  491
            F+AL+FVPHIRALGDAL+ RLRYP+ K+ G                 P KFV +HLRFDK
Sbjct  269  FQALIFVPHIRALGDALVSRLRYPSIKNRGLDGVHLEETAYTNKIQEPLKFVVLHLRFDK  328

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  329  DMAAHSACDFGGGKAEKLALAKYRQMIWQGR  359



>gb|KHG05570.1| hypothetical protein F383_31127 [Gossypium arboreum]
Length=518

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 178/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSFMDI+DVDHFI VLKDD+SIVKEL DEFSWSTREYY+
Sbjct  128  KILNATLVIPYLEVNPVWQDSSSFMDIYDVDHFINVLKDDVSIVKELSDEFSWSTREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIK APVHASANWY ENVLPVL+SYGIAAI+PFSHRL+FDN+P +IQ LRCKVN
Sbjct  188  TAIRATRIKRAPVHASANWYLENVLPVLQSYGIAAISPFSHRLSFDNLPSEIQQLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-----------------PQKFVAVHLRFDK  491
            F+ALV VPHIRALGDA++HRLRYP  + E                  PQKFV +HLRFDK
Sbjct  248  FKALVCVPHIRALGDAIVHRLRYPPGETEALSSDYLRVTTDQNDKQRPQKFVVLHLRFDK  307

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQTIWGGR  338



>ref|XP_006426272.1| hypothetical protein CICLE_v10025329mg [Citrus clementina]
 gb|ESR39512.1| hypothetical protein CICLE_v10025329mg [Citrus clementina]
 gb|KDO60568.1| hypothetical protein CISIN_1g009234mg [Citrus sinensis]
Length=539

 Score =   342 bits (876),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 179/211 (85%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSFMDI+DVDHFI VLKDDISIVKELP+EFSWSTREYY+
Sbjct  149  KILNATLVIPYLEVNPVWQDSSSFMDIYDVDHFINVLKDDISIVKELPNEFSWSTREYYA  208

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIKTAPVHASANWY ENVLPVL+SYG+AAI+PFSHRL FDN+P DIQ LRCK N
Sbjct  209  TAIRATRIKTAPVHASANWYLENVLPVLQSYGVAAISPFSHRLTFDNLPMDIQRLRCKAN  268

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-----------------PQKFVAVHLRFDK  491
            F+AL+FVPHIRALGDAL+ RLRYP+ K+ G                 P KFV +HLRFDK
Sbjct  269  FQALIFVPHIRALGDALVSRLRYPSIKNRGLDDVHLEETAYTNKIQEPLKFVVLHLRFDK  328

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  329  DMAAHSACDFGGGKAEKLALAKYRQMIWQGR  359



>ref|XP_007207425.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
 gb|EMJ08624.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
Length=474

 Score =   338 bits (867),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 177/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVW+DSSSFMDIFDVDHFI VLKDDISIVKELP +FSWSTREYY+
Sbjct  84   KILNATLVIPYLEVNPVWRDSSSFMDIFDVDHFINVLKDDISIVKELPSDFSWSTREYYA  143

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASANWY ENVLPV++SYGIAAIAPFSHRL FDN+P DIQ LRCKVN
Sbjct  144  TAIRATRVKTAPVHASANWYLENVLPVVQSYGIAAIAPFSHRLTFDNLPMDIQRLRCKVN  203

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDALI RLR P+ K                  +G  KFV +HLRFDK
Sbjct  204  FQALVFVPHIRALGDALISRLRNPSGKSGAVGTNYLQEMPDVKNKQGAGKFVVLHLRFDK  263

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  264  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  294



>ref|XP_007207426.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
 gb|EMJ08625.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
Length=485

 Score =   338 bits (868),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 177/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVW+DSSSFMDIFDVDHFI VLKDDISIVKELP +FSWSTREYY+
Sbjct  95   KILNATLVIPYLEVNPVWRDSSSFMDIFDVDHFINVLKDDISIVKELPSDFSWSTREYYA  154

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASANWY ENVLPV++SYGIAAIAPFSHRL FDN+P DIQ LRCKVN
Sbjct  155  TAIRATRVKTAPVHASANWYLENVLPVVQSYGIAAIAPFSHRLTFDNLPMDIQRLRCKVN  214

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDALI RLR P+ K                  +G  KFV +HLRFDK
Sbjct  215  FQALVFVPHIRALGDALISRLRNPSGKSGAVGTNYLQEMPDVKNKQGAGKFVVLHLRFDK  274

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  275  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  305



>gb|KJB44061.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=401

 Score =   335 bits (858),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 176/211 (83%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSSSFMDIFDVDHF+ VLKDDI I+K LPDEFSWSTREYY+
Sbjct  11   KILNATLVIPHLEVNPVWQDSSSFMDIFDVDHFMNVLKDDIPIIKVLPDEFSWSTREYYA  70

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIK APVHASANWY ENV PVL+S GIAAI+PFSHRL+FDN+P +IQ LRCKVN
Sbjct  71   TAIRGTRIKRAPVHASANWYLENVFPVLQSNGIAAISPFSHRLSFDNLPSEIQQLRCKVN  130

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-----------------PQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDAL+HRLRYP  + +                  PQKFV +HLRFDK
Sbjct  131  FKALVFVPHIRALGDALVHRLRYPPGQSQASSTDYLRETTDQNGKQNPQKFVVLHLRFDK  190

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  191  DMAAHSACDFGGGKAEKLALAKYRQTIWQGR  221



>gb|KHG27420.1| hypothetical protein F383_15612 [Gossypium arboreum]
Length=498

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 180/211 (85%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSSSFMDIFDVDHF+ VLKD+I I+KELPDEFSWSTREYY+
Sbjct  108  KILNATLVIPHLEVNPVWQDSSSFMDIFDVDHFMNVLKDEIPIIKELPDEFSWSTREYYA  167

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIK APVHASANWY ENVLPVL+S GIAAI+PFSHRL+FDN+P +IQ LRCKVN
Sbjct  168  TAIRATRIKRAPVHASANWYLENVLPVLQSNGIAAISPFSHRLSFDNLPSEIQQLRCKVN  227

Query  363  FRALVFVPHIRALGDALIHRLRYP------ASKD-----------EGPQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDAL+HRLRYP      +S D           + PQKFV +HLRFDK
Sbjct  228  FKALVFVPHIRALGDALVHRLRYPPGHSRASSTDYLRETTNQNGKQNPQKFVVLHLRFDK  287

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  288  DMAAHSACDFGGGKAEKLALAKYRQTIWQGR  318



>ref|XP_008385667.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Malus domestica]
Length=524

 Score =   338 bits (866),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 178/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVW+DSSSFMDIFDVDHFI VLKDDI IVKELP +FSWSTREYY+
Sbjct  134  KILNATLVIPYLEVNPVWRDSSSFMDIFDVDHFINVLKDDIRIVKELPSDFSWSTREYYA  193

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASANWY ENVLP+++SYGIAAIAPFSHRL FDN+P DIQ LRCKVN
Sbjct  194  TAIRATRVKTAPVHASANWYLENVLPLVQSYGIAAIAPFSHRLTFDNLPMDIQRLRCKVN  253

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDAL+ RLRYP+SK                  +G  KFV +HLRFDK
Sbjct  254  FQALVFVPHIRALGDALVSRLRYPSSKSGGASTNYLQEMPDVNDKQGAGKFVVLHLRFDK  313

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  314  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  344



>gb|EYU30936.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
 gb|EYU30937.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
Length=511

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 178/209 (85%), Gaps = 15/209 (7%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATL+IPYLEVNPVWQDSS+F DIFDVDHFIE LKD+ISIVKE+PDE+ WSTREYY+
Sbjct  122  KILNATLIIPYLEVNPVWQDSSTFEDIFDVDHFIESLKDEISIVKEVPDEYFWSTREYYA  181

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASANWY +NVLPVL SYGIAAIAPFSHRLAFDNMPK+IQ LRCKVN
Sbjct  182  TAIRATRVKTAPVHASANWYLDNVLPVLESYGIAAIAPFSHRLAFDNMPKEIQRLRCKVN  241

Query  363  FRALVFVPHIRALGDALIHRLRYPASK---------------DEGPQKFVAVHLRFDKDM  497
            F+ALV+VPHIRALGDAL+ RLRYP+S+                 G  KFV +HLRFDKDM
Sbjct  242  FQALVYVPHIRALGDALVSRLRYPSSRVDSTNYLKKVGDSNEKRGAGKFVVLHLRFDKDM  301

Query  498  AAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            AAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  302  AAHSACDFGGGKAEKLALAKYRQVIWQGR  330



>ref|XP_009623753.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana tomentosiformis]
Length=504

 Score =   336 bits (862),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 174/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP LEVNPVWQDSSSFMDIFDVDHFI VLKDD+SIVKELPDEFSWSTREYY 
Sbjct  114  KILNATLVIPQLEVNPVWQDSSSFMDIFDVDHFINVLKDDVSIVKELPDEFSWSTREYYG  173

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIRPTRIKTAPVHASANWY ENV PVL+SYGIAAIAPFSHRL FDNMPK +QHLRCKVN
Sbjct  174  TAIRPTRIKTAPVHASANWYLENVSPVLQSYGIAAIAPFSHRLTFDNMPKYLQHLRCKVN  233

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+AL FVPHIR LGDALI+RLR P S+                  +G  KF  +HLRFDK
Sbjct  234  FQALAFVPHIRHLGDALINRLRNPPSEGNMVSNNYLREVTDLKPKQGAGKFAVLHLRFDK  293

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAE L+LAKYRQ I  G+
Sbjct  294  DMAAHSACDFGGGKAENLALAKYRQVIWGGR  324



>ref|XP_009623754.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nicotiana tomentosiformis]
Length=503

 Score =   336 bits (861),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 174/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP LEVNPVWQDSSSFMDIFDVDHFI VLKDD+SIVKELPDEFSWSTREYY 
Sbjct  113  KILNATLVIPQLEVNPVWQDSSSFMDIFDVDHFINVLKDDVSIVKELPDEFSWSTREYYG  172

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIRPTRIKTAPVHASANWY ENV PVL+SYGIAAIAPFSHRL FDNMPK +QHLRCKVN
Sbjct  173  TAIRPTRIKTAPVHASANWYLENVSPVLQSYGIAAIAPFSHRLTFDNMPKYLQHLRCKVN  232

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+AL FVPHIR LGDALI+RLR P S+                  +G  KF  +HLRFDK
Sbjct  233  FQALAFVPHIRHLGDALINRLRNPPSEGNMVSNNYLREVTDLKPKQGAGKFAVLHLRFDK  292

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAE L+LAKYRQ I  G+
Sbjct  293  DMAAHSACDFGGGKAENLALAKYRQVIWGGR  323



>gb|KJB44060.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=428

 Score =   333 bits (855),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 176/211 (83%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSSSFMDIFDVDHF+ VLKDDI I+K LPDEFSWSTREYY+
Sbjct  128  KILNATLVIPHLEVNPVWQDSSSFMDIFDVDHFMNVLKDDIPIIKVLPDEFSWSTREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIK APVHASANWY ENV PVL+S GIAAI+PFSHRL+FDN+P +IQ LRCKVN
Sbjct  188  TAIRGTRIKRAPVHASANWYLENVFPVLQSNGIAAISPFSHRLSFDNLPSEIQQLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-----------------PQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDAL+HRLRYP  + +                  PQKFV +HLRFDK
Sbjct  248  FKALVFVPHIRALGDALVHRLRYPPGQSQASSTDYLRETTDQNGKQNPQKFVVLHLRFDK  307

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQTIWQGR  338



>ref|XP_008236135.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Prunus 
mume]
Length=529

 Score =   337 bits (863),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 177/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVW+DSSSFMDIFDVDHFI VLKDDISIVKELP +FSWSTREYY+
Sbjct  139  KILNATLVIPYLEVNPVWRDSSSFMDIFDVDHFINVLKDDISIVKELPSDFSWSTREYYA  198

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASANWY ENVLPV++SYGIAAIAPFSHRL FDN+P DIQ LRCKVN
Sbjct  199  TAIRATRVKTAPVHASANWYLENVLPVVQSYGIAAIAPFSHRLTFDNLPMDIQRLRCKVN  258

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDALI RLR P+ K                  +G  KFV +HLRFDK
Sbjct  259  FQALVFVPHIRALGDALISRLRNPSGKSGAVGTNYLQEMPDVKNKQGAGKFVVLHLRFDK  318

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  319  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  349



>ref|XP_008236140.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Prunus 
mume]
Length=518

 Score =   336 bits (862),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 177/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVW+DSSSFMDIFDVDHFI VLKDDISIVKELP +FSWSTREYY+
Sbjct  128  KILNATLVIPYLEVNPVWRDSSSFMDIFDVDHFINVLKDDISIVKELPSDFSWSTREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASANWY ENVLPV++SYGIAAIAPFSHRL FDN+P DIQ LRCKVN
Sbjct  188  TAIRATRVKTAPVHASANWYLENVLPVVQSYGIAAIAPFSHRLTFDNLPMDIQRLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDALI RLR P+ K                  +G  KFV +HLRFDK
Sbjct  248  FQALVFVPHIRALGDALISRLRNPSGKSGAVGTNYLQEMPDVKNKQGAGKFVVLHLRFDK  307

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  338



>ref|XP_009797995.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nicotiana sylvestris]
Length=503

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 174/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP LEVNPVWQDSSSFMDIFDVDHFI VLKDD+SIVKELPDEFSWSTREYY 
Sbjct  113  KILNATLVIPQLEVNPVWQDSSSFMDIFDVDHFINVLKDDVSIVKELPDEFSWSTREYYG  172

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIRPTRIKTAPVHASANWY ENV PVL+SYGIAAIAPFSHRL FDNMPK +QHLRCKVN
Sbjct  173  TAIRPTRIKTAPVHASANWYLENVSPVLQSYGIAAIAPFSHRLTFDNMPKYLQHLRCKVN  232

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+AL FVPH+R LGDALI+RLR P S+                  +G  KF  +HLRFDK
Sbjct  233  FQALAFVPHVRHLGDALINRLRNPPSEGNMVSNNYLREVTDLKPKQGAGKFAVLHLRFDK  292

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAE L+LAKYRQ I  G+
Sbjct  293  DMAAHSACDFGGGKAENLALAKYRQVIWGGR  323



>ref|XP_002533683.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28699.1| conserved hypothetical protein [Ricinus communis]
Length=509

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 181/211 (86%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+ E+NPVW+DSS+FM+IFDVDHFI VLKDDISIVKELPDEFSWSTREYY+
Sbjct  119  KILNATLVIPHFEINPVWRDSSTFMEIFDVDHFINVLKDDISIVKELPDEFSWSTREYYA  178

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIKTAPVH+SANWY ENVLPVL+SYGIAAI+PFSHRL FDN+P +IQ LRCKVN
Sbjct  179  TAIRATRIKTAPVHSSANWYLENVLPVLQSYGIAAISPFSHRLTFDNLPMEIQRLRCKVN  238

Query  363  FRALVFVPHIRALGDALIHRLRYPASK----------------DEG-PQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDALI+RLRYP+ K                DE   +KF+AVHLRFDK
Sbjct  239  FQALVFVPHIRALGDALINRLRYPSKKTVVGNTDYLRETLDVNDENEARKFIAVHLRFDK  298

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  299  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  329



>ref|XP_009797993.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009797994.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana sylvestris]
Length=504

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 174/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP LEVNPVWQDSSSFMDIFDVDHFI VLKDD+SIVKELPDEFSWSTREYY 
Sbjct  114  KILNATLVIPQLEVNPVWQDSSSFMDIFDVDHFINVLKDDVSIVKELPDEFSWSTREYYG  173

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIRPTRIKTAPVHASANWY ENV PVL+SYGIAAIAPFSHRL FDNMPK +QHLRCKVN
Sbjct  174  TAIRPTRIKTAPVHASANWYLENVSPVLQSYGIAAIAPFSHRLTFDNMPKYLQHLRCKVN  233

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+AL FVPH+R LGDALI+RLR P S+                  +G  KF  +HLRFDK
Sbjct  234  FQALAFVPHVRHLGDALINRLRNPPSEGNMVSNNYLREVTDLKPKQGAGKFAVLHLRFDK  293

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAE L+LAKYRQ I  G+
Sbjct  294  DMAAHSACDFGGGKAENLALAKYRQVIWGGR  324



>ref|XP_004288516.2| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=529

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 176/211 (83%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVW+DSSSFMDIFDVDHFI VLKDDISIVKELP +FSWSTREYY+
Sbjct  139  KILNATLVIPYLEVNPVWRDSSSFMDIFDVDHFINVLKDDISIVKELPSDFSWSTREYYA  198

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASANWY ENVLPVL+SYGIAAIAPFSHRL FD +P DIQ LRCKVN
Sbjct  199  TAIRATRVKTAPVHASANWYLENVLPVLQSYGIAAIAPFSHRLTFDTLPMDIQRLRCKVN  258

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+AL FVPHIRALGDALI RLRYP+ K                  +G  KFV +HLRFDK
Sbjct  259  FQALSFVPHIRALGDALISRLRYPSGKSGPIGTNHLLELPNVKGKQGEGKFVVLHLRFDK  318

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ +  G+
Sbjct  319  DMAAHSACDFGGGKAEKLALAKYRQVLWQGR  349



>ref|XP_008347789.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Malus domestica]
Length=524

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 178/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            +ILNATLVIPYLEVNPVW+DSSSFMDIFDVDHFI VLKDDI IVKELP +FSWSTREYY+
Sbjct  134  RILNATLVIPYLEVNPVWRDSSSFMDIFDVDHFINVLKDDIRIVKELPSDFSWSTREYYA  193

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASA+WY ENVLPV++SYGIAAIAPFSHRL FDN+P DIQ LRCKVN
Sbjct  194  TAIRATRVKTAPVHASAHWYLENVLPVVQSYGIAAIAPFSHRLTFDNLPMDIQRLRCKVN  253

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDALI RLRYP++K                  +G  KFV +HLRFDK
Sbjct  254  FQALVFVPHIRALGDALISRLRYPSTKSGXVGTNXLQEMPDVKEKQGAGKFVVLHLRFDK  313

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  314  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  344



>ref|XP_009364252.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Pyrus 
x bretschneideri]
Length=513

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 177/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVW+DSSSFMDIFDVDHFI VLKDDI IVKELP +FSWSTREYY+
Sbjct  123  KILNATLVIPYLEVNPVWRDSSSFMDIFDVDHFINVLKDDIRIVKELPSDFSWSTREYYA  182

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASANWY ENVLP+++SYGIAAIAPFSHRL FDN+P DIQ LRCKVN
Sbjct  183  TAIRATRVKTAPVHASANWYLENVLPLVQSYGIAAIAPFSHRLTFDNLPMDIQRLRCKVN  242

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+AL FVPHIRALGDAL+ RLRYP+SK                  +G  KFV +HLRFDK
Sbjct  243  FQALEFVPHIRALGDALVSRLRYPSSKSGGASSNYLQEMPNVNDKQGAGKFVVLHLRFDK  302

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  303  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  333



>ref|XP_008347790.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Malus domestica]
Length=513

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 178/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            +ILNATLVIPYLEVNPVW+DSSSFMDIFDVDHFI VLKDDI IVKELP +FSWSTREYY+
Sbjct  123  RILNATLVIPYLEVNPVWRDSSSFMDIFDVDHFINVLKDDIRIVKELPSDFSWSTREYYA  182

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASA+WY ENVLPV++SYGIAAIAPFSHRL FDN+P DIQ LRCKVN
Sbjct  183  TAIRATRVKTAPVHASAHWYLENVLPVVQSYGIAAIAPFSHRLTFDNLPMDIQRLRCKVN  242

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDALI RLRYP++K                  +G  KFV +HLRFDK
Sbjct  243  FQALVFVPHIRALGDALISRLRYPSTKSGXVGTNXLQEMPDVKEKQGAGKFVVLHLRFDK  302

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  303  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  333



>ref|XP_009364251.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Pyrus 
x bretschneideri]
Length=524

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 177/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVW+DSSSFMDIFDVDHFI VLKDDI IVKELP +FSWSTREYY+
Sbjct  134  KILNATLVIPYLEVNPVWRDSSSFMDIFDVDHFINVLKDDIRIVKELPSDFSWSTREYYA  193

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASANWY ENVLP+++SYGIAAIAPFSHRL FDN+P DIQ LRCKVN
Sbjct  194  TAIRATRVKTAPVHASANWYLENVLPLVQSYGIAAIAPFSHRLTFDNLPMDIQRLRCKVN  253

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+AL FVPHIRALGDAL+ RLRYP+SK                  +G  KFV +HLRFDK
Sbjct  254  FQALEFVPHIRALGDALVSRLRYPSSKSGGASSNYLQEMPNVNDKQGAGKFVVLHLRFDK  313

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  314  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  344



>ref|XP_011099984.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Sesamum indicum]
Length=517

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 179/212 (84%), Gaps = 18/212 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATL+IP+LEVNPVWQDSS+FMDIFDVDHFI VLKDDI I KELP+E+ WSTREYY+
Sbjct  126  KILNATLIIPHLEVNPVWQDSSTFMDIFDVDHFINVLKDDIRIAKELPEEYFWSTREYYA  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASANWY ENVLPVL+SYGIAAIAPFSHRLAFDNMP+DIQ LRCKVN
Sbjct  186  TAIRATRVKTAPVHASANWYLENVLPVLQSYGIAAIAPFSHRLAFDNMPEDIQRLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLRYP-----------------ASKD-EGPQKFVAVHLRFD  488
            F+AL FVPHIRALGDAL++RLRYP                  SKD +G  KFV +HLRFD
Sbjct  246  FQALDFVPHIRALGDALVNRLRYPHSTSEVDSASYLKNVGGGSKDKQGTGKFVVLHLRFD  305

Query  489  KDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            KDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  306  KDMAAHSACDFGGGKAEKLALAKYRQVIWQGR  337



>ref|XP_011099981.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
 ref|XP_011099982.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
 ref|XP_011099983.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
Length=518

 Score =   335 bits (858),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 179/212 (84%), Gaps = 18/212 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATL+IP+LEVNPVWQDSS+FMDIFDVDHFI VLKDDI I KELP+E+ WSTREYY+
Sbjct  127  KILNATLIIPHLEVNPVWQDSSTFMDIFDVDHFINVLKDDIRIAKELPEEYFWSTREYYA  186

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASANWY ENVLPVL+SYGIAAIAPFSHRLAFDNMP+DIQ LRCKVN
Sbjct  187  TAIRATRVKTAPVHASANWYLENVLPVLQSYGIAAIAPFSHRLAFDNMPEDIQRLRCKVN  246

Query  363  FRALVFVPHIRALGDALIHRLRYP-----------------ASKD-EGPQKFVAVHLRFD  488
            F+AL FVPHIRALGDAL++RLRYP                  SKD +G  KFV +HLRFD
Sbjct  247  FQALDFVPHIRALGDALVNRLRYPHSTSEVDSASYLKNVGGGSKDKQGTGKFVVLHLRFD  306

Query  489  KDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            KDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  307  KDMAAHSACDFGGGKAEKLALAKYRQVIWQGR  338



>gb|KJB44059.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=518

 Score =   334 bits (857),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 176/211 (83%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSSSFMDIFDVDHF+ VLKDDI I+K LPDEFSWSTREYY+
Sbjct  128  KILNATLVIPHLEVNPVWQDSSSFMDIFDVDHFMNVLKDDIPIIKVLPDEFSWSTREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIK APVHASANWY ENV PVL+S GIAAI+PFSHRL+FDN+P +IQ LRCKVN
Sbjct  188  TAIRGTRIKRAPVHASANWYLENVFPVLQSNGIAAISPFSHRLSFDNLPSEIQQLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-----------------PQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDAL+HRLRYP  + +                  PQKFV +HLRFDK
Sbjct  248  FKALVFVPHIRALGDALVHRLRYPPGQSQASSTDYLRETTDQNGKQNPQKFVVLHLRFDK  307

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQTIWQGR  338



>gb|AAK84479.1| putative auxin growth promotor protein [Solanum lycopersicum]
Length=478

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 172/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP LEVNPVWQDSSSF DIFDVDHFI  LKDD++IVKELPDEFSWSTREYY 
Sbjct  88   KILNATLVIPQLEVNPVWQDSSSFEDIFDVDHFINALKDDVAIVKELPDEFSWSTREYYG  147

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIRPTRIKTAPVHASANWY ENV PVL+SYGIAAIAPFSHRL FDNMPK +QHLRCKVN
Sbjct  148  IAIRPTRIKTAPVHASANWYLENVSPVLQSYGIAAIAPFSHRLTFDNMPKYLQHLRCKVN  207

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+AL FVPHIR LGDALI RLR+P S+D                 +G  KF  +HLRFDK
Sbjct  208  FQALAFVPHIRQLGDALITRLRFPPSEDNMVSNNYLREVTDLKPKQGVGKFAVLHLRFDK  267

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAE L+LAKYRQ I  G+
Sbjct  268  DMAAHSACDFGGGKAENLALAKYRQVIWGGR  298



>ref|XP_010312650.1| PREDICTED: uncharacterized protein At1g04910 isoform X4 [Solanum 
lycopersicum]
Length=468

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 172/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP LEVNPVWQDSSSF DIFDVDHFI  LKDD++IVKELPDEFSWSTREYY 
Sbjct  116  KILNATLVIPQLEVNPVWQDSSSFEDIFDVDHFINALKDDVAIVKELPDEFSWSTREYYG  175

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIRPTRIKTAPVHASANWY ENV PVL+SYGIAAIAPFSHRL FDNMPK +QHLRCKVN
Sbjct  176  IAIRPTRIKTAPVHASANWYLENVSPVLQSYGIAAIAPFSHRLTFDNMPKYLQHLRCKVN  235

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+AL FVPHIR LGDALI RLR+P S+D                 +G  KF  +HLRFDK
Sbjct  236  FQALAFVPHIRQLGDALITRLRFPPSEDNMVSNNYLREVTDLKPKQGVGKFAVLHLRFDK  295

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAE L+LAKYRQ I  G+
Sbjct  296  DMAAHSACDFGGGKAENLALAKYRQVIWGGR  326



>ref|XP_010312649.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Solanum 
lycopersicum]
Length=470

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 172/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP LEVNPVWQDSSSF DIFDVDHFI  LKDD++IVKELPDEFSWSTREYY 
Sbjct  80   KILNATLVIPQLEVNPVWQDSSSFEDIFDVDHFINALKDDVAIVKELPDEFSWSTREYYG  139

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIRPTRIKTAPVHASANWY ENV PVL+SYGIAAIAPFSHRL FDNMPK +QHLRCKVN
Sbjct  140  IAIRPTRIKTAPVHASANWYLENVSPVLQSYGIAAIAPFSHRLTFDNMPKYLQHLRCKVN  199

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+AL FVPHIR LGDALI RLR+P S+D                 +G  KF  +HLRFDK
Sbjct  200  FQALAFVPHIRQLGDALITRLRFPPSEDNMVSNNYLREVTDLKPKQGVGKFAVLHLRFDK  259

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAE L+LAKYRQ I  G+
Sbjct  260  DMAAHSACDFGGGKAENLALAKYRQVIWGGR  290



>ref|XP_009350347.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=513

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 177/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            +ILNATLVIPYLEVNPVW+DSSSFM+IFDVDHFI VLKDDI IVKELP +FSWSTREYY+
Sbjct  123  RILNATLVIPYLEVNPVWRDSSSFMEIFDVDHFINVLKDDIRIVKELPSDFSWSTREYYA  182

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASA+WY ENVLPV++SYGIAAIAPFSHRL FDN+P DIQ LRCKVN
Sbjct  183  TAIRATRVKTAPVHASAHWYLENVLPVVQSYGIAAIAPFSHRLTFDNLPMDIQQLRCKVN  242

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+AL FVPHIRALGDALI RLRYP++K                  +G  KFV +HLRFDK
Sbjct  243  FQALAFVPHIRALGDALISRLRYPSTKSGGVGTNYLQEMPDVKEKQGAGKFVVLHLRFDK  302

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  303  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  333



>ref|XP_009350346.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=524

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 177/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            +ILNATLVIPYLEVNPVW+DSSSFM+IFDVDHFI VLKDDI IVKELP +FSWSTREYY+
Sbjct  134  RILNATLVIPYLEVNPVWRDSSSFMEIFDVDHFINVLKDDIRIVKELPSDFSWSTREYYA  193

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASA+WY ENVLPV++SYGIAAIAPFSHRL FDN+P DIQ LRCKVN
Sbjct  194  TAIRATRVKTAPVHASAHWYLENVLPVVQSYGIAAIAPFSHRLTFDNLPMDIQQLRCKVN  253

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+AL FVPHIRALGDALI RLRYP++K                  +G  KFV +HLRFDK
Sbjct  254  FQALAFVPHIRALGDALISRLRYPSTKSGGVGTNYLQEMPDVKEKQGAGKFVVLHLRFDK  313

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  314  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  344



>ref|XP_006353172.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=506

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 172/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP LEVNPVWQDSSSF DIFDVDHFI  LKDD++IVKELPDEFSWSTREYY 
Sbjct  116  KILNATLVIPQLEVNPVWQDSSSFEDIFDVDHFINALKDDVAIVKELPDEFSWSTREYYG  175

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIRPTRIKTAPVHASANWY ENV PVL+SYGIAAIAPFSHRL FDNMPK +QHLRCKVN
Sbjct  176  VAIRPTRIKTAPVHASANWYLENVSPVLQSYGIAAIAPFSHRLTFDNMPKYLQHLRCKVN  235

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+AL FVPHIR LGDALI RLR+P S+D                 +G  KF  +HLRFDK
Sbjct  236  FQALAFVPHIRQLGDALITRLRFPPSEDNMVSNNYLREVTDLKPKQGGGKFAVLHLRFDK  295

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAE L+LAKYRQ I  G+
Sbjct  296  DMAAHSACDFGGGKAENLALAKYRQVIWGGR  326



>ref|XP_006353173.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum tuberosum]
Length=505

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 172/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP LEVNPVWQDSSSF DIFDVDHFI  LKDD++IVKELPDEFSWSTREYY 
Sbjct  115  KILNATLVIPQLEVNPVWQDSSSFEDIFDVDHFINALKDDVAIVKELPDEFSWSTREYYG  174

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIRPTRIKTAPVHASANWY ENV PVL+SYGIAAIAPFSHRL FDNMPK +QHLRCKVN
Sbjct  175  VAIRPTRIKTAPVHASANWYLENVSPVLQSYGIAAIAPFSHRLTFDNMPKYLQHLRCKVN  234

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+AL FVPHIR LGDALI RLR+P S+D                 +G  KF  +HLRFDK
Sbjct  235  FQALAFVPHIRQLGDALITRLRFPPSEDNMVSNNYLREVTDLKPKQGGGKFAVLHLRFDK  294

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAE L+LAKYRQ I  G+
Sbjct  295  DMAAHSACDFGGGKAENLALAKYRQVIWGGR  325



>ref|XP_006587571.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=516

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 177/213 (83%), Gaps = 21/213 (10%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLE+NPVW+DSSSFMDIFDVDHFI+VLKDDISIVKELP EFSWSTREYY 
Sbjct  126  KILNATLVIPYLELNPVWRDSSSFMDIFDVDHFIDVLKDDISIVKELPKEFSWSTREYYG  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIR TRIK APVHASA+WY ENVLPVL+SYGIAAI+PFSHRL+FDN+P DIQHLRCKVN
Sbjct  186  LAIRETRIKAAPVHASAHWYLENVLPVLQSYGIAAISPFSHRLSFDNLPMDIQHLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLRYP-------------------ASKDEGPQKFVAVHLRF  485
            F+AL FVPHIRALGDALI RLRYP                   A K+ G  KFV +HLRF
Sbjct  246  FQALTFVPHIRALGDALISRLRYPEGSAGEMGSNYLQEVTGAGARKNAG--KFVVLHLRF  303

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  304  DKDMAAHSACDFGGGKAEKLALAKYRQVIWQGR  336



>ref|XP_003534239.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
 gb|KHN38876.1| DUF246 domain-containing protein [Glycine soja]
Length=515

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 177/213 (83%), Gaps = 21/213 (10%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLE+NPVW+DSSSFMDIFDVDHFI+VLKDDISIVKELP EFSWSTREYY 
Sbjct  125  KILNATLVIPYLELNPVWRDSSSFMDIFDVDHFIDVLKDDISIVKELPKEFSWSTREYYG  184

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIR TRIK APVHASA+WY ENVLPVL+SYGIAAI+PFSHRL+FDN+P DIQHLRCKVN
Sbjct  185  LAIRETRIKAAPVHASAHWYLENVLPVLQSYGIAAISPFSHRLSFDNLPMDIQHLRCKVN  244

Query  363  FRALVFVPHIRALGDALIHRLRYP-------------------ASKDEGPQKFVAVHLRF  485
            F+AL FVPHIRALGDALI RLRYP                   A K+ G  KFV +HLRF
Sbjct  245  FQALTFVPHIRALGDALISRLRYPEGSAGEMGSNYLQEVTGAGARKNAG--KFVVLHLRF  302

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  303  DKDMAAHSACDFGGGKAEKLALAKYRQVIWQGR  335



>ref|XP_010312647.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Solanum 
lycopersicum]
Length=506

 Score =   332 bits (850),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 172/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP LEVNPVWQDSSSF DIFDVDHFI  LKDD++IVKELPDEFSWSTREYY 
Sbjct  116  KILNATLVIPQLEVNPVWQDSSSFEDIFDVDHFINALKDDVAIVKELPDEFSWSTREYYG  175

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIRPTRIKTAPVHASANWY ENV PVL+SYGIAAIAPFSHRL FDNMPK +QHLRCKVN
Sbjct  176  IAIRPTRIKTAPVHASANWYLENVSPVLQSYGIAAIAPFSHRLTFDNMPKYLQHLRCKVN  235

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+AL FVPHIR LGDALI RLR+P S+D                 +G  KF  +HLRFDK
Sbjct  236  FQALAFVPHIRQLGDALITRLRFPPSEDNMVSNNYLREVTDLKPKQGVGKFAVLHLRFDK  295

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAE L+LAKYRQ I  G+
Sbjct  296  DMAAHSACDFGGGKAENLALAKYRQVIWGGR  326



>ref|XP_010312648.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Solanum 
lycopersicum]
Length=505

 Score =   332 bits (850),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 172/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP LEVNPVWQDSSSF DIFDVDHFI  LKDD++IVKELPDEFSWSTREYY 
Sbjct  115  KILNATLVIPQLEVNPVWQDSSSFEDIFDVDHFINALKDDVAIVKELPDEFSWSTREYYG  174

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIRPTRIKTAPVHASANWY ENV PVL+SYGIAAIAPFSHRL FDNMPK +QHLRCKVN
Sbjct  175  IAIRPTRIKTAPVHASANWYLENVSPVLQSYGIAAIAPFSHRLTFDNMPKYLQHLRCKVN  234

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+AL FVPHIR LGDALI RLR+P S+D                 +G  KF  +HLRFDK
Sbjct  235  FQALAFVPHIRQLGDALITRLRFPPSEDNMVSNNYLREVTDLKPKQGVGKFAVLHLRFDK  294

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAE L+LAKYRQ I  G+
Sbjct  295  DMAAHSACDFGGGKAENLALAKYRQVIWGGR  325



>ref|XP_004509777.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=501

 Score =   330 bits (847),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 175/211 (83%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLE+NPVW+DSSSFMDIFDVDHFI+VLKDDISIVKELP+E+SWSTREYY+
Sbjct  111  KILNATLVIPYLELNPVWRDSSSFMDIFDVDHFIDVLKDDISIVKELPEEYSWSTREYYA  170

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIR TRIK APVHASANWY ENVLPVL+SYGIAAI+PFSHRL FDN+P DIQHLRCKVN
Sbjct  171  LAIRDTRIKAAPVHASANWYLENVLPVLQSYGIAAISPFSHRLTFDNVPMDIQHLRCKVN  230

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F+ALVFVPHIR LGDALI RLR P   +E                    KFV +HLRFDK
Sbjct  231  FQALVFVPHIRTLGDALISRLRNPQPSNEEMSSNYLQEVTSSDDNKNAGKFVVLHLRFDK  290

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  291  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  321



>gb|AGE09594.1| UP7-like protein, partial [Eucalyptus cladocalyx]
Length=297

 Score =   323 bits (828),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 174/210 (83%), Gaps = 16/210 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSF DIFDV+HFI+VLKDDI IV++LPDEFSWSTREYY+
Sbjct  60   KILNATLVIPYLEVNPVWQDSSSFGDIFDVEHFIDVLKDDIRIVRDLPDEFSWSTREYYA  119

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIRPTRIKTAPV A+ NWY ENV PVL+SYGIAAIAPFSHRL +DN+P DIQ LRCKVN
Sbjct  120  TAIRPTRIKTAPVRATVNWYLENVSPVLQSYGIAAIAPFSHRLTYDNLPMDIQRLRCKVN  179

Query  363  FRALVFVPHIRALGDALIHRLRYPA----------------SKDEGPQKFVAVHLRFDKD  494
            F  L+FVPHI+ALGDAL++RLRYP+                S  +   KFV +HLRFDKD
Sbjct  180  FEGLIFVPHIKALGDALVNRLRYPSDDSRATAGNYLREVTDSTAKKAGKFVVLHLRFDKD  239

Query  495  MAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            MAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  240  MAAHSACDFGGGKAEKLALAKYRQVIWQGR  269



>ref|XP_011021848.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=506

 Score =   329 bits (843),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 176/210 (84%), Gaps = 16/210 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+ EVNPVWQDSSSFMDIFDVDHFI VLKDDISIVKELPDEFSWSTREYY+
Sbjct  117  KILNATLVIPHFEVNPVWQDSSSFMDIFDVDHFINVLKDDISIVKELPDEFSWSTREYYA  176

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIR TRIK APVHASANWY ENVLPVL+SYGIAA++PFSHRL+FDN+P DIQ LRCKVN
Sbjct  177  IAIRATRIKMAPVHASANWYLENVLPVLQSYGIAAVSPFSHRLSFDNLPMDIQRLRCKVN  236

Query  363  FRALVFVPHIRALGDALIHRLRYP------------ASKD----EGPQKFVAVHLRFDKD  494
            F+ALVFVPHIRALGDAL+ RLR+P             S D    +   KFV +HLRFDKD
Sbjct  237  FQALVFVPHIRALGDALVSRLRHPYKNGAPGASYLQESTDVIDKDSAGKFVVIHLRFDKD  296

Query  495  MAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            MAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  297  MAAHSACDFGGGKAEKLALAKYRQVIWQGR  326



>gb|KDP29763.1| hypothetical protein JCGZ_18698 [Jatropha curcas]
Length=509

 Score =   328 bits (842),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 178/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+ EVNPVW+DSSSFMDIFD+DHFI+VLKDDISIVKELP+EFSWSTREYY+
Sbjct  119  KILNATLVIPHFEVNPVWRDSSSFMDIFDIDHFIDVLKDDISIVKELPEEFSWSTREYYA  178

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIK APVHASANWY +NVLPVL+SYGIAAI+PFSHRL FDN+P DIQ LRCKVN
Sbjct  179  TAIRATRIKMAPVHASANWYLDNVLPVLQSYGIAAISPFSHRLTFDNLPMDIQRLRCKVN  238

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F+AL+FV HIRALGDAL++RLRYP+ + E                   +KFV +HLRFDK
Sbjct  239  FQALIFVHHIRALGDALVNRLRYPSEEPEPFSTNSLRETTDKIDGNKARKFVVIHLRFDK  298

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  299  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  329



>ref|XP_004143441.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004160919.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 gb|KGN48703.1| hypothetical protein Csa_6G498990 [Cucumis sativus]
Length=513

 Score =   328 bits (842),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 178/210 (85%), Gaps = 16/210 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVW+DSSSF+DIFDVDHFI VLKDDISIVKELP EFSWSTREYY+
Sbjct  124  KILNATLVIPHLEVNPVWKDSSSFVDIFDVDHFINVLKDDISIVKELPAEFSWSTREYYA  183

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASANWY +NVLPVL+SYGIAAIAPFSHRLAF+N+P +IQ LRCKVN
Sbjct  184  TAIRATRVKTAPVHASANWYLDNVLPVLQSYGIAAIAPFSHRLAFENLPDEIQRLRCKVN  243

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG----------------PQKFVAVHLRFDKD  494
            F+AL FVPHI+ LG+ALI+RLRYP +K E                 P KFV +HLRFDKD
Sbjct  244  FQALTFVPHIQELGEALINRLRYPLNKKESVGGNYLSLTTDANEQRPLKFVVLHLRFDKD  303

Query  495  MAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            MAAHSACDFGGGKAEKL+LAKYRQ +  G+
Sbjct  304  MAAHSACDFGGGKAEKLALAKYRQVLWQGR  333



>gb|EYU30935.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
Length=522

 Score =   328 bits (842),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 178/220 (81%), Gaps = 26/220 (12%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATL+IPYLEVNPVWQDSS+F DIFDVDHFIE LKD+ISIVKE+PDE+ WSTREYY+
Sbjct  122  KILNATLIIPYLEVNPVWQDSSTFEDIFDVDHFIESLKDEISIVKEVPDEYFWSTREYYA  181

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASANWY +NVLPVL SYGIAAIAPFSHRLAFDNMPK+IQ LRCKVN
Sbjct  182  TAIRATRVKTAPVHASANWYLDNVLPVLESYGIAAIAPFSHRLAFDNMPKEIQRLRCKVN  241

Query  363  FRALVFVPHIRALGDALIHRLRYPASK---------------DEGPQKFVAVHLRFDK--  491
            F+ALV+VPHIRALGDAL+ RLRYP+S+                 G  KFV +HLRFDK  
Sbjct  242  FQALVYVPHIRALGDALVSRLRYPSSRVDSTNYLKKVGDSNEKRGAGKFVVLHLRFDKVL  301

Query  492  ---------DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
                     DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  302  SFLDNILTQDMAAHSACDFGGGKAEKLALAKYRQVIWQGR  341



>emb|CDP01562.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   328 bits (840),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 175/211 (83%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSS+FM+IFDVDHFI VLKDDI +VKELPDE+SWSTREYY+
Sbjct  124  KILNATLVIPYLEVNPVWQDSSTFMEIFDVDHFISVLKDDIRVVKELPDEYSWSTREYYA  183

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIR TRIKTAPV ASA+WY ENVLPVL+SYG+AAIAPFSHRL FDNMP +IQ LRCKVN
Sbjct  184  AAIRSTRIKTAPVRASAHWYLENVLPVLQSYGVAAIAPFSHRLDFDNMPMEIQRLRCKVN  243

Query  363  FRALVFVPHIRALGDALIHRLRYPASK-----------------DEGPQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDAL+ RLRY  S+                 D+   KFV +HLRFDK
Sbjct  244  FQALVFVPHIRALGDALVSRLRYSPSRNEMVGDNYIREVSGSRDDQAAGKFVVLHLRFDK  303

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  304  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  334



>ref|XP_009783617.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=512

 Score =   327 bits (838),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 175/210 (83%), Gaps = 16/210 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSS+F DIFDV HFI VLKDDI IVKELPDEFSWSTREYY+
Sbjct  123  KILNATLVIPHLEVNPVWQDSSTFKDIFDVGHFINVLKDDIVIVKELPDEFSWSTREYYA  182

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TA+R TRIKTAPVHAS NWY +NVLPVL+SYGIAAIAPFSHRL FDN+PK +QHLRCKVN
Sbjct  183  TAVRHTRIKTAPVHASTNWYLDNVLPVLQSYGIAAIAPFSHRLTFDNLPKYLQHLRCKVN  242

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD----------------EGPQKFVAVHLRFDKD  494
            F+ALVFVPH+R LGD LI+RLR P+SK                 +G  KFV +HLRFDKD
Sbjct  243  FQALVFVPHVRNLGDVLINRLRDPSSKGNMVGRNYLREVSEKYKQGAGKFVVLHLRFDKD  302

Query  495  MAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            MAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  303  MAAHSACDFGGGKAEKLALAKYRQVIWQGR  332



>ref|XP_002268599.2| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
 emb|CBI38269.3| unnamed protein product [Vitis vinifera]
Length=510

 Score =   326 bits (836),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 175/210 (83%), Gaps = 16/210 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVW+DSSSFMDIFDVDHFI VLKDDISIV+ELP +FSWSTREYY+
Sbjct  121  KILNATLVIPHLEVNPVWRDSSSFMDIFDVDHFINVLKDDISIVRELPYDFSWSTREYYA  180

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIKTAPVHASA WY +NVLPVL SYGIAAIAPFSHRLAF+N+P D+Q LRCKVN
Sbjct  181  TAIRATRIKTAPVHASAKWYLDNVLPVLESYGIAAIAPFSHRLAFNNLPMDVQRLRCKVN  240

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-------------EGPQ---KFVAVHLRFDKD  494
            F+ALVFVPH+RALGDAL+ RLRYP                 +G Q   KF  +HLRFDKD
Sbjct  241  FQALVFVPHVRALGDALVSRLRYPKKNGAFGTEYLQEVTDVKGEQEAGKFAVLHLRFDKD  300

Query  495  MAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            MAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  301  MAAHSACDFGGGKAEKLALAKYRQTIWQGR  330



>ref|XP_007158370.1| hypothetical protein PHAVU_002G147300g [Phaseolus vulgaris]
 gb|ESW30364.1| hypothetical protein PHAVU_002G147300g [Phaseolus vulgaris]
Length=514

 Score =   326 bits (835),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 176/213 (83%), Gaps = 21/213 (10%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLE+NPVW+DSSSF+DIFDVDHFI+VLKDDISIVKELP E+SWSTREYY 
Sbjct  124  KILNATLVIPYLELNPVWRDSSSFVDIFDVDHFIDVLKDDISIVKELPGEYSWSTREYYG  183

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIR TRIK APVHASA+WY ENVLPVL+SYGIAAI+PFSHRL+FDN+P DIQHLRCKVN
Sbjct  184  LAIRETRIKAAPVHASAHWYLENVLPVLQSYGIAAISPFSHRLSFDNLPMDIQHLRCKVN  243

Query  363  FRALVFVPHIRALGDALIHRLRYP-------------------ASKDEGPQKFVAVHLRF  485
            F AL+FVPHIR LGDALI RLR P                   ASK+ G  KFV +HLRF
Sbjct  244  FEALIFVPHIRTLGDALISRLRNPDASAGEMGSNYLQEVTSEGASKNAG--KFVVLHLRF  301

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  302  DKDMAAHSACDFGGGKAEKLALAKYRQVIWQGR  334



>ref|XP_002310868.1| hypothetical protein POPTR_0007s14280g [Populus trichocarpa]
 gb|ABK95421.1| unknown [Populus trichocarpa]
 gb|EEE91318.1| hypothetical protein POPTR_0007s14280g [Populus trichocarpa]
Length=506

 Score =   325 bits (834),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 175/210 (83%), Gaps = 16/210 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+ EVNPVWQDSSSFMDIFDVDHFI VLKDDISIVKELPDEFSWSTREYY+
Sbjct  117  KILNATLVIPHFEVNPVWQDSSSFMDIFDVDHFINVLKDDISIVKELPDEFSWSTREYYA  176

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIR TRIK APVHASANWY ENV PVL+SYGIAA++PFSHRL+FDN+P DIQ LRCKVN
Sbjct  177  IAIRATRIKMAPVHASANWYLENVSPVLQSYGIAAVSPFSHRLSFDNLPMDIQRLRCKVN  236

Query  363  FRALVFVPHIRALGDALIHRLRYP------------ASKD----EGPQKFVAVHLRFDKD  494
            F+ALVFVPHIRALGDAL+ RLR+P             S D    +   KFV +HLRFDKD
Sbjct  237  FQALVFVPHIRALGDALVSRLRHPYKNGAPGASYLQESTDVIDKDSAGKFVVLHLRFDKD  296

Query  495  MAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            MAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  297  MAAHSACDFGGGKAEKLALAKYRQVIWQGR  326



>ref|XP_010277498.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nelumbo nucifera]
Length=396

 Score =   322 bits (825),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 177/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+ EVNPVWQDSSSF +IFDVDHFI+VLKD+ISIVK+LP E+SWSTREYY+
Sbjct  124  KILNATLVIPHFEVNPVWQDSSSFSEIFDVDHFIDVLKDEISIVKDLPKEYSWSTREYYA  183

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIKTAPVHASANWY ENVLPVL+SYGIAAIAPFSHRLAFDN+P DIQ LRCKVN
Sbjct  184  TAIRATRIKTAPVHASANWYLENVLPVLQSYGIAAIAPFSHRLAFDNLPMDIQRLRCKVN  243

Query  363  FRALVFVPHIRALGDALIHRLRYPASK-------------DEGPQ----KFVAVHLRFDK  491
            F+AL FVPHIR LG+ L++RLR PA K             D+G +    KFV +HLRFDK
Sbjct  244  FKALAFVPHIRELGEVLVNRLRRPAGKSALGDNQFLRETTDDGKKWGDGKFVVLHLRFDK  303

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEK++LAKYRQ I  G+
Sbjct  304  DMAAHSACDFGGGKAEKMALAKYRQVIWQGR  334



>ref|XP_008440542.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis melo]
Length=513

 Score =   326 bits (835),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 177/210 (84%), Gaps = 16/210 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVW+DSSSF+DIFDVDHFI VLKDDISIV+ELP EFSWSTREYY+
Sbjct  124  KILNATLVIPHLEVNPVWKDSSSFVDIFDVDHFINVLKDDISIVQELPAEFSWSTREYYA  183

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASA WY ENVLPVL+SYGIAAIAPFSHRLAF+N+P +IQ LRCKVN
Sbjct  184  TAIRATRVKTAPVHASAKWYLENVLPVLQSYGIAAIAPFSHRLAFENLPDEIQRLRCKVN  243

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG----------------PQKFVAVHLRFDKD  494
            F+AL FVPHI+ LGDALI+RLRYP +K E                 P KFV +HLRFDKD
Sbjct  244  FQALNFVPHIQELGDALINRLRYPLNKKEPTEGNYLSMTTDANEQRPLKFVVLHLRFDKD  303

Query  495  MAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            MAAHSACDFGGGKAEKL+LAKYRQ +  G+
Sbjct  304  MAAHSACDFGGGKAEKLALAKYRQVLWQGR  333



>gb|KCW54611.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=484

 Score =   325 bits (832),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 174/210 (83%), Gaps = 16/210 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSF DIFDV+HFI+VLKDDI IV++LPDEFSWSTREYY+
Sbjct  95   KILNATLVIPYLEVNPVWQDSSSFGDIFDVEHFIDVLKDDIRIVRDLPDEFSWSTREYYA  154

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIRPTRIKTAPV A+ NWY ENV PVL+SYGIAAIAPFSHRL +DN+P DIQ LRCKVN
Sbjct  155  TAIRPTRIKTAPVRATVNWYLENVSPVLQSYGIAAIAPFSHRLTYDNLPMDIQRLRCKVN  214

Query  363  FRALVFVPHIRALGDALIHRLRYPA----------------SKDEGPQKFVAVHLRFDKD  494
            F  L+FVPHIRALGD+L++RLRYP+                S  +   KFV +HLRFDKD
Sbjct  215  FEGLIFVPHIRALGDSLVNRLRYPSDDSRATAGNYLREVTDSTAKKAGKFVVLHLRFDKD  274

Query  495  MAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            MAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  275  MAAHSACDFGGGKAEKLALAKYRQVIWQGR  304



>ref|XP_010113429.1| hypothetical protein L484_026763 [Morus notabilis]
 gb|EXC35456.1| hypothetical protein L484_026763 [Morus notabilis]
Length=553

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 171/208 (82%), Gaps = 14/208 (7%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVW+DSSSF DIFDV HFI VLKDD+SIV+ELP EFSWSTRE+YS
Sbjct  166  KILNATLVIPYLEVNPVWRDSSSFEDIFDVHHFINVLKDDVSIVRELPYEFSWSTREFYS  225

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIKTAPVHASANWY ENVLPVL SYGIAAI+PFSHRLAFDN+P DIQ LRCKVN
Sbjct  226  TAIRTTRIKTAPVHASANWYLENVLPVLESYGIAAISPFSHRLAFDNLPMDIQRLRCKVN  285

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG--------------PQKFVAVHLRFDKDMA  500
            F AL FVPH+RALGDAL+ RLRYP+                     KFV +HLRFDKDMA
Sbjct  286  FHALAFVPHVRALGDALVSRLRYPSETRTTLGTTYLRETADRRRAGKFVVLHLRFDKDMA  345

Query  501  AHSACDFGGGKAEKLSLAKYRQNILAGK  584
            AHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  346  AHSACDFGGGKAEKLALAKYRQTIWQGR  373



>gb|KCW54609.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=506

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 174/210 (83%), Gaps = 16/210 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSF DIFDV+HFI+VLKDDI IV++LPDEFSWSTREYY+
Sbjct  116  KILNATLVIPYLEVNPVWQDSSSFGDIFDVEHFIDVLKDDIRIVRDLPDEFSWSTREYYA  175

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIRPTRIKTAPV A+ NWY ENV PVL+SYGIAAIAPFSHRL +DN+P DIQ LRCKVN
Sbjct  176  TAIRPTRIKTAPVRATVNWYLENVSPVLQSYGIAAIAPFSHRLTYDNLPMDIQRLRCKVN  235

Query  363  FRALVFVPHIRALGDALIHRLRYPA----------------SKDEGPQKFVAVHLRFDKD  494
            F  L+FVPHIRALGD+L++RLRYP+                S  +   KFV +HLRFDKD
Sbjct  236  FEGLIFVPHIRALGDSLVNRLRYPSDDSRATAGNYLREVTDSTAKKAGKFVVLHLRFDKD  295

Query  495  MAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            MAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  296  MAAHSACDFGGGKAEKLALAKYRQVIWQGR  325



>gb|KHN14510.1| DUF246 domain-containing protein [Glycine soja]
Length=516

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 171/211 (81%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLE+NPVW+DSSSFMDIFDVDHFI+VLKDDISIVKELP EF+WSTREYY 
Sbjct  126  KILNATLVIPYLELNPVWRDSSSFMDIFDVDHFIDVLKDDISIVKELPKEFAWSTREYYG  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIR TRIK APVHASA WY ENVLPVL+SYGIAAI+PFSHRL+FDN+P DIQHLRCKVN
Sbjct  186  LAIRETRIKAAPVHASAYWYLENVLPVLQSYGIAAISPFSHRLSFDNLPVDIQHLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F+AL FV HIR LGDALI RLRYP    E                    KFV +HLRFDK
Sbjct  246  FQALTFVSHIRTLGDALISRLRYPQGSAEEMGFNYLQEVTGAGARKSAGKFVVLHLRFDK  305

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  306  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  336



>ref|XP_004237994.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
Length=516

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 170/209 (81%), Gaps = 15/209 (7%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSF DIFDVDHFI VL  DISIVKELP ++SWSTREYY+
Sbjct  128  KILNATLVIPYLEVNPVWQDSSSFADIFDVDHFISVLSGDISIVKELPSDYSWSTREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IRPTRIKTAPVHASA+WY ENVLPV++SYGI AIAPFSHRLAFDN P DIQHLRCKVN
Sbjct  188  TGIRPTRIKTAPVHASASWYQENVLPVMQSYGIVAIAPFSHRLAFDNQPSDIQHLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE---------------GPQKFVAVHLRFDKDM  497
            F ALVFVPH+R LGDAL+ RLR P   +                G  K+V +HLRFDKDM
Sbjct  248  FHALVFVPHVRRLGDALVSRLRSPPGLNNASSATDFHNWENDRAGAGKYVVLHLRFDKDM  307

Query  498  AAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            AAHSACDFGGGKAEKL+LAKYRQ +  G+
Sbjct  308  AAHSACDFGGGKAEKLALAKYRQVLWQGR  336



>ref|XP_010680342.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=506

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/210 (73%), Positives = 180/210 (86%), Gaps = 16/210 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP LEVNPVW+D+SSF +IFDVDHFI+VLKDDI+IVKELP E++WSTRE+YS
Sbjct  117  KILNATLVIPLLEVNPVWKDTSSFEEIFDVDHFIDVLKDDINIVKELPFEYAWSTREFYS  176

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHAS +WY +NVLP+L+SYGIAAI+PFSHRLAFDNMP+DIQ LRCKVN
Sbjct  177  TAIRETRVKTAPVHASVHWYPDNVLPILQSYGIAAISPFSHRLAFDNMPEDIQRLRCKVN  236

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE----------------GPQKFVAVHLRFDKD  494
            F+AL FVPHIRALGDAL++RL+YP+S+ E                 PQKFV +HLRFDKD
Sbjct  237  FQALTFVPHIRALGDALVNRLQYPSSRSEPEHGLLQQFNYRKGYREPQKFVVLHLRFDKD  296

Query  495  MAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            MAAHSACDFGGGKAEKL+LA+YRQ +  G+
Sbjct  297  MAAHSACDFGGGKAEKLALARYRQVMWQGR  326



>ref|XP_003517397.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
Length=516

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 174/213 (82%), Gaps = 21/213 (10%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLE+NPVW+DSSSFMDIFDVDHFI+VLKDDISIVKELP EF+WSTREYY 
Sbjct  126  KILNATLVIPYLELNPVWRDSSSFMDIFDVDHFIDVLKDDISIVKELPKEFAWSTREYYG  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIR TRIK APVHASA WY ENVLPVL+SYGIAAI+PFSHRL+FDN+P DIQHLRCKVN
Sbjct  186  LAIRETRIKAAPVHASAYWYLENVLPVLQSYGIAAISPFSHRLSFDNLPVDIQHLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLRYP-------------------ASKDEGPQKFVAVHLRF  485
            F+AL FV HIR LGDALI RLRYP                   A K+ G  KFV +HLRF
Sbjct  246  FQALTFVSHIRTLGDALISRLRYPQGSAEEMGFNYLQEVTGAGARKNAG--KFVVLHLRF  303

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  304  DKDMAAHSACDFGGGKAEKLALAKYRQVIWQGR  336



>ref|XP_010027954.1| PREDICTED: uncharacterized protein At1g04910 [Eucalyptus grandis]
 gb|KCW54610.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=505

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 174/210 (83%), Gaps = 16/210 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSF DIFDV+HFI+VLKDDI IV++LPDEFSWSTREYY+
Sbjct  116  KILNATLVIPYLEVNPVWQDSSSFGDIFDVEHFIDVLKDDIRIVRDLPDEFSWSTREYYA  175

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIRPTRIKTAPV A+ NWY ENV PVL+SYGIAAIAPFSHRL +DN+P DIQ LRCKVN
Sbjct  176  TAIRPTRIKTAPVRATVNWYLENVSPVLQSYGIAAIAPFSHRLTYDNLPMDIQRLRCKVN  235

Query  363  FRALVFVPHIRALGDALIHRLRYPA----------------SKDEGPQKFVAVHLRFDKD  494
            F  L+FVPHIRALGD+L++RLRYP+                S  +   KFV +HLRFDKD
Sbjct  236  FEGLIFVPHIRALGDSLVNRLRYPSDDSRATAGNYLREVTDSTAKKAGKFVVLHLRFDKD  295

Query  495  MAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            MAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  296  MAAHSACDFGGGKAEKLALAKYRQVIWQGR  325



>ref|XP_010523310.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Tarenaya hassleriana]
Length=445

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 177/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+PYLEVNPVWQDSSSF++IFDVDHFI+VLKDD+ I+KELP++FSWSTREYY+
Sbjct  55   KILNATLVVPYLEVNPVWQDSSSFVEIFDVDHFIDVLKDDVRIIKELPEKFSWSTREYYA  114

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASANWY ENVLPVL S+GIAAIAPFSHRL+FD++P +IQ LRCKVN
Sbjct  115  TAIRETRVKTAPVHASANWYLENVLPVLESFGIAAIAPFSHRLSFDHLPPEIQRLRCKVN  174

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            FRAL FVPH+R LGDAL+ RLR P+ ++                 + P KFV +HLRFDK
Sbjct  175  FRALRFVPHVRELGDALVSRLRNPSWRNKEQNVDHLTDITNSHSRQEPGKFVVLHLRFDK  234

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  235  DMAAHSACDFGGGKAEKLALAKYRQMIWQGR  265



>ref|XP_006573005.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=515

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 171/211 (81%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLE+NPVW+DSSSFMDIFDVDHFI+VLKDDISIVKELP EF+WSTREYY 
Sbjct  125  KILNATLVIPYLELNPVWRDSSSFMDIFDVDHFIDVLKDDISIVKELPKEFAWSTREYYG  184

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIR TRIK APVHASA WY ENVLPVL+SYGIAAI+PFSHRL+FDN+P DIQHLRCKVN
Sbjct  185  LAIRETRIKAAPVHASAYWYLENVLPVLQSYGIAAISPFSHRLSFDNLPVDIQHLRCKVN  244

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F+AL FV HIR LGDALI RLRYP    E                    KFV +HLRFDK
Sbjct  245  FQALTFVSHIRTLGDALISRLRYPQGSAEEMGFNYLQEVTGAGARKNAGKFVVLHLRFDK  304

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  305  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  335



>gb|EYU39303.1| hypothetical protein MIMGU_mgv1a004838mg [Erythranthe guttata]
Length=507

 Score =   324 bits (830),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 173/196 (88%), Gaps = 2/196 (1%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVW+DSS+FMDIFDVDHFI +LKDDI IVKELP+E+ WSTREYY+
Sbjct  131  KILNATLVIPHLEVNPVWKDSSTFMDIFDVDHFINILKDDIKIVKELPEEYFWSTREYYA  190

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASANWY ENVLP+L+SYGIAAIAPFSHRLAFDNMP +IQ LRCKVN
Sbjct  191  TAIRATRVKTAPVHASANWYIENVLPLLQSYGIAAIAPFSHRLAFDNMPNEIQRLRCKVN  250

Query  363  FRALVFVPHIRALGDALIHRLRYPASK--DEGPQKFVAVHLRFDKDMAAHSACDFGGGKA  536
            F+AL FVPHI++LG  L+ RLRY  ++   +   KFV +HLRFDKDMAAHSACDFGGGKA
Sbjct  251  FQALTFVPHIKSLGHDLVTRLRYSPTQVNKKATGKFVVLHLRFDKDMAAHSACDFGGGKA  310

Query  537  EKLSLAKYRQNILAGK  584
            EKL+LAKYRQ I  G+
Sbjct  311  EKLALAKYRQVIWQGR  326



>ref|XP_010277497.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nelumbo nucifera]
Length=514

 Score =   323 bits (829),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 177/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+ EVNPVWQDSSSF +IFDVDHFI+VLKD+ISIVK+LP E+SWSTREYY+
Sbjct  124  KILNATLVIPHFEVNPVWQDSSSFSEIFDVDHFIDVLKDEISIVKDLPKEYSWSTREYYA  183

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIKTAPVHASANWY ENVLPVL+SYGIAAIAPFSHRLAFDN+P DIQ LRCKVN
Sbjct  184  TAIRATRIKTAPVHASANWYLENVLPVLQSYGIAAIAPFSHRLAFDNLPMDIQRLRCKVN  243

Query  363  FRALVFVPHIRALGDALIHRLRYPASK-------------DEGPQ----KFVAVHLRFDK  491
            F+AL FVPHIR LG+ L++RLR PA K             D+G +    KFV +HLRFDK
Sbjct  244  FKALAFVPHIRELGEVLVNRLRRPAGKSALGDNQFLRETTDDGKKWGDGKFVVLHLRFDK  303

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEK++LAKYRQ I  G+
Sbjct  304  DMAAHSACDFGGGKAEKMALAKYRQVIWQGR  334



>gb|AAB72114.1| PsRT17-1 [Pisum sativum]
Length=406

 Score =   320 bits (820),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 173/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLE+NPVW+DSSSF D  DVDHFI+VLKDD++IVKELP+E++WS+REYY+
Sbjct  52   KILNATLVIPYLELNPVWKDSSSFEDYIDVDHFIDVLKDDVTIVKELPEEYAWSSREYYT  111

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIR TRIK APVHA+ANWY ENVLPVL+SYGIAAI+PFSHRL FDN+P DIQHLRCKVN
Sbjct  112  LAIRDTRIKAAPVHATANWYLENVLPVLQSYGIAAISPFSHRLTFDNLPMDIQHLRCKVN  171

Query  363  FRALVFVPHIRALGDALIHRLRYPA-SKDE----------------GPQKFVAVHLRFDK  491
            F+ALVFVPHIR LGDALI RLR P  S DE                   KFV +HLRFDK
Sbjct  172  FQALVFVPHIRTLGDALISRLRNPQHSTDEMGSNYLQEVTDADDSKNAGKFVVLHLRFDK  231

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  232  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  262



>ref|XP_006472461.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
 ref|XP_006472462.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Citrus sinensis]
Length=517

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 174/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+P+LEVNPVW+DSSSF DIFDVDHFI  L+D+ISIVKELP E+SWS+REYY+
Sbjct  127  KILNATLVLPHLEVNPVWRDSSSFADIFDVDHFISSLRDEISIVKELPSEYSWSSREYYA  186

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASANWY ENVLP+L+SYGIAAIAPFSHRLAFDN+P +IQHLRCKVN
Sbjct  187  TGIRDTRIKTAPVHASANWYLENVLPILQSYGIAAIAPFSHRLAFDNLPTNIQHLRCKVN  246

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F+ALVFVPHIR LG+ ++HRLR+P  K +                 G  KF  +HLRFDK
Sbjct  247  FQALVFVPHIRKLGETIVHRLRHPPGKLQASGTEFHKGRIGDSEVTGAGKFTVLHLRFDK  306

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  307  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  337



>gb|EPS72903.1| hypothetical protein M569_01846, partial [Genlisea aurea]
Length=497

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 173/206 (84%), Gaps = 12/206 (6%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            K+LNATLVIPYLEVN VWQD+SSF DIFDVDHFI VLKDD+SIVKELP E+ WSTREYY+
Sbjct  113  KLLNATLVIPYLEVNSVWQDTSSFGDIFDVDHFINVLKDDVSIVKELPTEYFWSTREYYA  172

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR  R+K APVHASANWY ENVLPV++SYG+AAIAPFSHRLAFDNMP DIQ LRCKVN
Sbjct  173  TAIRANRVKAAPVHASANWYLENVLPVIQSYGVAAIAPFSHRLAFDNMPSDIQRLRCKVN  232

Query  363  FRALVFVPHIRALGDALIHRLRYPA------------SKDEGPQKFVAVHLRFDKDMAAH  506
            F+ALVFVP +R+LGDAL++RLR P             +++ G  KFV +HLRFDKDMAAH
Sbjct  233  FQALVFVPLVRSLGDALVNRLRSPPDAATELREVSLINENAGSGKFVVLHLRFDKDMAAH  292

Query  507  SACDFGGGKAEKLSLAKYRQNILAGK  584
            SACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  293  SACDFGGGKAEKLALAKYRQTIWQGR  318



>ref|XP_007018221.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOY15446.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=540

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 175/211 (83%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            K+LNATLVIP+LEVNPVWQDSSSF DIFDVDHFI VL+D++SIVKELP E+SWSTREYY+
Sbjct  150  KVLNATLVIPHLEVNPVWQDSSSFTDIFDVDHFINVLRDEVSIVKELPREYSWSTREYYA  209

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASANWY ENVLPVL+SYGIAAI+PFSHRLAFD +P  +QHLRCKVN
Sbjct  210  TGIRATRIKTAPVHASANWYLENVLPVLQSYGIAAISPFSHRLAFDKLPMKLQHLRCKVN  269

Query  363  FRALVFVPHIRALGDALIHRLRYPASK-----------------DEGPQKFVAVHLRFDK  491
            F+ALVFVP IR++G+ L+H+LRYP+ K                  EG  K+V +HLRFDK
Sbjct  270  FQALVFVPQIRSIGETLVHQLRYPSGKLQASAVEVLRGRIDDTEKEGAGKYVVLHLRFDK  329

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ +  G+
Sbjct  330  DMAAHSACDFGGGKAEKLALAKYRQVLWQGR  360



>ref|XP_006472463.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Citrus sinensis]
Length=514

 Score =   322 bits (825),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 174/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+P+LEVNPVW+DSSSF DIFDVDHFI  L+D+ISIVKELP E+SWS+REYY+
Sbjct  124  KILNATLVLPHLEVNPVWRDSSSFADIFDVDHFISSLRDEISIVKELPSEYSWSSREYYA  183

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASANWY ENVLP+L+SYGIAAIAPFSHRLAFDN+P +IQHLRCKVN
Sbjct  184  TGIRDTRIKTAPVHASANWYLENVLPILQSYGIAAIAPFSHRLAFDNLPTNIQHLRCKVN  243

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F+ALVFVPHIR LG+ ++HRLR+P  K +                 G  KF  +HLRFDK
Sbjct  244  FQALVFVPHIRKLGETIVHRLRHPPGKLQASGTEFHKGRIGDSEVTGAGKFTVLHLRFDK  303

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  304  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  334



>ref|XP_010523312.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=517

 Score =   322 bits (825),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 177/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+PYLEVNPVWQDSSSF++IFDVDHFI+VLKDD+ I+KELP++FSWSTREYY+
Sbjct  127  KILNATLVVPYLEVNPVWQDSSSFVEIFDVDHFIDVLKDDVRIIKELPEKFSWSTREYYA  186

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASANWY ENVLPVL S+GIAAIAPFSHRL+FD++P +IQ LRCKVN
Sbjct  187  TAIRETRVKTAPVHASANWYLENVLPVLESFGIAAIAPFSHRLSFDHLPPEIQRLRCKVN  246

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            FRAL FVPH+R LGDAL+ RLR P+ ++                 + P KFV +HLRFDK
Sbjct  247  FRALRFVPHVRELGDALVSRLRNPSWRNKEQNVDHLTDITNSHSRQEPGKFVVLHLRFDK  306

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  307  DMAAHSACDFGGGKAEKLALAKYRQMIWQGR  337



>ref|XP_006338062.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=516

 Score =   322 bits (824),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 170/209 (81%), Gaps = 15/209 (7%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSF DIFDVDHFI  L +DISIVKELP ++SWSTREYY+
Sbjct  128  KILNATLVIPYLEVNPVWQDSSSFADIFDVDHFISALSNDISIVKELPSDYSWSTREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA+WY ENVLPV++SYGIAAIAPFSHRLAFD+ P DIQHLRCKVN
Sbjct  188  TGIRATRIKTAPVHASASWYLENVLPVMQSYGIAAIAPFSHRLAFDSQPSDIQHLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE---------------GPQKFVAVHLRFDKDM  497
            F ALVFVPH+R LGDAL+  LR P S D                G  K+V +HLRFDKDM
Sbjct  248  FHALVFVPHVRTLGDALVSHLRSPPSLDNASSATHFHKGENDRAGAGKYVVLHLRFDKDM  307

Query  498  AAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            AAHSACDFGGGKAEKL+LAKYRQ +  G+
Sbjct  308  AAHSACDFGGGKAEKLALAKYRQVLWQGR  336



>ref|XP_003613049.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES96007.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=503

 Score =   321 bits (823),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 174/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLE+NPVW+DSSSF DIFDVDHFI+VLKDD+SIVKELP+E+SWS+REYY+
Sbjct  113  KILNATLVIPYLELNPVWKDSSSFEDIFDVDHFIDVLKDDVSIVKELPEEYSWSSREYYA  172

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIR TRIK APVHA+ANWY ENVLPVL+SYG+AAI+PFSHRL+FDN+P DIQHLRCKVN
Sbjct  173  LAIRDTRIKAAPVHATANWYLENVLPVLQSYGVAAISPFSHRLSFDNVPMDIQHLRCKVN  232

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F+AL FVPHIRALGD+LI RLR P    E                    KFV +HLRFDK
Sbjct  233  FQALDFVPHIRALGDSLISRLRNPQRSSEEMNSNYLQEVTNVDDNKNAGKFVVLHLRFDK  292

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  293  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  323



>ref|XP_010523308.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010523309.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Tarenaya hassleriana]
Length=517

 Score =   322 bits (824),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 177/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+PYLEVNPVWQDSSSF++IFDVDHFI+VLKDD+ I+KELP++FSWSTREYY+
Sbjct  127  KILNATLVVPYLEVNPVWQDSSSFVEIFDVDHFIDVLKDDVRIIKELPEKFSWSTREYYA  186

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASANWY ENVLPVL S+GIAAIAPFSHRL+FD++P +IQ LRCKVN
Sbjct  187  TAIRETRVKTAPVHASANWYLENVLPVLESFGIAAIAPFSHRLSFDHLPPEIQRLRCKVN  246

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            FRAL FVPH+R LGDAL+ RLR P+ ++                 + P KFV +HLRFDK
Sbjct  247  FRALRFVPHVRELGDALVSRLRNPSWRNKEQNVDHLTDITNSHSRQEPGKFVVLHLRFDK  306

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  307  DMAAHSACDFGGGKAEKLALAKYRQMIWQGR  337



>ref|XP_009624657.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=516

 Score =   321 bits (823),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 169/209 (81%), Gaps = 15/209 (7%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQD SSF DIFDVDHFI +L  D+S+VKELP E+SWSTREYY+
Sbjct  128  KILNATLVIPYLEVNPVWQDPSSFADIFDVDHFINILSGDVSVVKELPSEYSWSTREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA WY ENVLPV++SYGI AIAPFSHRLAFDN+P DIQHLRCKVN
Sbjct  188  TGIRATRIKTAPVHASATWYLENVLPVMQSYGIVAIAPFSHRLAFDNLPSDIQHLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE---------------GPQKFVAVHLRFDKDM  497
            F ALVFVPH+R LGD L+ RLR P S ++               G  K+V +HLRFDKDM
Sbjct  248  FNALVFVPHVRTLGDTLVSRLRSPPSMNKASSATHFHDRENDRAGAGKYVVLHLRFDKDM  307

Query  498  AAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            AAHSACDFGGGKAEKL+LAKYRQ +  G+
Sbjct  308  AAHSACDFGGGKAEKLALAKYRQVLWQGR  336



>ref|XP_010937178.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=560

 Score =   322 bits (826),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 173/208 (83%), Gaps = 14/208 (7%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVW+DSSSF DI+DVDHFI VLKD+ISIV+ELP EFSWSTREYY+
Sbjct  173  KILNATLVIPHLEVNPVWKDSSSFEDIYDVDHFISVLKDEISIVRELPQEFSWSTREYYA  232

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIR TR+KTAPVHASANWY ENV P+L+SYGIAAIAPFSHRLAFDN+P ++Q LRCKVN
Sbjct  233  VAIRATRVKTAPVHASANWYIENVAPILQSYGIAAIAPFSHRLAFDNLPGELQQLRCKVN  292

Query  363  FRALVFVPHIRALGDALIHRLRYPASK--------------DEGPQKFVAVHLRFDKDMA  500
            F+ALVFVPHI ALG+AL+ RLRYP  K              D    KFV +HLRFDKDMA
Sbjct  293  FQALVFVPHINALGEALVKRLRYPVGKHSDEYIQEVVDENVDAASGKFVVLHLRFDKDMA  352

Query  501  AHSACDFGGGKAEKLSLAKYRQNILAGK  584
            AHSACDFGGGKAE+L+LAKYRQ I  G+
Sbjct  353  AHSACDFGGGKAERLALAKYRQVIWQGR  380



>gb|AFK40388.1| unknown [Lotus japonicus]
Length=502

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 175/213 (82%), Gaps = 21/213 (10%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLE+NPVW+DSSSFMDIFDVDHFI+VLKDDISIVKELP+E+SWSTREYY+
Sbjct  112  KILNATLVIPYLELNPVWRDSSSFMDIFDVDHFIDVLKDDISIVKELPEEYSWSTREYYA  171

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             A+R TRI  +PVHASANWY ENVLPVL+S+GIAAI+PFSHRL+FDN+P DIQHLRCKVN
Sbjct  172  IAVRDTRINNSPVHASANWYLENVLPVLQSFGIAAISPFSHRLSFDNLPMDIQHLRCKVN  231

Query  363  FRALVFVPHIRALGDALIHRLRYPA-------------------SKDEGPQKFVAVHLRF  485
             +AL FVPHIR LGDALI+RLR P                    SK+ G  KFV +HLRF
Sbjct  232  LQALEFVPHIRTLGDALINRLRSPQGSAGEIGSNYLQEVTDGGDSKNAG--KFVVLHLRF  289

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEK +LAKYRQ I  G+
Sbjct  290  DKDMAAHSACDFGGGKAEKFALAKYRQVIWQGR  322



>ref|XP_006280335.1| hypothetical protein CARUB_v10026260mg [Capsella rubella]
 gb|EOA13233.1| hypothetical protein CARUB_v10026260mg [Capsella rubella]
Length=508

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 177/213 (83%), Gaps = 19/213 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQD+SSF+DIFDVDHFI+ LKDDI +V+ELPDE+SWSTREYYS
Sbjct  116  KILNATLVIPYLEVNPVWQDTSSFVDIFDVDHFIDALKDDIRVVRELPDEYSWSTREYYS  175

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TA+R TR+KTAPVHASANWY ENV PVL+SYGIAAI+PFSHRL+FD++P +IQ LRCKVN
Sbjct  176  TAVRETRVKTAPVHASANWYMENVSPVLQSYGIAAISPFSHRLSFDHLPAEIQRLRCKVN  235

Query  363  FRALVFVPHIRALGDALIHRLRYPA---SKDEG----------------PQKFVAVHLRF  485
            F+AL FVPHIR+LGDAL+ RLR P+   +KD+                 P KF  +HLRF
Sbjct  236  FQALRFVPHIRSLGDALVSRLRNPSWRNNKDQKNVDHLRDMTNSHSRQEPGKFAVLHLRF  295

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  296  DKDMAAHSACDFGGGKAEKLALAKYRQMIWQGR  328



>ref|XP_006433827.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
 gb|ESR47067.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
Length=517

 Score =   319 bits (818),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 173/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+P+LEVNPVW+DSSSF DIFDVDHFI  L+D+ISIVKELP E+SWS+REYY+
Sbjct  127  KILNATLVLPHLEVNPVWRDSSSFADIFDVDHFISSLRDEISIVKELPSEYSWSSREYYA  186

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASANWY ENVLP+L+SYGIAAIAPFSHRLAFDN+P +IQHLRCKVN
Sbjct  187  TGIRDTRIKTAPVHASANWYLENVLPILQSYGIAAIAPFSHRLAFDNLPTNIQHLRCKVN  246

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F+ALVFVPHIR LG+ ++H LR+P  K +                 G  KF  +HLRFDK
Sbjct  247  FQALVFVPHIRKLGETIVHLLRHPPGKLQASGTEFHKGRIGDSEVTGAGKFTVLHLRFDK  306

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  307  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  337



>ref|XP_010463027.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=508

 Score =   319 bits (817),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 175/213 (82%), Gaps = 19/213 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQD+SSF+DIFDVDHFI+ LKDDI +V+ELPDE+SWSTREYY 
Sbjct  116  KILNATLVIPYLEVNPVWQDTSSFVDIFDVDHFIDSLKDDIRVVRELPDEYSWSTREYYG  175

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TA+R TR+KTAPVHASANWY ENV PVL+SYGIAAI+PFSHRL+FD++P DIQ LRCKVN
Sbjct  176  TAVRETRVKTAPVHASANWYIENVSPVLQSYGIAAISPFSHRLSFDHLPADIQRLRCKVN  235

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-------------------EGPQKFVAVHLRF  485
            F+AL FVPHIR+LGDAL+ RLR P+ ++                   + P KF  +HLRF
Sbjct  236  FQALRFVPHIRSLGDALVSRLRNPSWRNNKEQNNVDHLRAMTNSHSRQEPGKFAVLHLRF  295

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  296  DKDMAAHSACDFGGGKAEKLALAKYRQMIWQGR  328



>ref|XP_006433826.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
 gb|ESR47066.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
Length=514

 Score =   319 bits (817),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 173/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+P+LEVNPVW+DSSSF DIFDVDHFI  L+D+ISIVKELP E+SWS+REYY+
Sbjct  124  KILNATLVLPHLEVNPVWRDSSSFADIFDVDHFISSLRDEISIVKELPSEYSWSSREYYA  183

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASANWY ENVLP+L+SYGIAAIAPFSHRLAFDN+P +IQHLRCKVN
Sbjct  184  TGIRDTRIKTAPVHASANWYLENVLPILQSYGIAAIAPFSHRLAFDNLPTNIQHLRCKVN  243

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F+ALVFVPHIR LG+ ++H LR+P  K +                 G  KF  +HLRFDK
Sbjct  244  FQALVFVPHIRKLGETIVHLLRHPPGKLQASGTEFHKGRIGDSEVTGAGKFTVLHLRFDK  303

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  304  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  334



>ref|XP_010444520.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=507

 Score =   318 bits (814),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 175/213 (82%), Gaps = 19/213 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQD+SSF+DIFDVDHFI+ LKDDI +V+ELPDE+SWSTREYY 
Sbjct  115  KILNATLVIPYLEVNPVWQDTSSFVDIFDVDHFIDSLKDDIRVVRELPDEYSWSTREYYG  174

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TA+R TR+KTAPVHASANWY ENV PVL+SYGIAAI+PFSHRL+FD++P DI+ LRCKVN
Sbjct  175  TAVRETRVKTAPVHASANWYIENVSPVLQSYGIAAISPFSHRLSFDHLPADIERLRCKVN  234

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-------------------EGPQKFVAVHLRF  485
            F+AL FVPHIR+LGDAL+ RLR P+ ++                   + P KF  +HLRF
Sbjct  235  FQALRFVPHIRSLGDALVSRLRNPSWRNNKEQTNVDHLREMTNSHSRQEPGKFAVLHLRF  294

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  295  DKDMAAHSACDFGGGKAEKLALAKYRQMIWQGR  327



>ref|XP_010254530.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=522

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 173/210 (82%), Gaps = 16/210 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+ EVNPVWQDSSSF +IFDVDHFI VLKD+ISIVKELP E+SWSTREYY+
Sbjct  124  KILNATLVIPHFEVNPVWQDSSSFSEIFDVDHFINVLKDEISIVKELPKEYSWSTREYYA  183

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIKT PVHASANWY ENVLPVL+SYGIAAIAPFSHRLAFDN+P +IQ LRCKVN
Sbjct  184  TAIRATRIKTTPVHASANWYLENVLPVLQSYGIAAIAPFSHRLAFDNLPMEIQRLRCKVN  243

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE--GPQ--------------KFVAVHLRFDKD  494
            F+ALVFVPHIR LG+ L+ RLR+P  ++   G +              KF  +HLRFDKD
Sbjct  244  FQALVFVPHIRELGETLVSRLRHPPGRNALVGNEYLQKTTERNKLEAGKFAVLHLRFDKD  303

Query  495  MAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            MAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  304  MAAHSACDFGGGKAEKLALAKYRQVIWQGR  333



>ref|XP_008802622.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Phoenix 
dactylifera]
Length=495

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 175/208 (84%), Gaps = 14/208 (7%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVW+DSSSF +I+DVDHFI VLKD+IS+V+ELP EFSWSTREYY+
Sbjct  168  KILNATLVIPHLEVNPVWKDSSSFEEIYDVDHFINVLKDEISVVRELPQEFSWSTREYYA  227

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIR TR+KTAPVHASA WY ENVLP+++SYGIAAIAPFSHRLAFDN+P +IQ LRCKVN
Sbjct  228  VAIRATRVKTAPVHASAYWYLENVLPIVQSYGIAAIAPFSHRLAFDNLPGEIQRLRCKVN  287

Query  363  FRALVFVPHIRALGDALIHRLRYPAS--KDEGPQ------------KFVAVHLRFDKDMA  500
            F+ALVFVPHI ALG+AL+ RLRYP S   DE  Q            KFV +HLRFDKDMA
Sbjct  288  FQALVFVPHINALGEALVKRLRYPVSVHSDEYIQEVVDENVPVASGKFVVLHLRFDKDMA  347

Query  501  AHSACDFGGGKAEKLSLAKYRQNILAGK  584
            AHSACDFGGGKAE+L+LAKYRQ I  G+
Sbjct  348  AHSACDFGGGKAERLALAKYRQVIWQGR  375



>gb|ABJ96379.1| expressed protein [Prunus persica]
Length=517

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 176/210 (84%), Gaps = 16/210 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+P+LEVNPVWQDSSSF +IFD+DHFIEVL+D++SIVK+LP EFSWSTREYY+
Sbjct  128  KILNATLVVPHLEVNPVWQDSSSFEEIFDLDHFIEVLRDEVSIVKDLPSEFSWSTREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHAS++WY ENVLP+L+ YG+AAI+PFSHRL F+N+PK+IQ LRCKVN
Sbjct  188  TGIRITRIKTAPVHASSDWYLENVLPILQRYGVAAISPFSHRLTFENLPKNIQRLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD----------------EGPQKFVAVHLRFDKD  494
            F+AL FVPHIR LG+ L++RLRYP +++                +G  KFV +HLRFDKD
Sbjct  248  FKALAFVPHIRELGETLVNRLRYPPNRNQDAASDSQDGTNQIEKQGAGKFVVLHLRFDKD  307

Query  495  MAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            MAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  308  MAAHSACDFGGGKAEKLALAKYRQVIWQGR  337



>ref|XP_007222858.1| hypothetical protein PRUPE_ppa004255mg [Prunus persica]
 gb|EMJ24057.1| hypothetical protein PRUPE_ppa004255mg [Prunus persica]
Length=520

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 176/210 (84%), Gaps = 16/210 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+P+LEVNPVWQDSSSF +IFD+DHFIEVL+D++SIVK+LP EFSWSTREYY+
Sbjct  131  KILNATLVVPHLEVNPVWQDSSSFEEIFDLDHFIEVLRDEVSIVKDLPSEFSWSTREYYA  190

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHAS++WY ENVLP+L+ YG+AAI+PFSHRL F+N+PK+IQ LRCKVN
Sbjct  191  TGIRITRIKTAPVHASSDWYLENVLPILQRYGVAAISPFSHRLTFENLPKNIQRLRCKVN  250

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD----------------EGPQKFVAVHLRFDKD  494
            F+AL FVPHIR LG+ L++RLRYP +++                +G  KFV +HLRFDKD
Sbjct  251  FKALAFVPHIRELGETLVNRLRYPPNRNQDAASDSQDGTNQIEKQGAGKFVVLHLRFDKD  310

Query  495  MAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            MAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  311  MAAHSACDFGGGKAEKLALAKYRQVIWQGR  340



>ref|XP_010484355.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=508

 Score =   317 bits (811),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 174/213 (82%), Gaps = 19/213 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQD+SSF+DIFDVDHFI+ LKDDI +V+ELP E+SWSTREYY 
Sbjct  116  KILNATLVIPYLEVNPVWQDTSSFVDIFDVDHFIDSLKDDIRVVRELPGEYSWSTREYYG  175

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TA+R TR+KTAPVHASANWY ENV PVL+SYGIAAI+PFSHRL+FD++P DIQ LRCKVN
Sbjct  176  TAVRETRVKTAPVHASANWYIENVSPVLQSYGIAAISPFSHRLSFDHLPADIQRLRCKVN  235

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-------------------EGPQKFVAVHLRF  485
            F+AL FVPHIR+LGDAL+ RLR P+ ++                   + P KF  +HLRF
Sbjct  236  FQALRFVPHIRSLGDALVSRLRNPSWRNNKEQTNVDHLREMTNSHSRQEPGKFAVLHLRF  295

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  296  DKDMAAHSACDFGGGKAEKLALAKYRQMIWQGR  328



>ref|XP_002864958.1| hypothetical protein ARALYDRAFT_496780 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41217.1| hypothetical protein ARALYDRAFT_496780 [Arabidopsis lyrata subsp. 
lyrata]
Length=504

 Score =   316 bits (810),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 173/213 (81%), Gaps = 19/213 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSF+DIFDVDHFI+ LKDDI +V+ELPDE+SWSTREYY 
Sbjct  112  KILNATLVIPYLEVNPVWQDSSSFVDIFDVDHFIDALKDDIRVVRELPDEYSWSTREYYG  171

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TA+R TR+KTAPVHASANWY ENV PVL+SYGIAAI+PFSHRL+FD++P +IQ LRCKVN
Sbjct  172  TAVRETRVKTAPVHASANWYIENVSPVLQSYGIAAISPFSHRLSFDHLPAEIQRLRCKVN  231

Query  363  FRALVFVPHIRALGDALIHRLRYPA-------------------SKDEGPQKFVAVHLRF  485
            F+AL FVPHI +LGDAL+ RLR P+                    K + P KF  +HLRF
Sbjct  232  FQALRFVPHITSLGDALVSRLRNPSWRNNKELKNVDHLGDMTNPHKRQEPGKFAVLHLRF  291

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  292  DKDMAAHSACDFGGGKAEKLALAKYRQMIWQGR  324



>ref|XP_010519195.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=518

 Score =   316 bits (810),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 174/213 (82%), Gaps = 19/213 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSF++IFDVDHFIEVLK+D+ IVKELP+ FSWSTREYY+
Sbjct  126  KILNATLVIPYLEVNPVWQDSSSFVEIFDVDHFIEVLKNDVRIVKELPENFSWSTREYYA  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
              IR TR+KTAPVHAS+NWY ENVLP+L+S+GIAAIAPFSHRL+FDN+P +IQ LRCKVN
Sbjct  186  ATIRETRVKTAPVHASSNWYLENVLPLLQSFGIAAIAPFSHRLSFDNLPAEIQRLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-------------------EGPQKFVAVHLRF  485
            F+AL FVPHIR LGD+L+ RLR P  ++                   + P KFV +HLRF
Sbjct  246  FQALSFVPHIRELGDSLVSRLRNPLWRNKEEEEDVDHLRDMRNSHSRQEPGKFVVLHLRF  305

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  306  DKDMAAHSACDFGGGKAEKLALAKYRQMIWQGR  338



>ref|XP_010939815.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=558

 Score =   317 bits (813),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 173/208 (83%), Gaps = 14/208 (7%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVW+DSSSF +I+DVDHFI VLKD+IS+V+ELP EFSWSTREYY+
Sbjct  171  KILNATLVIPHLEVNPVWKDSSSFEEIYDVDHFISVLKDEISVVRELPQEFSWSTREYYA  230

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIR TR+KTAPVHASANWY ENVLPVL+SYGIAAIAPFSHRLAFDN+P +IQ LRCKVN
Sbjct  231  VAIRATRVKTAPVHASANWYLENVLPVLQSYGIAAIAPFSHRLAFDNLPGEIQRLRCKVN  290

Query  363  FRALVFVPHIRALGDALIHRLRYPAS----------KDE----GPQKFVAVHLRFDKDMA  500
            F+ALVFVPHI  LG+AL+ RL YP S           DE       KFV +HLRFDKDMA
Sbjct  291  FQALVFVPHINGLGEALVKRLGYPVSIHSSEYIQEVVDENVHAASGKFVVLHLRFDKDMA  350

Query  501  AHSACDFGGGKAEKLSLAKYRQNILAGK  584
            AHSACDFGGGKAE+L+LAKYRQ I  G+
Sbjct  351  AHSACDFGGGKAERLALAKYRQVIWQGR  378



>ref|NP_201350.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 dbj|BAE99053.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED98060.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=504

 Score =   315 bits (808),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 173/213 (81%), Gaps = 19/213 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSF+DIFDVDHFI+ LKDDI +V+ELPDE+SWSTREYY 
Sbjct  112  KILNATLVIPYLEVNPVWQDSSSFVDIFDVDHFIDSLKDDIRVVRELPDEYSWSTREYYG  171

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TA+R TR+KTAPVHASANWY ENV PVL+SYGIAAI+PFSHRL+FD++P +IQ LRCKVN
Sbjct  172  TAVRETRVKTAPVHASANWYIENVSPVLQSYGIAAISPFSHRLSFDHLPAEIQRLRCKVN  231

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-------------------EGPQKFVAVHLRF  485
            F+AL FVPHI +LGDAL+ RLR P+ +                    + P KF  +HLRF
Sbjct  232  FQALRFVPHITSLGDALVSRLRNPSWRSNKEQKNVDHLGDMTNPHRRQEPGKFAVLHLRF  291

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKLSLAKYRQ I  G+
Sbjct  292  DKDMAAHSACDFGGGKAEKLSLAKYRQMIWQGR  324



>gb|AAM13166.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91219.1| unknown protein [Arabidopsis thaliana]
Length=504

 Score =   315 bits (808),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 173/213 (81%), Gaps = 19/213 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSF+DIFDVDHFI+ LKDDI +V+ELPDE+SWSTREYY 
Sbjct  112  KILNATLVIPYLEVNPVWQDSSSFVDIFDVDHFIDSLKDDIRVVRELPDEYSWSTREYYG  171

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TA+R TR+KTAPVHASANWY ENV PVL+SYGIAAI+PFSHRL+FD++P +IQ LRCKVN
Sbjct  172  TAVRETRVKTAPVHASANWYIENVSPVLQSYGIAAISPFSHRLSFDHLPAEIQRLRCKVN  231

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-------------------EGPQKFVAVHLRF  485
            F+AL FVPHI +LGDAL+ RLR P+ +                    + P KF  +HLRF
Sbjct  232  FQALRFVPHITSLGDALVSRLRNPSWRSNKEQKNVDHLGDMTNPHRRQEPGKFAVLHLRF  291

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKLSLAKYRQ I  G+
Sbjct  292  DKDMAAHSACDFGGGKAEKLSLAKYRQMIWQGR  324



>ref|XP_004301363.1| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=513

 Score =   316 bits (809),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 174/208 (84%), Gaps = 14/208 (7%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+P+LEVNPVWQDSSSF +IFDVDHF++VL++++SIVKELP EFSWS+REYY+
Sbjct  126  KILNATLVLPHLEVNPVWQDSSSFEEIFDVDHFLDVLRNEVSIVKELPSEFSWSSREYYA  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IRPTRIKTAPVHA A WY ENVLP ++SYGIAAI+PFSHRL+FDNMP+ IQ LRCKVN
Sbjct  186  TGIRPTRIKTAPVHAPAEWYVENVLPTMQSYGIAAISPFSHRLSFDNMPESIQRLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD--------------EGPQKFVAVHLRFDKDMA  500
            F+AL FVPHIR LG+AL++RLR P  ++              +G  KFV +HLRFDKDMA
Sbjct  246  FQALSFVPHIRELGEALVNRLRNPPIRNQNTDSQEGTDDLDKQGAGKFVVLHLRFDKDMA  305

Query  501  AHSACDFGGGKAEKLSLAKYRQNILAGK  584
            AHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  306  AHSACDFGGGKAEKLALAKYRQVIWQGR  333



>ref|XP_006852943.1| hypothetical protein AMTR_s00033p00238220 [Amborella trichopoda]
 gb|ERN14410.1| hypothetical protein AMTR_s00033p00238220 [Amborella trichopoda]
Length=446

 Score =   313 bits (803),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 169/207 (82%), Gaps = 14/207 (7%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+ EVNPVW+DSS+F DIFDVD+FI VLKDDI+IVKELP  FSWSTREYY+
Sbjct  60   KILNATLVIPHFEVNPVWRDSSTFGDIFDVDYFIHVLKDDINIVKELPGRFSWSTREYYA  119

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPV ASANWY ENVLP+L+SYGIAA+APFSHRLAFDN+PK+IQ LRCKVN
Sbjct  120  TAIRSTRVKTAPVQASANWYLENVLPILQSYGIAAVAPFSHRLAFDNLPKEIQRLRCKVN  179

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-------------PQKFVAVHLRFDKDMAA  503
            F AL FVPHI ALG  L+ RLRYP   D G               KFV +HLRFDKDMAA
Sbjct  180  FEALAFVPHINALGQTLVKRLRYPLG-DGGLLREKVDAEINPISGKFVVLHLRFDKDMAA  238

Query  504  HSACDFGGGKAEKLSLAKYRQNILAGK  584
            HSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  239  HSACDFGGGKAEKLALAKYRQVIWQGR  265



>gb|KDP41479.1| hypothetical protein JCGZ_15886 [Jatropha curcas]
Length=513

 Score =   316 bits (809),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 177/208 (85%), Gaps = 14/208 (7%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSSSF+DIFDVDHFI+VL D+I IVKELP+E+SWSTREYY+
Sbjct  126  KILNATLVIPHLEVNPVWQDSSSFVDIFDVDHFIDVLHDEIFIVKELPNEYSWSTREYYA  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA+WY ENVLPVL+SYG+AA+APFSHRLAFD +P +IQ LRCKVN
Sbjct  186  TGIRATRIKTAPVHASADWYLENVLPVLQSYGVAAVAPFSHRLAFDKLPTNIQRLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLRYPA--------------SKDEGPQKFVAVHLRFDKDMA  500
            F ALVFVPH+++LG+ L++RLR P+              +++ G +KFV +HLRFDKDMA
Sbjct  246  FEALVFVPHVKSLGETLVNRLRNPSGSSRTEFLRERIDDTENLGSRKFVVLHLRFDKDMA  305

Query  501  AHSACDFGGGKAEKLSLAKYRQNILAGK  584
            AHSACDFGGGKAEKL+LAKYRQ +  G+
Sbjct  306  AHSACDFGGGKAEKLALAKYRQVLWQGR  333



>dbj|BAE71212.1| hypothetical protein [Trifolium pratense]
Length=404

 Score =   312 bits (799),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 171/204 (84%), Gaps = 17/204 (8%)
 Frame = +3

Query  24   VIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYSTAIRPTR  203
            VIPYLE+NPVW+DSSSF DIFDVDHFI+VLK+D+SIVKELP+E+SWS+REYY+ AIR TR
Sbjct  21   VIPYLELNPVWKDSSSFEDIFDVDHFIDVLKNDVSIVKELPEEYSWSSREYYALAIRDTR  80

Query  204  IKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVNFRALVFV  383
            IK APVHA+ANWY ENVLPVL+SYGIAAI+PFSHRL+FDN+P DIQHLRCKVNF+ALVFV
Sbjct  81   IKVAPVHATANWYIENVLPVLQSYGIAAISPFSHRLSFDNLPMDIQHLRCKVNFQALVFV  140

Query  384  PHIRALGDALIHRLRYP-----------------ASKDEGPQKFVAVHLRFDKDMAAHSA  512
            PHIRALGDAL++RLR P                 A  ++   KFV +HLRFDKDMAAHSA
Sbjct  141  PHIRALGDALVNRLRNPQHTTEEMGSNYLQEVTDADDNKNAGKFVVLHLRFDKDMAAHSA  200

Query  513  CDFGGGKAEKLSLAKYRQNILAGK  584
            CDFGGGKAEKL+LAKYRQ I  G+
Sbjct  201  CDFGGGKAEKLALAKYRQVIWQGR  224



>ref|XP_009785662.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=516

 Score =   315 bits (808),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 168/209 (80%), Gaps = 15/209 (7%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSF +IFDVDHFI +L  D+S+VKELP E+SWSTREYY+
Sbjct  128  KILNATLVIPYLEVNPVWQDSSSFAEIFDVDHFINILSGDVSVVKELPSEYSWSTREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTA VHASA WY ENVLPV++SYGI AIAPFSHRLAFDN+P  IQHLRCKVN
Sbjct  188  TGIRATRIKTASVHASATWYLENVLPVMQSYGIVAIAPFSHRLAFDNLPSYIQHLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE---------------GPQKFVAVHLRFDKDM  497
            F ALVFVPH+R LGD L+ RLR P S ++               G  K+V +HLRFDKDM
Sbjct  248  FNALVFVPHVRTLGDTLVSRLRSPPSMNKASSATHFHDRENDRAGAGKYVVLHLRFDKDM  307

Query  498  AAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            AAHSACDFGGGKAEKL+LAKYRQ +  G+
Sbjct  308  AAHSACDFGGGKAEKLALAKYRQVLWQGR  336



>dbj|BAB11569.1| unnamed protein product [Arabidopsis thaliana]
Length=523

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 173/213 (81%), Gaps = 19/213 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSF+DIFDVDHFI+ LKDDI +V+ELPDE+SWSTREYY 
Sbjct  131  KILNATLVIPYLEVNPVWQDSSSFVDIFDVDHFIDSLKDDIRVVRELPDEYSWSTREYYG  190

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TA+R TR+KTAPVHASANWY ENV PVL+SYGIAAI+PFSHRL+FD++P +IQ LRCKVN
Sbjct  191  TAVRETRVKTAPVHASANWYIENVSPVLQSYGIAAISPFSHRLSFDHLPAEIQRLRCKVN  250

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-------------------EGPQKFVAVHLRF  485
            F+AL FVPHI +LGDAL+ RLR P+ +                    + P KF  +HLRF
Sbjct  251  FQALRFVPHITSLGDALVSRLRNPSWRSNKEQKNVDHLGDMTNPHRRQEPGKFAVLHLRF  310

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKLSLAKYRQ I  G+
Sbjct  311  DKDMAAHSACDFGGGKAEKLSLAKYRQMIWQGR  343



>ref|XP_008219267.1| PREDICTED: uncharacterized protein At1g04910-like [Prunus mume]
Length=520

 Score =   315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 175/210 (83%), Gaps = 16/210 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KIL ATLV+P+LEVNPVWQDSSSF +IFD+DHFIEVL+D++SIVK+LP EFSWSTREYY+
Sbjct  131  KILKATLVVPHLEVNPVWQDSSSFEEIFDLDHFIEVLRDEVSIVKDLPSEFSWSTREYYA  190

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHAS++WY ENVLPVL+ YG+AAI+PFSHRL F+N+PK+IQ LRCKVN
Sbjct  191  TGIRITRIKTAPVHASSDWYLENVLPVLQRYGVAAISPFSHRLTFENLPKNIQRLRCKVN  250

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQ----------------KFVAVHLRFDKD  494
            F+AL FVPHIR LG+ L++RLRYP ++++G                  KFV +HLRFDKD
Sbjct  251  FQALAFVPHIRELGETLVNRLRYPPNRNQGAASDSQDGTNQIEKQGAGKFVVLHLRFDKD  310

Query  495  MAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            MAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  311  MAAHSACDFGGGKAEKLALAKYRQVIWQGR  340



>ref|XP_010547595.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=513

 Score =   313 bits (802),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 176/211 (83%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVN VWQDSSSF++IFDVDHFI+ LK+D+ IVKELP+EFSWSTREYY+
Sbjct  123  KILNATLVIPFLEVNSVWQDSSSFVEIFDVDHFIDELKNDVRIVKELPEEFSWSTREYYA  182

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHAS+NWY ENVLP+L+S+GIAAI+PFSHRL+FD++P +IQ LRCKVN
Sbjct  183  TAIRETRVKTAPVHASSNWYLENVLPLLQSFGIAAISPFSHRLSFDHLPAEIQWLRCKVN  242

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            FRAL FVPHIR LG+AL+ RLR P+ +D                 + P KFV +HLRFDK
Sbjct  243  FRALRFVPHIRQLGEALVTRLRNPSWRDKEEDVDHLRDMSNPHKRQEPGKFVVLHLRFDK  302

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  303  DMAAHSACDFGGGKAEKLALAKYRQMIWQGR  333



>emb|CDY14569.1| BnaC03g48900D [Brassica napus]
Length=503

 Score =   312 bits (800),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 172/213 (81%), Gaps = 19/213 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSF+DIFDVDHFI  LKDDI IV+ELP+E SWSTREYY 
Sbjct  111  KILNATLVIPYLEVNPVWQDSSSFVDIFDVDHFINTLKDDIRIVRELPEELSWSTREYYG  170

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASA WY ENV PVL+S+GIAAI+PFSHRL+FD++P +IQ LRCKVN
Sbjct  171  TAIRETRVKTAPVHASAKWYRENVSPVLQSFGIAAISPFSHRLSFDHLPAEIQRLRCKVN  230

Query  363  FRALVFVPHIRALGDALIHRLRYP---ASKD----------------EGPQKFVAVHLRF  485
            F+AL FVPHI +LGDAL+ RLR P   +SKD                + P KF  +HLRF
Sbjct  231  FQALRFVPHITSLGDALVSRLRNPLWRSSKDRKNVDHLGDMTNSHRRQEPGKFAVLHLRF  290

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  291  DKDMAAHSACDFGGGKAEKLALAKYRQMIWQGR  323



>gb|KFK28724.1| hypothetical protein AALP_AA7G039000 [Arabis alpina]
Length=513

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 168/211 (80%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILN TLVIP LEVNPVWQDSSSF DIFDVDHF+ +LKD++ IV+ELP E++WSTREYY+
Sbjct  121  KILNVTLVIPRLEVNPVWQDSSSFEDIFDVDHFLSILKDEVRIVRELPTEYAWSTREYYA  180

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA WY ENVLPV++SYGIAA+APFSHRLAFDNMP+ IQ LRCKVN
Sbjct  181  TGIRATRIKTAPVHASAEWYLENVLPVIQSYGIAAVAPFSHRLAFDNMPESIQRLRCKVN  240

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F AL FVPHIR LGDA++ RLR+P S  +                 G  KFV +HLRFDK
Sbjct  241  FEALSFVPHIRKLGDAIVDRLRHPPSISQTSGTIDPTDRINTIVKAGAGKFVVLHLRFDK  300

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHS CDFGGGKAEKL+LAKYRQ I  G+
Sbjct  301  DMAAHSGCDFGGGKAEKLALAKYRQVIWQGR  331



>ref|XP_002514041.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48624.1| conserved hypothetical protein [Ricinus communis]
Length=519

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 174/208 (84%), Gaps = 14/208 (7%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSSSF++IFD DHFI++L+ +IS+VKE P ++SWSTREYY+
Sbjct  125  KILNATLVIPHLEVNPVWQDSSSFVEIFDADHFIDILRHEISVVKEPPSKYSWSTREYYA  184

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP+HASANWY ENVLPVL+SYGIAAIAPFSHRLAFDN+P +IQ LRCKVN
Sbjct  185  TGIRATRIKTAPLHASANWYLENVLPVLQSYGIAAIAPFSHRLAFDNLPTNIQRLRCKVN  244

Query  363  FRALVFVPHIRALGDALIHRLRYPA--------------SKDEGPQKFVAVHLRFDKDMA  500
            F ALVFV HI++LGD L++RLRYP+              +  EG  K+V +HLRFDKDMA
Sbjct  245  FEALVFVAHIKSLGDTLVNRLRYPSGASGTEFVKERRGDTGKEGSGKYVVLHLRFDKDMA  304

Query  501  AHSACDFGGGKAEKLSLAKYRQNILAGK  584
            AHS+CDFGGGKAE+L+LAKYRQ +  G+
Sbjct  305  AHSSCDFGGGKAERLALAKYRQVLWQGR  332



>ref|XP_009376221.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Pyrus x bretschneideri]
Length=520

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 173/210 (82%), Gaps = 16/210 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSSSF DIFDVDHFIE L+ ++SIVK LP EFSWSTREYY+
Sbjct  131  KILNATLVIPHLEVNPVWQDSSSFEDIFDVDHFIEALQGEVSIVKALPSEFSWSTREYYA  190

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRI+TAPVHAS++WY EN LP+L+ YG+AAI+PFSHRLAFD +P++IQHLRCKVN
Sbjct  191  TGIRITRIRTAPVHASSDWYLENALPILQRYGVAAISPFSHRLAFDKLPQNIQHLRCKVN  250

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD----------------EGPQKFVAVHLRFDKD  494
            F+AL FVPHIR LG+ L++RLRYP +++                +G  K+V +HLRFDKD
Sbjct  251  FQALAFVPHIRELGETLVNRLRYPPNRNPKAGSDSQDKANEIEKQGAGKYVVLHLRFDKD  310

Query  495  MAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            MAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  311  MAAHSACDFGGGKAEKLALAKYRQVIWQGR  340



>gb|KJB48896.1| hypothetical protein B456_008G092600, partial [Gossypium raimondii]
Length=495

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 166/211 (79%), Gaps = 27/211 (13%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSFMDI+DVD  I VLKDD+SIVKELPDEFSWSTREYY+
Sbjct  81   KILNATLVIPYLEVNPVWQDSSSFMDIYDVDRLINVLKDDVSIVKELPDEFSWSTREYYA  140

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIK APVHASANWY ENVLPVL+SYGIAAI+P SHRL+FDN+P +IQ LRCKVN
Sbjct  141  TAIRATRIKRAPVHASANWYLENVLPVLQSYGIAAISPCSHRLSFDNLPSEIQQLRCKVN  200

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-----------------PQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDA++HRLRYP  + E                  PQKFV +HLRFDK
Sbjct  201  FKALVFVPHIRALGDAIVHRLRYPPGETEALSSDYLRVTTDQNDKQRPQKFVVLHLRFDK  260

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            D AAHSACDFGG          YRQ I  G+
Sbjct  261  DTAAHSACDFGG----------YRQTIWGGR  281



>gb|KJB58885.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=399

 Score =   308 bits (789),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 171/211 (81%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSSSF DIFDVDHFI VL+D++SIVKELP E+SWS+REYY+
Sbjct  128  KILNATLVIPHLEVNPVWQDSSSFTDIFDVDHFINVLRDEVSIVKELPTEYSWSSREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA+WY ENVLPV++SYGIAAI+PFSHRLAFD +P +IQHLRCKVN
Sbjct  188  TGIRATRIKTAPVHASADWYLENVLPVMQSYGIAAISPFSHRLAFDKLPVEIQHLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASK-----------------DEGPQKFVAVHLRFDK  491
            F AL FVP IR +G+ L++RLR P+ K                  E   KFV +HLRFDK
Sbjct  248  FEALAFVPRIRLIGETLVNRLRDPSGKLQASGTAVLRERTDDTEKERAGKFVVLHLRFDK  307

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ +  G+
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQVLWQGR  338



>ref|XP_009150636.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
 emb|CDY08790.1| BnaA06g24340D [Brassica napus]
Length=503

 Score =   310 bits (795),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 171/213 (80%), Gaps = 19/213 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSF+DIFDVDHFI  LKDDI IV+ELP+E SWSTREYY 
Sbjct  111  KILNATLVIPYLEVNPVWQDSSSFVDIFDVDHFINTLKDDIRIVRELPEELSWSTREYYG  170

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TR+KTAPVHASA WY ENV PVL+S+GIAAI+PFSHRL+FD++P +IQ LRCKVN
Sbjct  171  TAIRETRVKTAPVHASAKWYRENVSPVLQSFGIAAISPFSHRLSFDHLPAEIQRLRCKVN  230

Query  363  FRALVFVPHIRALGDALIHRLRYP---ASKD----------------EGPQKFVAVHLRF  485
            F+AL FVPHI +LGDAL+ RLR P   + KD                + P KF  +HLRF
Sbjct  231  FQALRFVPHITSLGDALVSRLRNPLWRSRKDRKNVDHLGDMTNSHSRQEPGKFAVLHLRF  290

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  291  DKDMAAHSACDFGGGKAEKLALAKYRQMIWQGR  323



>ref|XP_010664406.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Vitis 
vinifera]
Length=446

 Score =   308 bits (790),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 171/212 (81%), Gaps = 18/212 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSSSF +IFD+DHFI VLKDDI I KELP ++SWSTREYY+
Sbjct  124  KILNATLVIPHLEVNPVWQDSSSFAEIFDIDHFINVLKDDIFIAKELPSKYSWSTREYYA  183

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP+HASA WY ENVLPVL+SYGIAA+APFSHRLAFDN+P  IQ LRCKVN
Sbjct  184  TGIRATRIKTAPIHASAIWYLENVLPVLQSYGIAALAPFSHRLAFDNLPAYIQRLRCKVN  243

Query  363  FRALVFVPHIRALGDALIHRLRY------------------PASKDEGPQKFVAVHLRFD  488
            F+ALVFVPHI+ALG+AL++ +RY                    +  +G  KFV +HLRFD
Sbjct  244  FKALVFVPHIKALGEALVNHIRYLPIESRAGGTEYLQDRTDEINHKQGAGKFVVLHLRFD  303

Query  489  KDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            KDMAAHSACDFGGGKAEK++LAKYRQ I  G+
Sbjct  304  KDMAAHSACDFGGGKAEKMALAKYRQVIWQGR  335



>gb|EPS73888.1| hypothetical protein M569_00867, partial [Genlisea aurea]
Length=498

 Score =   310 bits (794),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 169/199 (85%), Gaps = 5/199 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP  EV+ VWQDSS+FMDIFDVDHFI+VLKDDISIV+E+P+EF WSTREYY+
Sbjct  121  KILNATLVIPQFEVHSVWQDSSTFMDIFDVDHFIDVLKDDISIVEEVPEEFFWSTREYYA  180

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             AIR TR+K+APVHASANWY +NV P+L+SYGIAAIAPFSHRLAFD MP +IQ LRCKVN
Sbjct  181  AAIRATRVKSAPVHASANWYLDNVSPILQSYGIAAIAPFSHRLAFDKMPDEIQRLRCKVN  240

Query  363  FRALVFVPHIRALGDALIHRLRYP-----ASKDEGPQKFVAVHLRFDKDMAAHSACDFGG  527
            F+ALVFVPHIR LGDAL+ RLR       A  + G   FV +HLRFDKDMAAHSACDFGG
Sbjct  241  FQALVFVPHIRDLGDALVSRLRSSPITGDAEYERGIGNFVVLHLRFDKDMAAHSACDFGG  300

Query  528  GKAEKLSLAKYRQNILAGK  584
            GKAEKL+LAKYRQ +  G+
Sbjct  301  GKAEKLALAKYRQVVWQGR  319



>ref|XP_008368388.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=519

 Score =   311 bits (796),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/209 (71%), Positives = 172/209 (82%), Gaps = 15/209 (7%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSSSF +IFDVDHFIE L+ ++SIVK LP EFSWSTREYY+
Sbjct  131  KILNATLVIPHLEVNPVWQDSSSFEEIFDVDHFIEALQGEVSIVKALPIEFSWSTREYYA  190

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHAS++WY ENVLP+L+ YG+AAI+PFSHRLAF+N+P  IQHLRCKVN
Sbjct  191  TGIRITRIKTAPVHASSDWYLENVLPILQRYGVAAISPFSHRLAFENLPPSIQHLRCKVN  250

Query  363  FRALVFVPHIRALGDALIHRLRYP--------ASKD-------EGPQKFVAVHLRFDKDM  497
            F AL FVPHIR LG+ L++RLRYP         S+D       +G  K+V +HLRFDKDM
Sbjct  251  FEALAFVPHIRKLGETLVNRLRYPNRNQKAGTGSQDKANEIEKQGAGKYVVLHLRFDKDM  310

Query  498  AAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            AAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  311  AAHSACDFGGGKAEKLALAKYRQVIWQGR  339



>ref|XP_003602912.1| PsRT17-1 like protein [Medicago truncatula]
 gb|AES73163.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=517

 Score =   311 bits (796),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 172/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILN TLVIP+ EVNPVWQDSSSF DIFDVDHFI+VL+D++SIVKELP E+SWSTREYY+
Sbjct  127  KILNVTLVIPHFEVNPVWQDSSSFADIFDVDHFIDVLRDEVSIVKELPGEYSWSTREYYA  186

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHA+A+WY+ENVLPVL+SYG+AAIAPFSHRL F+ +P DIQ LRCKVN
Sbjct  187  TGIRATRIKTAPVHATADWYTENVLPVLQSYGVAAIAPFSHRLTFNGLPSDIQRLRCKVN  246

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE--------------GPQ---KFVAVHLRFDK  491
            F AL FVPH++ LGD L+ RLRY +S ++              G Q   KFV +HLRFDK
Sbjct  247  FEALNFVPHVKELGDILVQRLRYNSSINQAESNDYLPEEADKLGKQQSGKFVVLHLRFDK  306

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  307  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  337



>ref|XP_006394027.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
 gb|ESQ31313.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
Length=506

 Score =   310 bits (794),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 171/213 (80%), Gaps = 19/213 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSF+DIFDVDHFI+ LKDDI +V+ELP+E+SWSTREYY 
Sbjct  114  KILNATLVIPYLEVNPVWQDSSSFVDIFDVDHFIDALKDDIRVVRELPEEYSWSTREYYG  173

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TA+R TRIKTAPVHASA WY ENV PVL+SYGIAAI+PFSHRL+FD++P +IQ LRCKVN
Sbjct  174  TAVRETRIKTAPVHASAKWYIENVSPVLQSYGIAAISPFSHRLSFDHLPAEIQRLRCKVN  233

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-------------------PQKFVAVHLRF  485
            F+AL FVPHI +LGDAL+ RL+ P+ +                      P KF  +HLRF
Sbjct  234  FQALRFVPHITSLGDALVSRLKNPSWRSNKEKKNVDHLGDMINSHSRREPGKFAVLHLRF  293

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  294  DKDMAAHSACDFGGGKAEKLALAKYRQMIWQGR  326



>ref|XP_006394028.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
 gb|ESQ31314.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
Length=507

 Score =   310 bits (794),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 171/213 (80%), Gaps = 19/213 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLEVNPVWQDSSSF+DIFDVDHFI+ LKDDI +V+ELP+E+SWSTREYY 
Sbjct  115  KILNATLVIPYLEVNPVWQDSSSFVDIFDVDHFIDALKDDIRVVRELPEEYSWSTREYYG  174

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TA+R TRIKTAPVHASA WY ENV PVL+SYGIAAI+PFSHRL+FD++P +IQ LRCKVN
Sbjct  175  TAVRETRIKTAPVHASAKWYIENVSPVLQSYGIAAISPFSHRLSFDHLPAEIQRLRCKVN  234

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-------------------PQKFVAVHLRF  485
            F+AL FVPHI +LGDAL+ RL+ P+ +                      P KF  +HLRF
Sbjct  235  FQALRFVPHITSLGDALVSRLKNPSWRSNKEKKNVDHLGDMINSHSRREPGKFAVLHLRF  294

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  295  DKDMAAHSACDFGGGKAEKLALAKYRQMIWQGR  327



>ref|XP_010692399.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=503

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 168/195 (86%), Gaps = 1/195 (1%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVN VWQDSSSF ++FD+DHFI  L D+ISIV+ELP E+SWSTREYY 
Sbjct  129  KILNATLVIPHLEVNSVWQDSSSFAEVFDLDHFINSLSDEISIVRELPVEYSWSTREYYG  188

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA+WY ENVLPVL+ YGIAAI+PFSHRLAFDN+PK IQ LRC VN
Sbjct  189  TGIRETRIKTAPVHASADWYLENVLPVLQRYGIAAISPFSHRLAFDNLPKSIQQLRCMVN  248

Query  363  FRALVFVPHIRALGDALIHRLRYPAS-KDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAE  539
            F +L+FVPHIR LGD L++RLRYP +   +  +K+V +HLRFDKDMAAHSACDFGGG+AE
Sbjct  249  FESLLFVPHIRILGDTLVNRLRYPNNFSGQSSEKYVVLHLRFDKDMAAHSACDFGGGRAE  308

Query  540  KLSLAKYRQNILAGK  584
            KL+LA+YRQ I  G+
Sbjct  309  KLALARYRQVIWQGR  323



>gb|KJB58881.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
 gb|KJB58882.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=518

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 171/211 (81%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSSSF DIFDVDHFI VL+D++SIVKELP E+SWS+REYY+
Sbjct  128  KILNATLVIPHLEVNPVWQDSSSFTDIFDVDHFINVLRDEVSIVKELPTEYSWSSREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA+WY ENVLPV++SYGIAAI+PFSHRLAFD +P +IQHLRCKVN
Sbjct  188  TGIRATRIKTAPVHASADWYLENVLPVMQSYGIAAISPFSHRLAFDKLPVEIQHLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASK-----------------DEGPQKFVAVHLRFDK  491
            F AL FVP IR +G+ L++RLR P+ K                  E   KFV +HLRFDK
Sbjct  248  FEALAFVPRIRLIGETLVNRLRDPSGKLQASGTAVLRERTDDTEKERAGKFVVLHLRFDK  307

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ +  G+
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQVLWQGR  338



>ref|XP_002283844.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Vitis 
vinifera]
 emb|CBI19265.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 171/212 (81%), Gaps = 18/212 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSSSF +IFD+DHFI VLKDDI I KELP ++SWSTREYY+
Sbjct  124  KILNATLVIPHLEVNPVWQDSSSFAEIFDIDHFINVLKDDIFIAKELPSKYSWSTREYYA  183

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP+HASA WY ENVLPVL+SYGIAA+APFSHRLAFDN+P  IQ LRCKVN
Sbjct  184  TGIRATRIKTAPIHASAIWYLENVLPVLQSYGIAALAPFSHRLAFDNLPAYIQRLRCKVN  243

Query  363  FRALVFVPHIRALGDALIHRLRY------------------PASKDEGPQKFVAVHLRFD  488
            F+ALVFVPHI+ALG+AL++ +RY                    +  +G  KFV +HLRFD
Sbjct  244  FKALVFVPHIKALGEALVNHIRYLPIESRAGGTEYLQDRTDEINHKQGAGKFVVLHLRFD  303

Query  489  KDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            KDMAAHSACDFGGGKAEK++LAKYRQ I  G+
Sbjct  304  KDMAAHSACDFGGGKAEKMALAKYRQVIWQGR  335



>ref|XP_006413418.1| hypothetical protein EUTSA_v10024936mg [Eutrema salsugineum]
 gb|ESQ54871.1| hypothetical protein EUTSA_v10024936mg [Eutrema salsugineum]
Length=518

 Score =   309 bits (792),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 166/211 (79%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILN TLVIP LEVNPVWQDSSSF DIFDVDHFI  LKD++ IV+ELP ++SWSTR+YY+
Sbjct  127  KILNVTLVIPRLEVNPVWQDSSSFADIFDVDHFIAFLKDEVRIVRELPTQYSWSTRDYYA  186

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA WY ENVLPV++SYGIAA+APFSHRLAFDN+P+ IQ LRCKVN
Sbjct  187  TGIRATRIKTAPVHASAEWYVENVLPVIQSYGIAAVAPFSHRLAFDNLPESIQRLRCKVN  246

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F AL FVPHIR LGDAL+HRLR P S  +                 G  KF  +HLRFDK
Sbjct  247  FEALNFVPHIRELGDALVHRLRNPPSSSQTSGTMDPTDRINTIVKAGAGKFAVLHLRFDK  306

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHS CDFGGGKAEKL+LAKYR+ I  G+
Sbjct  307  DMAAHSGCDFGGGKAEKLALAKYREVIWQGR  337



>ref|XP_007136338.1| hypothetical protein PHAVU_009G0371000g, partial [Phaseolus vulgaris]
 gb|ESW08332.1| hypothetical protein PHAVU_009G0371000g, partial [Phaseolus vulgaris]
Length=449

 Score =   306 bits (784),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 171/211 (81%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+ EVNPVWQDSSSF DIFD+DHFI+VL++++SIVKE P ++SWSTREYY+
Sbjct  128  KILNATLVIPHFEVNPVWQDSSSFEDIFDLDHFIDVLRNEVSIVKEPPSDYSWSTREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP+ A+A+WY ENVLPVLRSYGIAAIAPFSHRL F+N+P DIQ LRCKVN
Sbjct  188  TGIRATRIKTAPIQATADWYIENVLPVLRSYGIAAIAPFSHRLTFNNLPSDIQRLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLR------------YPASK-----DEGPQKFVAVHLRFDK  491
            F AL+FVPHI+ LGDA+IHRLR            +P  +      +   KFV +HLRFDK
Sbjct  248  FEALIFVPHIKELGDAIIHRLRRTSIVNQAEAKYFPLEETDVLIKQQTGKFVVLHLRFDK  307

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ +  G+
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQVLWQGR  338



>ref|XP_008378640.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=441

 Score =   306 bits (783),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 172/210 (82%), Gaps = 16/210 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSSSF DIFDVDHFIE L+ ++SIVK LP EFSWSTREYY+
Sbjct  186  KILNATLVIPHLEVNPVWQDSSSFEDIFDVDHFIEALQGEVSIVKALPSEFSWSTREYYA  245

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHAS++WY ENVLP+L+ YG+AAI+PFSHRLAFDN+P++IQ + CKVN
Sbjct  246  TGIRITRIKTAPVHASSDWYLENVLPLLQRYGVAAISPFSHRLAFDNLPQNIQRVSCKVN  305

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD----------------EGPQKFVAVHLRFDKD  494
            F+AL FVPHIR LG+ L++RLRYP + +                +G  K+V +HLRF+KD
Sbjct  306  FQALAFVPHIRELGETLVNRLRYPPNGNPKGGSDSQDKANEIEKQGAGKYVVLHLRFNKD  365

Query  495  MAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            +AAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  366  IAAHSACDFGGGKAEKLALAKYRQVIWQGR  395



>ref|XP_003526543.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=511

 Score =   308 bits (788),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 169/206 (82%), Gaps = 12/206 (6%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+P+ EVNPVWQDSSSF DIFDVDHFI+VL+D++SIVKELP ++SWSTREYY 
Sbjct  126  KILNATLVLPHFEVNPVWQDSSSFADIFDVDHFIDVLRDEVSIVKELPSDYSWSTREYYG  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPV A+++WY ENVLPVL+SYGIAAIAPFSHRL F+N+P  IQ LRCKVN
Sbjct  186  TGIRATRIKTAPVQATSDWYIENVLPVLQSYGIAAIAPFSHRLTFNNLPSYIQRLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGP------------QKFVAVHLRFDKDMAAH  506
            F AL+FV HI+ LG A++HRLR+P   ++ P             KFV +HLRFDKDMAAH
Sbjct  246  FEALIFVSHIKELGKAIVHRLRHPTEGNDYPLEETDKFGKQQTGKFVVLHLRFDKDMAAH  305

Query  507  SACDFGGGKAEKLSLAKYRQNILAGK  584
            SACDFGGGKAEKL+LAKYRQ +  G+
Sbjct  306  SACDFGGGKAEKLALAKYRQVLWQGR  331



>ref|XP_009401410.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009401411.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=518

 Score =   308 bits (788),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 169/208 (81%), Gaps = 14/208 (7%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIPYLE+NPVW+DSSSF +I+DVDHFI+VLK++IS+ +ELP E+SWSTREYY+
Sbjct  131  KILNATLVIPYLEINPVWRDSSSFEEIYDVDHFIDVLKEEISVTRELPKEYSWSTREYYA  190

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
              IR TR+KTAP HASANWY ENVLPVL+SYGIAAI+PFSHRLAF+N+P DIQ LRCKVN
Sbjct  191  IGIRATRVKTAPSHASANWYLENVLPVLQSYGIAAISPFSHRLAFENLPGDIQRLRCKVN  250

Query  363  FRALVFVPHIRALGDALIHRLRYPASK--------------DEGPQKFVAVHLRFDKDMA  500
            F+AL FV HI ALG+ L+ RLR P  +               EGP KF  +HLRFDKDMA
Sbjct  251  FQALAFVSHINALGETLVKRLRSPVHQQPEEFLKEVADENVQEGPGKFAVLHLRFDKDMA  310

Query  501  AHSACDFGGGKAEKLSLAKYRQNILAGK  584
            AHSACDFGGG+AE+L+LAKYRQ I  G+
Sbjct  311  AHSACDFGGGRAERLALAKYRQVIWQGR  338



>ref|XP_002867661.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43920.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 166/211 (79%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+N TLVIP LEVNPVWQDSSSF DIFD+ HFI VLKD++ IV+ELP +++WSTR+YY+
Sbjct  128  KIMNVTLVIPRLEVNPVWQDSSSFTDIFDLGHFISVLKDEVRIVRELPIQYAWSTRDYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA WY ENVLPV++SYGIAA+APFSHRLAFDN+P+ IQ LRCKVN
Sbjct  188  TGIRATRIKTAPVHASAEWYLENVLPVIQSYGIAAVAPFSHRLAFDNLPESIQRLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F AL FVPHIR LGDAL+HRLRYP S  +                 G  KF  +HLRFDK
Sbjct  248  FEALNFVPHIRELGDALVHRLRYPPSSSQTSGTMDQTDRINTIVKAGAGKFAVLHLRFDK  307

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHS CDF GGKAEKL+LAKYRQ I  G+
Sbjct  308  DMAAHSGCDFEGGKAEKLALAKYRQVIWQGR  338



>gb|KCW68511.1| hypothetical protein EUGRSUZ_F02148 [Eucalyptus grandis]
Length=491

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 168/211 (80%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQD+SSF DIFDVDHFI  L+ DISIVKELP E+SWSTREYY+
Sbjct  101  KILNATLVIPHLEVNPVWQDASSFSDIFDVDHFISALEGDISIVKELPSEYSWSTREYYA  160

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIK APVHASANWY ENVLP+L+ +GIAAI+PFSHRL F+N+P +IQ LRCKVN
Sbjct  161  TGIRDTRIKMAPVHASANWYLENVLPILQRFGIAAISPFSHRLTFNNLPPNIQRLRCKVN  220

Query  363  FRALVFVPHIRALGDALIHRLRYPAS-----------------KDEGPQKFVAVHLRFDK  491
            F AL FVPH+R LG+ L+  LRYP +                 +++G  KFV +HLRFDK
Sbjct  221  FEALAFVPHVRELGETLVSHLRYPVTESQAMGNLFVKDGREQMRNQGSGKFVVLHLRFDK  280

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAE+++LAKYRQ I  G+
Sbjct  281  DMAAHSACDFGGGKAERMALAKYRQVIWQGR  311



>ref|XP_010061545.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Eucalyptus grandis]
Length=517

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 168/211 (80%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQD+SSF DIFDVDHFI  L+ DISIVKELP E+SWSTREYY+
Sbjct  127  KILNATLVIPHLEVNPVWQDASSFSDIFDVDHFISALEGDISIVKELPSEYSWSTREYYA  186

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIK APVHASANWY ENVLP+L+ +GIAAI+PFSHRL F+N+P +IQ LRCKVN
Sbjct  187  TGIRDTRIKMAPVHASANWYLENVLPILQRFGIAAISPFSHRLTFNNLPPNIQRLRCKVN  246

Query  363  FRALVFVPHIRALGDALIHRLRYPAS-----------------KDEGPQKFVAVHLRFDK  491
            F AL FVPH+R LG+ L+  LRYP +                 +++G  KFV +HLRFDK
Sbjct  247  FEALAFVPHVRELGETLVSHLRYPVTESQAMGNLFVKDGREQMRNQGSGKFVVLHLRFDK  306

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAE+++LAKYRQ I  G+
Sbjct  307  DMAAHSACDFGGGKAERMALAKYRQVIWQGR  337



>ref|XP_009138156.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=515

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 165/211 (78%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILN TLVIP LEVNPVWQDSSSF DIFDVDHFI VLKD++ IV+ELP +++WSTR+YY+
Sbjct  124  KILNVTLVIPRLEVNPVWQDSSSFADIFDVDHFITVLKDEVRIVRELPTQYAWSTRDYYA  183

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP HASA WY ENVLPV++SYGIAA+APFSHRLAFDN+P+ IQ LRCKVN
Sbjct  184  TGIRATRIKTAPTHASAEWYVENVLPVIQSYGIAAVAPFSHRLAFDNVPESIQRLRCKVN  243

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F AL FVP IR LGDA++HRLR P S                    G  KFV +HLRFDK
Sbjct  244  FEALNFVPRIRELGDAVVHRLRNPPSSSITSGATDPTERVNTIAKSGAGKFVVLHLRFDK  303

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHS CDFGGGKAEKL+LAKYRQ I  G+
Sbjct  304  DMAAHSGCDFGGGKAEKLALAKYRQVIWQGR  334



>ref|XP_010448552.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=518

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 166/211 (79%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+N TLVIP LEVNPVWQDSSSF DIFDV+HFI VLKD++ IV+ELP +++WSTR+YY+
Sbjct  127  KIMNVTLVIPRLEVNPVWQDSSSFTDIFDVEHFISVLKDEVRIVRELPTQYAWSTRDYYA  186

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA WY ENVLPV++SYGIAA+APFSHRLAFDN+P+ IQ LRCKVN
Sbjct  187  TGIRATRIKTAPVHASAEWYLENVLPVIQSYGIAAVAPFSHRLAFDNLPESIQRLRCKVN  246

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F AL FVP IR LGDAL+HRLRYP S  +                 G  KF  +HLRFDK
Sbjct  247  FEALNFVPRIRELGDALVHRLRYPPSSSQTSGNMDPTDRINTIVKAGAGKFAVLHLRFDK  306

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHS CDF GGKAEKL+LAKYRQ I  G+
Sbjct  307  DMAAHSGCDFEGGKAEKLALAKYRQVIWQGR  337



>ref|XP_010439017.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
 ref|XP_010439018.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
 ref|XP_010439019.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=518

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 166/211 (79%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+N TLVIP LEVNPVWQDSSSF DIFDV+HFI VLKD++ IV+ELP +++WSTR+YY+
Sbjct  127  KIMNVTLVIPRLEVNPVWQDSSSFTDIFDVEHFISVLKDEVRIVRELPTQYAWSTRDYYA  186

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA WY ENVLPV++SYGIAA+APFSHRLAFDN+P+ IQ LRCKVN
Sbjct  187  TGIRATRIKTAPVHASAEWYLENVLPVIQSYGIAAVAPFSHRLAFDNLPESIQRLRCKVN  246

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F AL FVP IR LGDAL+HRLRYP S  +                 G  KF  +HLRFDK
Sbjct  247  FEALNFVPRIRELGDALVHRLRYPPSSSQTSGNMDPTDRINTIVKAGAGKFAVLHLRFDK  306

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHS CDF GGKAEKL+LAKYRQ I  G+
Sbjct  307  DMAAHSGCDFEGGKAEKLALAKYRQVIWQGR  337



>ref|XP_010433755.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=529

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 166/211 (79%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+N TLVIP LEVNPVWQDSSSF DIFDV+HFI VLKD++ IV+ELP +++WSTR+YY+
Sbjct  138  KIMNVTLVIPRLEVNPVWQDSSSFTDIFDVEHFISVLKDEVRIVRELPTQYAWSTRDYYA  197

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA WY ENVLPV++SYGIAA+APFSHRLAFDN+P+ IQ LRCKVN
Sbjct  198  TGIRATRIKTAPVHASAEWYLENVLPVIQSYGIAAVAPFSHRLAFDNLPESIQRLRCKVN  257

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F AL FVP IR LGDAL+HRLRYP S  +                 G  KF  +HLRFDK
Sbjct  258  FEALNFVPRIRELGDALVHRLRYPPSSSQTSGNIDPTDRINTIVKAGSGKFAVLHLRFDK  317

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHS CDF GGKAEKL+LAKYRQ I  G+
Sbjct  318  DMAAHSGCDFEGGKAEKLALAKYRQVIWQGR  348



>emb|CDY03446.1| BnaC01g16360D [Brassica napus]
Length=613

 Score =   309 bits (791),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 166/211 (79%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILN TLVIP LEVNPVWQDSSSF DIFDVDHFI VLKD++ IV+ELP +++WSTR+YY+
Sbjct  222  KILNVTLVIPRLEVNPVWQDSSSFADIFDVDHFITVLKDEVRIVRELPTQYAWSTRDYYA  281

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP HASA WY ENVLPV++SYGIAA+APFSHRLAFDN+P+ IQ LRCKVN
Sbjct  282  TGIRATRIKTAPTHASAEWYVENVLPVIQSYGIAAVAPFSHRLAFDNVPESIQRLRCKVN  341

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F AL FVP IR LGDAL+HRLR P S  +                 G  KFV +HLRFDK
Sbjct  342  FEALNFVPRIRELGDALVHRLRNPPSTSKTSGDTDPTERVNTIAKSGAGKFVVLHLRFDK  401

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHS CDFGGGKAEKL+LAKYRQ I  G+
Sbjct  402  DMAAHSGCDFGGGKAEKLALAKYRQVIWQGR  432



>emb|CAA23010.1| PsRT17-1 like protein [Arabidopsis thaliana]
 emb|CAB79363.1| PsRT17-1 like protein [Arabidopsis thaliana]
Length=431

 Score =   303 bits (777),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 165/211 (78%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+N TLVIP LEVN VWQDSSSF DIFD+DHFI VLKD++ IV+ELP +++WSTR+YY+
Sbjct  40   KIMNVTLVIPRLEVNTVWQDSSSFTDIFDLDHFISVLKDEVRIVRELPIQYAWSTRDYYA  99

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA WY ENVLP+++SYGIAA+APFSHRLAFDN+P+ IQ LRCKVN
Sbjct  100  TGIRATRIKTAPVHASAEWYLENVLPIIQSYGIAAVAPFSHRLAFDNLPESIQRLRCKVN  159

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F AL FVPHIR LGDAL+HRLR P S  +                 G  KF  +HLRFDK
Sbjct  160  FEALNFVPHIRELGDALVHRLRNPPSSSQTSGTMDPTDRINTIVKAGAGKFAVLHLRFDK  219

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHS CDF GGKAEKL+LAKYRQ I  G+
Sbjct  220  DMAAHSGCDFEGGKAEKLALAKYRQVIWQGR  250



>gb|AGV54860.1| O-fucosyltransferase family protein [Phaseolus vulgaris]
Length=516

 Score =   306 bits (783),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 171/211 (81%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+ EVNPVWQDSSSF DIFD+DHFI+VL++++SIVKE P ++SWSTREYY+
Sbjct  126  KILNATLVIPHFEVNPVWQDSSSFEDIFDLDHFIDVLRNEVSIVKEPPSDYSWSTREYYA  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP+ A+A+WY ENVLPVLRSYGIAAIAPFSHRL F+N+P DIQ LRCKVN
Sbjct  186  TGIRATRIKTAPIQATADWYIENVLPVLRSYGIAAIAPFSHRLTFNNLPSDIQRLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLR------------YPASK-----DEGPQKFVAVHLRFDK  491
            F AL+FVPHI+ LGDA+IHRLR            +P  +      +   KFV +HLRFDK
Sbjct  246  FEALIFVPHIKELGDAIIHRLRRTSIVNQAEAKYFPLEETDVLIKQQTGKFVVLHLRFDK  305

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ +  G+
Sbjct  306  DMAAHSACDFGGGKAEKLALAKYRQVLWQGR  336



>gb|KHN09000.1| DUF246 domain-containing protein [Glycine soja]
Length=510

 Score =   305 bits (782),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 168/206 (82%), Gaps = 12/206 (6%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+P+ EVNPVWQDSSSF DIFDVDHFI+VL+D++SIVKELP ++SWSTREYY 
Sbjct  125  KILNATLVLPHFEVNPVWQDSSSFADIFDVDHFIDVLRDEVSIVKELPSDYSWSTREYYG  184

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPV A+++WY ENVLPVL+SYGIAAIAPFSHRL F+N+P  IQ LRCKVN
Sbjct  185  TGIRATRIKTAPVQATSDWYIENVLPVLQSYGIAAIAPFSHRLTFNNLPSYIQRLRCKVN  244

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGP------------QKFVAVHLRFDKDMAAH  506
            F AL+FV HI+ LG A++H LR+P   ++ P             KFV +HLRFDKDMAAH
Sbjct  245  FEALIFVSHIKELGKAIVHHLRHPTEGNDYPLEETDKFGKQQTGKFVVLHLRFDKDMAAH  304

Query  507  SACDFGGGKAEKLSLAKYRQNILAGK  584
            SACDFGGGKAEKL+LAKYRQ +  G+
Sbjct  305  SACDFGGGKAEKLALAKYRQVLWQGR  330



>ref|XP_010523344.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
 ref|XP_010523345.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
Length=519

 Score =   305 bits (782),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 167/211 (79%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILN TLVIP+ EVNPVWQDSSSF DIFDVDHFI +LKD++ I +ELP  ++WSTREYY+
Sbjct  127  KILNVTLVIPHFEVNPVWQDSSSFTDIFDVDHFISILKDEVQIARELPTSYAWSTREYYT  186

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA WY ENVLPV++SYGIAA+APFSHRL FDN+P+ IQ LRCKVN
Sbjct  187  TGIRSTRIKTAPVHASARWYVENVLPVIQSYGIAAVAPFSHRLGFDNLPEHIQRLRCKVN  246

Query  363  FRALVFVPHIRALGDALIHRLRYPA--SKDEG--PQK-------------FVAVHLRFDK  491
            F AL FVP I  LGDAL+HRLR+PA  SK  G  PQK             F  +HLRFDK
Sbjct  247  FEALKFVPRIWELGDALVHRLRHPASISKTSGTQPQKDRVDIIAKARAETFAVLHLRFDK  306

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  307  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  337



>ref|XP_010107675.1| hypothetical protein L484_007693 [Morus notabilis]
 gb|EXC16648.1| hypothetical protein L484_007693 [Morus notabilis]
Length=529

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 173/211 (82%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+L+VNPVWQDSSSF +IFDVDHFI+VL+++IS+VKELP  FSWSTREYY+
Sbjct  139  KILNATLVIPHLDVNPVWQDSSSFAEIFDVDHFIDVLRNEISVVKELPSYFSWSTREYYA  198

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA+WY ENVLP+L+SYGI AIAPFSHRL F+++P +IQ LRCKVN
Sbjct  199  TGIRATRIKTAPVHASADWYLENVLPLLQSYGIVAIAPFSHRLTFNDLPVNIQRLRCKVN  258

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F+AL FVPHI+ LG+ L+ RLR+P +K+                 +G  K+V +HLRFDK
Sbjct  259  FKALDFVPHIKELGETLVQRLRHPPTKNQVSGTEYLQEGNNEIKKQGDGKYVVLHLRFDK  318

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  319  DMAAHSACDFGGGKAEKLALAKYRQVIWQGR  349



>emb|CDY37829.1| BnaAnng04900D [Brassica napus]
Length=505

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 170/213 (80%), Gaps = 19/213 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LE+NPVWQDSSSF+DIFDVDHFI+ LKDD+ +VKELP+++SWSTREYY+
Sbjct  113  KILNATLVIPFLEINPVWQDSSSFVDIFDVDHFIDALKDDVRVVKELPEDYSWSTREYYA  172

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             A+R TR+KTAPVHASA WY ENV P+L SYGIAAI+PFSHRL+FD++P +IQ LRCKVN
Sbjct  173  AAVRETRVKTAPVHASAQWYIENVSPLLHSYGIAAISPFSHRLSFDHLPGEIQRLRCKVN  232

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-------------------PQKFVAVHLRF  485
            F+AL FVPHI +LGDAL+ RLR P  + E                    P KF  +HLRF
Sbjct  233  FQALRFVPHITSLGDALVSRLRNPLWRSEKDRKSVDHLGDMTNPNSRHEPGKFAVLHLRF  292

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  293  DKDMAAHSACDFGGGKAEKLALAKYRQMIWQGR  325



>emb|CDY33958.1| BnaC02g43790D [Brassica napus]
Length=505

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 169/213 (79%), Gaps = 19/213 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LE+NPVWQDSSSF+DIFDVDHFI+ LKDD+ +VKELP E+SWSTREYY+
Sbjct  113  KILNATLVIPFLEINPVWQDSSSFVDIFDVDHFIDALKDDVRVVKELPGEYSWSTREYYA  172

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             A+R TR+KTAPVHASA WY ENV P+L SYGIAAI+PFSHRL+FD++P +IQ LRCKVN
Sbjct  173  AAVRETRVKTAPVHASAQWYIENVSPLLHSYGIAAISPFSHRLSFDHLPGEIQRLRCKVN  232

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-------------------PQKFVAVHLRF  485
            F+AL FVPHI +LGDAL+ RLR P  + +                    P KF  +HLRF
Sbjct  233  FQALRFVPHITSLGDALVSRLRNPLWRSDKERKSVDHLGDMTNPNSRHEPGKFAVLHLRF  292

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  293  DKDMAAHSACDFGGGKAEKLALAKYRQMIWQGR  325



>gb|KHN08263.1| DUF246 domain-containing protein [Glycine soja]
Length=511

 Score =   304 bits (778),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 170/206 (83%), Gaps = 12/206 (6%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+P+ EVNPVWQDSSSF DIFDVDHFI+ L+D++SIVKELP ++SWSTREYY 
Sbjct  126  KILNATLVLPHFEVNPVWQDSSSFADIFDVDHFIDDLRDEVSIVKELPSDYSWSTREYYG  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPV A+ +WY ENVLPVL+SYGIAAIAPFSHRL F+N+P DIQ LRCKVN
Sbjct  186  TGIRATRIKTAPVQATVDWYIENVLPVLQSYGIAAIAPFSHRLTFNNLPSDIQRLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLR-------YPASKDE--GPQ---KFVAVHLRFDKDMAAH  506
            F AL+FV HI+ LG+A++HRLR       YP  +++  G Q   KFV +HLRFDKDMAAH
Sbjct  246  FEALIFVSHIKELGNAIVHRLRHTTEGSDYPLEENDKFGKQQTGKFVVLHLRFDKDMAAH  305

Query  507  SACDFGGGKAEKLSLAKYRQNILAGK  584
            SACDFGGGKAEKL+L KYRQ +  G+
Sbjct  306  SACDFGGGKAEKLALVKYRQVLWQGR  331



>ref|XP_004501643.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=513

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 168/211 (80%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILN TLVIP+ EVNPVWQDSSSF DIFDVDHFIEVL+ ++SIVKELP E+SWSTREYY+
Sbjct  123  KILNVTLVIPHFEVNPVWQDSSSFADIFDVDHFIEVLRGEVSIVKELPSEYSWSTREYYA  182

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPV A+A+WY ENVLPVL+SYG+AAIAPFSHRL F+ +P DIQ LRCKVN
Sbjct  183  TGIRDTRIKTAPVQATADWYIENVLPVLQSYGVAAIAPFSHRLTFNGLPSDIQRLRCKVN  242

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE--------------GPQ---KFVAVHLRFDK  491
            F AL FVPHI+ LGD L+H LR  AS ++              G Q   KFV +HLRFDK
Sbjct  243  FEALNFVPHIKELGDILVHHLRNNASINQAEGNDYLLEETDKLGKQQSGKFVVLHLRFDK  302

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHSACDFGGGKAEKL+LAKYRQ +  G+
Sbjct  303  DMAAHSACDFGGGKAEKLALAKYRQVLWQGR  333



>ref|XP_003523785.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=511

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 169/206 (82%), Gaps = 12/206 (6%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+P+ EVNPVWQDSSSF DIFDVDHFI+ L+D++SIVKELP ++SWSTREYY 
Sbjct  126  KILNATLVLPHFEVNPVWQDSSSFADIFDVDHFIDDLRDEVSIVKELPSDYSWSTREYYG  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPV A+ +WY ENVLPVL+SYGIAAIAPFSHRL F+N+P DIQ LRCKVN
Sbjct  186  TGIRATRIKTAPVQATVDWYIENVLPVLQSYGIAAIAPFSHRLTFNNLPSDIQRLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLR-------YPASKDE--GPQ---KFVAVHLRFDKDMAAH  506
            F AL+FV HI+ LG+A++HRLR       YP  + +  G Q   KFV +HLRFDKDMAAH
Sbjct  246  FEALIFVSHIKELGNAIVHRLRHTTEGSDYPLEETDKFGKQQTGKFVVLHLRFDKDMAAH  305

Query  507  SACDFGGGKAEKLSLAKYRQNILAGK  584
            SACDFGGGKAEKL+L KYRQ +  G+
Sbjct  306  SACDFGGGKAEKLALVKYRQVLWQGR  331



>emb|CDP11502.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 165/209 (79%), Gaps = 15/209 (7%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+P+ EVNPVWQDSSSF DIFD DHFI+ LK+++S+VK+LP + SWSTREYY+
Sbjct  127  KILNATLVLPHFEVNPVWQDSSSFTDIFDADHFIDALKNEVSVVKDLPSQHSWSTREYYA  186

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP+HA A WY ENVLPV++SYGIAAIAPFSHRLAFDN+P +IQ LRCKVN
Sbjct  187  TGIRATRIKTAPMHAPATWYLENVLPVMQSYGIAAIAPFSHRLAFDNLPSEIQQLRCKVN  246

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG---------------PQKFVAVHLRFDKDM  497
            F ALVFVPHIR L + LI+RLRY  S D                   K+V +HLRFDKDM
Sbjct  247  FEALVFVPHIRMLAETLINRLRYAPSGDRAVGVSNWEERLDDKRRAGKYVVLHLRFDKDM  306

Query  498  AAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            AAHSACDFGGGKAEKL+L KYRQ +  G+
Sbjct  307  AAHSACDFGGGKAEKLALGKYRQVLWQGR  335



>ref|XP_008444924.1| PREDICTED: uncharacterized protein At1g04910-like [Cucumis melo]
Length=515

 Score =   303 bits (775),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 173/209 (83%), Gaps = 15/209 (7%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            +ILNATL+IP+LE+N VW+DSSSF +IFDVD+FI+VL+DDISIVKELP E+SWSTREYY+
Sbjct  126  RILNATLIIPHLEINAVWKDSSSFGEIFDVDYFIDVLRDDISIVKELPTEYSWSTREYYA  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP HASANWY ENVLPVL+SYGIAAI+PFSHRL+F+++P +IQHLRCKVN
Sbjct  186  TGIRNTRIKTAPTHASANWYLENVLPVLQSYGIAAISPFSHRLSFNDLPTEIQHLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQ---------------KFVAVHLRFDKDM  497
            F+AL FV  I  LGD +I+RLRYP+++ E  +               KFV +HLRFDKDM
Sbjct  246  FKALAFVRGITELGDTIINRLRYPSNQKETERVESLLEDEKRKLEGGKFVVLHLRFDKDM  305

Query  498  AAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            AAHSAC+FGGGKAE+L+LAKYRQ I  G+
Sbjct  306  AAHSACEFGGGKAERLALAKYRQVIWQGR  334



>ref|NP_194184.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AAP68214.1| At4g24530 [Arabidopsis thaliana]
 dbj|BAE99793.1| PsRT17-1 like protein [Arabidopsis thaliana]
 gb|AEE84921.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=519

 Score =   303 bits (775),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 165/211 (78%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+N TLVIP LEVN VWQDSSSF DIFD+DHFI VLKD++ IV+ELP +++WSTR+YY+
Sbjct  128  KIMNVTLVIPRLEVNTVWQDSSSFTDIFDLDHFISVLKDEVRIVRELPIQYAWSTRDYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA WY ENVLP+++SYGIAA+APFSHRLAFDN+P+ IQ LRCKVN
Sbjct  188  TGIRATRIKTAPVHASAEWYLENVLPIIQSYGIAAVAPFSHRLAFDNLPESIQRLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F AL FVPHIR LGDAL+HRLR P S  +                 G  KF  +HLRFDK
Sbjct  248  FEALNFVPHIRELGDALVHRLRNPPSSSQTSGTMDPTDRINTIVKAGAGKFAVLHLRFDK  307

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHS CDF GGKAEKL+LAKYRQ I  G+
Sbjct  308  DMAAHSGCDFEGGKAEKLALAKYRQVIWQGR  338



>ref|XP_009130513.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Brassica rapa]
Length=506

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 170/213 (80%), Gaps = 19/213 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LE+NPVWQDSSSF+DIFDVDHFI+ LKDD+ +VKELP+++SWSTREYY+
Sbjct  114  KILNATLVIPFLEINPVWQDSSSFVDIFDVDHFIDALKDDVRVVKELPEDYSWSTREYYA  173

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             A+R TR+KTAPVHASA WY ENV P+L SYGIAAI+PFS+RL+FD++P +IQ LRCKVN
Sbjct  174  AAVRETRVKTAPVHASAQWYIENVSPLLHSYGIAAISPFSNRLSFDHLPGEIQRLRCKVN  233

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-------------------PQKFVAVHLRF  485
            F+AL FVPHI +LGDAL+ RLR P  + E                    P KF  +HLRF
Sbjct  234  FQALRFVPHITSLGDALVSRLRNPLWRSEKDRKSVDHLGDMTNPNSRHEPGKFAVLHLRF  293

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  294  DKDMAAHSACDFGGGKAEKLALAKYRQMIWQGR  326



>ref|XP_009130514.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Brassica rapa]
Length=505

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 170/213 (80%), Gaps = 19/213 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LE+NPVWQDSSSF+DIFDVDHFI+ LKDD+ +VKELP+++SWSTREYY+
Sbjct  113  KILNATLVIPFLEINPVWQDSSSFVDIFDVDHFIDALKDDVRVVKELPEDYSWSTREYYA  172

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             A+R TR+KTAPVHASA WY ENV P+L SYGIAAI+PFS+RL+FD++P +IQ LRCKVN
Sbjct  173  AAVRETRVKTAPVHASAQWYIENVSPLLHSYGIAAISPFSNRLSFDHLPGEIQRLRCKVN  232

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-------------------PQKFVAVHLRF  485
            F+AL FVPHI +LGDAL+ RLR P  + E                    P KF  +HLRF
Sbjct  233  FQALRFVPHITSLGDALVSRLRNPLWRSEKDRKSVDHLGDMTNPNSRHEPGKFAVLHLRF  292

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DKDMAAHSACDFGGGKAEKL+LAKYRQ I  G+
Sbjct  293  DKDMAAHSACDFGGGKAEKLALAKYRQMIWQGR  325



>emb|CDY34289.1| BnaA01g13920D [Brassica napus]
Length=792

 Score =   309 bits (792),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 165/211 (78%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILN TLVIP LEVNPVWQDSSSF DIFDVDHFI VLKD++ IV+ELP +++WSTR+YY+
Sbjct  401  KILNVTLVIPRLEVNPVWQDSSSFADIFDVDHFITVLKDEVRIVRELPTQYAWSTRDYYA  460

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP HASA WY ENVLPV++SYGIAA+APFSHRLAFDN+P+ IQ LRCKVN
Sbjct  461  TGIRATRIKTAPTHASAEWYVENVLPVIQSYGIAAVAPFSHRLAFDNVPESIQRLRCKVN  520

Query  363  FRALVFVPHIRALGDALIHRLRYPASKD-----------------EGPQKFVAVHLRFDK  491
            F AL FVP IR LGDA++HRLR P S                    G  KFV +HLRFDK
Sbjct  521  FEALNFVPRIRELGDAVVHRLRNPPSSSITSGATDPTERVNTIAKSGAGKFVVLHLRFDK  580

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHS CDFGGGKAEKL+LAKYRQ I  G+
Sbjct  581  DMAAHSGCDFGGGKAEKLALAKYRQVIWQGR  611



>gb|KJB18177.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=367

 Score =   296 bits (758),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 157/187 (84%), Gaps = 17/187 (9%)
 Frame = +3

Query  75   MDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYSTAIRPTRIKTAPVHASANWYSENV  254
            MDIFDVDHFI VLKDDISIVKELPD+FSWSTREYY+TAIRPTRIK APVHASANWY ENV
Sbjct  1    MDIFDVDHFINVLKDDISIVKELPDDFSWSTREYYATAIRPTRIKRAPVHASANWYLENV  60

Query  255  LPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVNFRALVFVPHIRALGDALIHRLRYP  434
            LPVL+S GIAAI+PFSHRL+F+N+P +IQ LRCKVNF+ALVFVPHIRALGDAL+HRLRYP
Sbjct  61   LPVLQSNGIAAISPFSHRLSFNNLPSEIQKLRCKVNFKALVFVPHIRALGDALVHRLRYP  120

Query  435  ASKDEG-----------------PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYR  563
             ++ +                  PQKFV VHLRFDKDMAAHSACDFGGGKAEKL+LAKYR
Sbjct  121  PTESQPLITDDLTGTTDRNVKQMPQKFVVVHLRFDKDMAAHSACDFGGGKAEKLALAKYR  180

Query  564  QNILAGK  584
            Q I  G+
Sbjct  181  QRIWGGR  187



>ref|XP_004152738.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004163454.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
Length=515

 Score =   301 bits (770),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 171/209 (82%), Gaps = 15/209 (7%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            +ILNATL+IP+LE+N VW+DSSSF +IFDVDHFI+VL+DDISIVKELP E+SWSTREYY+
Sbjct  126  RILNATLIIPHLEINAVWKDSSSFGEIFDVDHFIDVLRDDISIVKELPTEYSWSTREYYA  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP HASANWY ENVLP+++SYGIAAIAPFSHRL+F+++P +IQHLRCKVN
Sbjct  186  TGIRSTRIKTAPTHASANWYLENVLPIMQSYGIAAIAPFSHRLSFNDLPTEIQHLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQ---------------KFVAVHLRFDKDM  497
            F AL FV  I  LGD +I+RLRY +++ E  +               KFV +HLRFDKDM
Sbjct  246  FMALAFVRGITELGDTIINRLRYSSNQKETERVDSLLEDEKIQLKGGKFVVLHLRFDKDM  305

Query  498  AAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            AAHSAC+FGGGKAE+L+LAKYRQ I  G+
Sbjct  306  AAHSACEFGGGKAERLALAKYRQVIWQGR  334



>ref|XP_011016933.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Populus 
euphratica]
Length=513

 Score =   301 bits (770),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 166/211 (79%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVN VWQD+SSF DIFDV+HFI+ L  D++IVKE P E+ WSTREYY+
Sbjct  123  KILNATLVIPHLEVNAVWQDTSSFADIFDVEHFIDTLSHDVAIVKEPPSEYWWSTREYYA  182

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR  RIKTAPVH SA+WY ENVLPVL+SYGIAAIAPFSHRLAFD +P DIQ LRCKVN
Sbjct  183  TGIRAMRIKTAPVHGSADWYLENVLPVLQSYGIAAIAPFSHRLAFDKLPPDIQRLRCKVN  242

Query  363  FRALVFVPHIRALGDALIHRLRYPASK-----------------DEGPQKFVAVHLRFDK  491
            F AL+FVPHIR LGD L++RLR+P  K                  EG  KFV +HLRFDK
Sbjct  243  FHALIFVPHIRVLGDTLVNRLRHPFEKFHTSGTGFLKERMNDTESEGSGKFVVLHLRFDK  302

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHS+CDFGGGKAE+L+LAKYRQ +  G+
Sbjct  303  DMAAHSSCDFGGGKAERLALAKYRQVLWQGR  333



>ref|XP_002301095.2| hypothetical protein POPTR_0002s10600g [Populus trichocarpa]
 gb|EEE80368.2| hypothetical protein POPTR_0002s10600g [Populus trichocarpa]
Length=513

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 166/211 (79%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVN VWQD+SSF DIFDV+HFI+ L  D++IVKE P E+ WSTREYY+
Sbjct  123  KILNATLVIPHLEVNAVWQDTSSFADIFDVEHFIDTLSHDVAIVKEPPSEYWWSTREYYA  182

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR  RIKTAPVH SA+WY ENVLPVL+SYGIAAIAPFSHRLAFD +P +IQ LRCKVN
Sbjct  183  TGIRAMRIKTAPVHGSADWYLENVLPVLQSYGIAAIAPFSHRLAFDKLPPNIQRLRCKVN  242

Query  363  FRALVFVPHIRALGDALIHRLRYPASK-----------------DEGPQKFVAVHLRFDK  491
            F AL FVPHIR LGDAL++RLR+P  K                  EG  KFV +HLRFDK
Sbjct  243  FHALTFVPHIRVLGDALVNRLRHPFEKFHTSGTGFLKERMNDTESEGSGKFVVLHLRFDK  302

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHS+CDFGGGKAE+L+LAKYRQ +  G+
Sbjct  303  DMAAHSSCDFGGGKAERLALAKYRQLLWQGR  333



>ref|XP_006285210.1| hypothetical protein CARUB_v10006569mg [Capsella rubella]
 gb|EOA18108.1| hypothetical protein CARUB_v10006569mg [Capsella rubella]
Length=521

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 165/211 (78%), Gaps = 17/211 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+N TLVIP LEVNPVWQDSSSF DIFDV+H+I VLKD++ IV++LP +++WSTR+YY+
Sbjct  130  KIMNVTLVIPRLEVNPVWQDSSSFTDIFDVEHYISVLKDEVRIVRDLPTQYAWSTRDYYA  189

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA WY ENVLPV++SYGIAA+APFSHRLAFDN+P+ IQ LRCKVN
Sbjct  190  TGIRATRIKTAPVHASAEWYLENVLPVIQSYGIAAVAPFSHRLAFDNLPESIQRLRCKVN  249

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F AL FVP I+ LGDAL+HRLRYP S                    G  KF  +HLRFDK
Sbjct  250  FDALNFVPRIQELGDALVHRLRYPPSISRASGTMDPTDRINTIVKAGAGKFAVLHLRFDK  309

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHS CDF GGKAEKL+LAKYRQ I  G+
Sbjct  310  DMAAHSGCDFEGGKAEKLALAKYRQVIWQGR  340



>ref|NP_001063155.1| Os09g0412200 [Oryza sativa Japonica Group]
 dbj|BAD28369.1| putative auxin-independent growth promoter [Oryza sativa Japonica 
Group]
 dbj|BAF25069.1| Os09g0412200 [Oryza sativa Japonica Group]
 dbj|BAG90088.1| unnamed protein product [Oryza sativa Japonica Group]
Length=512

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 166/206 (81%), Gaps = 12/206 (6%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNA+LVIP+LEVNPVW+D+SSF +IFDVDHFI  LK ++SIVK LP +FSWSTREYY 
Sbjct  127  KILNASLVIPHLEVNPVWKDTSSFEEIFDVDHFINTLKAEVSIVKVLPKKFSWSTREYYG  186

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA+WY ENV P+L+SYGIAAIAPFSHRLAFD++P DIQHLRCKVN
Sbjct  187  TGIRATRIKTAPVHASASWYLENVSPILQSYGIAAIAPFSHRLAFDDLPVDIQHLRCKVN  246

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG------------PQKFVAVHLRFDKDMAAH  506
            F+ALVF+PHI +LG+ L+ RLR P     G              K+  +HLRFDKDMAAH
Sbjct  247  FQALVFLPHIISLGETLVKRLRSPVQGQSGELIQEVGEDTNQAGKYAVLHLRFDKDMAAH  306

Query  507  SACDFGGGKAEKLSLAKYRQNILAGK  584
            SACDFGGG+AE+L+LAKYRQ I  G+
Sbjct  307  SACDFGGGRAERLALAKYRQVIWQGR  332



>ref|XP_006661225.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Oryza 
brachyantha]
Length=492

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 164/206 (80%), Gaps = 12/206 (6%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            K+LNATLVIP+LEVNPVW+DSSSF +IFDVDHFI  LK ++SIVK LP EFSWSTREYY 
Sbjct  107  KVLNATLVIPHLEVNPVWKDSSSFAEIFDVDHFINTLKAEVSIVKVLPKEFSWSTREYYG  166

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIK AP+HASA+WY ENV P+L+SYGIAAIAPFSHRLAFD++P DIQ LRCKVN
Sbjct  167  TGIRATRIKNAPLHASASWYLENVSPILQSYGIAAIAPFSHRLAFDDLPADIQRLRCKVN  226

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG------------PQKFVAVHLRFDKDMAAH  506
            F+AL F+PHI +LG+AL+ RLR P     G              K+  +HLRFDKDMAAH
Sbjct  227  FQALAFLPHIISLGEALVKRLRSPVQGHSGELIQEVGEDTTQAGKYAVLHLRFDKDMAAH  286

Query  507  SACDFGGGKAEKLSLAKYRQNILAGK  584
            SACDFGGG+AE+L+LAKYRQ I  G+
Sbjct  287  SACDFGGGRAERLALAKYRQVIWQGR  312



>ref|XP_008651492.1| PREDICTED: LOC100283829 isoform X1 [Zea mays]
 gb|ACF82519.1| unknown [Zea mays]
 tpg|DAA61414.1| TPA: hypothetical protein ZEAMMB73_640362 [Zea mays]
Length=447

 Score =   293 bits (749),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 166/206 (81%), Gaps = 12/206 (6%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVW+DSSSF +IFDVDHFI  LKD++SI+K LP EFSWSTREYY 
Sbjct  62   KILNATLVIPHLEVNPVWKDSSSFEEIFDVDHFINSLKDEVSIIKVLPKEFSWSTREYYG  121

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP+HASANWY ENV P+L+SYGI AIAPFSHRLAFD++P D+Q LRCKVN
Sbjct  122  TGIRATRIKTAPLHASANWYLENVSPILQSYGIVAIAPFSHRLAFDDLPVDLQRLRCKVN  181

Query  363  FRALVFVPHIRALGDALIHRLRYP----ASKD--------EGPQKFVAVHLRFDKDMAAH  506
            F+ALVF  HI +LG+ L+ RLR P    +SK            +K+  +HLRFDKDMAAH
Sbjct  182  FQALVFRSHIISLGETLVKRLRSPVRVHSSKSIHQVVGDTNQAEKYAVLHLRFDKDMAAH  241

Query  507  SACDFGGGKAEKLSLAKYRQNILAGK  584
            SACDFGGG+AE+L+LAKYRQ I  G+
Sbjct  242  SACDFGGGRAEQLALAKYRQVIWQGR  267



>ref|XP_004956798.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=512

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 165/207 (80%), Gaps = 13/207 (6%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVW+DSSSF +IFDVDHFI  LKDD+SI+K LP EFSWSTREYY 
Sbjct  126  KILNATLVIPHLEVNPVWKDSSSFEEIFDVDHFINSLKDDVSIIKVLPKEFSWSTREYYG  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP+HASA WY ENV P+L+SYGIAAIAPFSHRLAFD++P D+Q LRCKVN
Sbjct  186  TGIRATRIKTAPLHASAKWYLENVSPILQSYGIAAIAPFSHRLAFDDLPADLQRLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLRYPAS--KDEG-----------PQKFVAVHLRFDKDMAA  503
            F+ALVF PHI +LG+ L+ RLR P     DE              K+  +HLRFDKDMAA
Sbjct  246  FQALVFRPHIISLGETLVKRLRSPVQGHSDESIHQVVEESTNQAGKYAVLHLRFDKDMAA  305

Query  504  HSACDFGGGKAEKLSLAKYRQNILAGK  584
            HS+CDFGGG+AEKL+LAKYR+ I  G+
Sbjct  306  HSSCDFGGGRAEKLALAKYRKVIWQGR  332



>ref|XP_002462371.1| hypothetical protein SORBIDRAFT_02g024540 [Sorghum bicolor]
 gb|EER98892.1| hypothetical protein SORBIDRAFT_02g024540 [Sorghum bicolor]
Length=511

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 163/206 (79%), Gaps = 12/206 (6%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVW+DSSSF +IFDVDHFI  LKD++SI+K LP EFSWSTREYY 
Sbjct  126  KILNATLVIPHLEVNPVWKDSSSFEEIFDVDHFINSLKDEVSIIKALPKEFSWSTREYYG  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP+HASANWY ENV P+L+SYGIAA+APFSHRLAFD++P D+Q LRCKVN
Sbjct  186  TGIRATRIKTAPIHASANWYLENVSPILQSYGIAAVAPFSHRLAFDDLPADLQRLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG------------PQKFVAVHLRFDKDMAAH  506
            F+ALVF  HI +LG+ L+ RLR                     QK+  +HLRFDKDMAAH
Sbjct  246  FQALVFRSHIISLGETLVKRLRSSVGGRSSKSIHQVVGDTNQAQKYAVLHLRFDKDMAAH  305

Query  507  SACDFGGGKAEKLSLAKYRQNILAGK  584
            SACDFGGG+AE+L+LAKYRQ I  G+
Sbjct  306  SACDFGGGRAEQLALAKYRQVIWQGR  331



>gb|EEE69695.1| hypothetical protein OsJ_29339 [Oryza sativa Japonica Group]
Length=722

 Score =   299 bits (765),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 166/206 (81%), Gaps = 12/206 (6%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNA+LVIP+LEVNPVW+D+SSF +IFDVDHFI  LK ++SIVK LP +FSWSTREYY 
Sbjct  127  KILNASLVIPHLEVNPVWKDTSSFEEIFDVDHFINTLKAEVSIVKVLPKKFSWSTREYYG  186

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA+WY ENV P+L+SYGIAAIAPFSHRLAFD++P DIQHLRCKVN
Sbjct  187  TGIRATRIKTAPVHASASWYLENVSPILQSYGIAAIAPFSHRLAFDDLPVDIQHLRCKVN  246

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGP------------QKFVAVHLRFDKDMAAH  506
            F+ALVF+PHI +LG+ L+ RLR P     G              K+  +HLRFDKDMAAH
Sbjct  247  FQALVFLPHIISLGETLVKRLRSPVQGQSGELIQEVGEDTNQAGKYAVLHLRFDKDMAAH  306

Query  507  SACDFGGGKAEKLSLAKYRQNILAGK  584
            SACDFGGG+AE+L+LAKYRQ I  G+
Sbjct  307  SACDFGGGRAERLALAKYRQVIWQGR  332



>tpg|DAA61415.1| TPA: hypothetical protein ZEAMMB73_640362 [Zea mays]
Length=486

 Score =   292 bits (747),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 166/206 (81%), Gaps = 12/206 (6%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVW+DSSSF +IFDVDHFI  LKD++SI+K LP EFSWSTREYY 
Sbjct  91   KILNATLVIPHLEVNPVWKDSSSFEEIFDVDHFINSLKDEVSIIKVLPKEFSWSTREYYG  150

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP+HASANWY ENV P+L+SYGI AIAPFSHRLAFD++P D+Q LRCKVN
Sbjct  151  TGIRATRIKTAPLHASANWYLENVSPILQSYGIVAIAPFSHRLAFDDLPVDLQRLRCKVN  210

Query  363  FRALVFVPHIRALGDALIHRLRYP----ASKD--------EGPQKFVAVHLRFDKDMAAH  506
            F+ALVF  HI +LG+ L+ RLR P    +SK            +K+  +HLRFDKDMAAH
Sbjct  211  FQALVFRSHIISLGETLVKRLRSPVRVHSSKSIHQVVGDTNQAEKYAVLHLRFDKDMAAH  270

Query  507  SACDFGGGKAEKLSLAKYRQNILAGK  584
            SACDFGGG+AE+L+LAKYRQ I  G+
Sbjct  271  SACDFGGGRAEQLALAKYRQVIWQGR  296



>ref|NP_001150199.1| LOC100283829 [Zea mays]
 gb|ACG38224.1| psRT17-1 like protein [Zea mays]
 tpg|DAA61416.1| TPA: psRT17-1 like protein [Zea mays]
Length=511

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 166/206 (81%), Gaps = 12/206 (6%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVW+DSSSF +IFDVDHFI  LKD++SI+K LP EFSWSTREYY 
Sbjct  126  KILNATLVIPHLEVNPVWKDSSSFEEIFDVDHFINSLKDEVSIIKVLPKEFSWSTREYYG  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP+HASANWY ENV P+L+SYGI AIAPFSHRLAFD++P D+Q LRCKVN
Sbjct  186  TGIRATRIKTAPLHASANWYLENVSPILQSYGIVAIAPFSHRLAFDDLPVDLQRLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLRYP----ASKD--------EGPQKFVAVHLRFDKDMAAH  506
            F+ALVF  HI +LG+ L+ RLR P    +SK            +K+  +HLRFDKDMAAH
Sbjct  246  FQALVFRSHIISLGETLVKRLRSPVRVHSSKSIHQVVGDTNQAEKYAVLHLRFDKDMAAH  305

Query  507  SACDFGGGKAEKLSLAKYRQNILAGK  584
            SACDFGGG+AE+L+LAKYRQ I  G+
Sbjct  306  SACDFGGGRAEQLALAKYRQVIWQGR  331



>ref|XP_010543952.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Tarenaya 
hassleriana]
Length=192

 Score =   280 bits (717),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 158/192 (82%), Gaps = 17/192 (9%)
 Frame = +3

Query  60   DSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYSTAIRPTRIKTAPVHASANW  239
            DSSSF++IFDVDHFI+VLKDD+ I+KELP++FSWSTREYY+TAIR TR+KTAPVHASANW
Sbjct  1    DSSSFVEIFDVDHFIDVLKDDVRIIKELPEKFSWSTREYYATAIRETRVKTAPVHASANW  60

Query  240  YSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVNFRALVFVPHIRALGDALIH  419
            Y ENVLPVL S+GIAAIAPFSHRL+FD++P +IQ LRCKVNFRAL FVPH+R LGDAL+ 
Sbjct  61   YLENVLPVLESFGIAAIAPFSHRLSFDHLPPEIQRLRCKVNFRALRFVPHVRELGDALVS  120

Query  420  RLRYPASKD-----------------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  548
            RLR P+ ++                 + P KFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  121  RLRNPSWRNKEQNVDHLTDITNSHSRQEPGKFVVLHLRFDKDMAAHSACDFGGGKAEKLA  180

Query  549  LAKYRQNILAGK  584
            LAKYRQ I  G+
Sbjct  181  LAKYRQMIWQGR  192



>dbj|BAK06980.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score =   288 bits (736),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 162/207 (78%), Gaps = 13/207 (6%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVW+DSSSF DIF+VDHFI  L+ D+SIV+    EFSWSTRE+YS
Sbjct  126  KILNATLVIPHLEVNPVWKDSSSFGDIFNVDHFINTLRGDVSIVRAPLKEFSWSTREFYS  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP+HASANWY ENV P+L+SYGIAAIAPFSHRLAFD++P DIQ LRCKVN
Sbjct  186  TGIRATRIKTAPLHASANWYIENVSPILQSYGIAAIAPFSHRLAFDDLPVDIQRLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLRYPASK-------------DEGPQKFVAVHLRFDKDMAA  503
            F ALVFVP+I +LG  L  RLR P                 +  +K+  VHLRFDKDMAA
Sbjct  246  FEALVFVPYIISLGRTLEKRLRSPVQGHSTELTQQVVEDYTDQSEKYAVVHLRFDKDMAA  305

Query  504  HSACDFGGGKAEKLSLAKYRQNILAGK  584
            HSACDFGGG+AEKL+LAKYRQ I  G+
Sbjct  306  HSACDFGGGRAEKLALAKYRQVIWQGR  332



>gb|KGN62755.1| hypothetical protein Csa_2G370540 [Cucumis sativus]
Length=1445

 Score =   300 bits (768),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 171/209 (82%), Gaps = 15/209 (7%)
 Frame = +3

Query  3     KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
             +ILNATL+IP+LE+N VW+DSSSF +IFDVDHFI+VL+DDISIVKELP E+SWSTREYY+
Sbjct  1056  RILNATLIIPHLEINAVWKDSSSFGEIFDVDHFIDVLRDDISIVKELPTEYSWSTREYYA  1115

Query  183   TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
             T IR TRIKTAP HASANWY ENVLP+++SYGIAAIAPFSHRL+F+++P +IQHLRCKVN
Sbjct  1116  TGIRSTRIKTAPTHASANWYLENVLPIMQSYGIAAIAPFSHRLSFNDLPTEIQHLRCKVN  1175

Query  363   FRALVFVPHIRALGDALIHRLRYPASKDEGPQ---------------KFVAVHLRFDKDM  497
             F AL FV  I  LGD +I+RLRY +++ E  +               KFV +HLRFDKDM
Sbjct  1176  FMALAFVRGITELGDTIINRLRYSSNQKETERVDSLLEDEKIQLKGGKFVVLHLRFDKDM  1235

Query  498   AAHSACDFGGGKAEKLSLAKYRQNILAGK  584
             AAHSAC+FGGGKAE+L+LAKYRQ I  G+
Sbjct  1236  AAHSACEFGGGKAERLALAKYRQVIWQGR  1264



>ref|XP_003578106.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=512

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 166/207 (80%), Gaps = 13/207 (6%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+L++NPVW+D+SSF +IFDVDHFI  LKD++SI+K  P E+ WSTREYY 
Sbjct  126  KILNATLVIPHLDINPVWKDTSSFEEIFDVDHFINTLKDEVSIIKIPPKEYLWSTREYYG  185

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP+HASA+WY ENV P+L+SYGIAAIAPF+HRLAFD++P DIQ LRCKVN
Sbjct  186  TGIRATRIKTAPLHASASWYLENVSPILQSYGIAAIAPFTHRLAFDDLPADIQRLRCKVN  245

Query  363  FRALVFVPHIRALGDALIHRLRYPA---SKDEGPQ----------KFVAVHLRFDKDMAA  503
            F+ALVF+PHI +LG+ L+ RLR P    S +   Q          K+  +HLRFDKDMAA
Sbjct  246  FQALVFLPHITSLGETLVKRLRSPVHGHSSEFARQVVEENTYQAGKYAVLHLRFDKDMAA  305

Query  504  HSACDFGGGKAEKLSLAKYRQNILAGK  584
            HSAC+FGGG+AEKL+LAKYRQ I  G+
Sbjct  306  HSACEFGGGRAEKLALAKYRQVIWQGR  332



>emb|CAN78778.1| hypothetical protein VITISV_029752 [Vitis vinifera]
Length=507

 Score =   285 bits (730),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 162/212 (76%), Gaps = 29/212 (14%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSSSF +IFD+DHFI            LP ++SWSTREYY+
Sbjct  127  KILNATLVIPHLEVNPVWQDSSSFAEIFDIDHFIN-----------LPSKYSWSTREYYA  175

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAP+HASA WY ENVLPVL+SYGIAA+APFSHRLAFDN+P  IQ LRCKVN
Sbjct  176  TGIRATRIKTAPIHASAIWYLENVLPVLQSYGIAALAPFSHRLAFDNLPAYIQXLRCKVN  235

Query  363  FRALVFVPHIRALGDALIHRLRY------------------PASKDEGPQKFVAVHLRFD  488
            F+ALVFVPHI+ALG+AL++ +RY                    +  +G  KFV +HLRFD
Sbjct  236  FKALVFVPHIKALGEALVNHIRYLPIESRAGGTEYLQDRTDEINHKQGAGKFVVLHLRFD  295

Query  489  KDMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            KDMAAHSACDFGGGKAEK++LAKYRQ I  G+
Sbjct  296  KDMAAHSACDFGGGKAEKMALAKYRQVIWQGR  327



>gb|EMT16885.1| hypothetical protein F775_06176 [Aegilops tauschii]
Length=511

 Score =   285 bits (729),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 161/207 (78%), Gaps = 13/207 (6%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVW+DSSSF DIF+VDHFI  LK ++SIV+  P E+SWS RE+Y 
Sbjct  125  KILNATLVIPHLEVNPVWKDSSSFGDIFNVDHFINTLKGEVSIVRSPPKEYSWSKREFYG  184

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASANWY ENV P+L+SYGIAAIAPFSHRLAFD++P DIQ LRCKVN
Sbjct  185  TGIRATRIKTAPVHASANWYIENVSPILQSYGIAAIAPFSHRLAFDDLPVDIQRLRCKVN  244

Query  363  FRALVFVPHIRALGDALIHRLRYPAS--KDEGPQKFV-----------AVHLRFDKDMAA  503
            F ALVFVP+I +LG  L  RLR P      E  Q+ V            +HLRFDKDMAA
Sbjct  245  FEALVFVPYITSLGRTLEKRLRSPVQGHSTEFAQQVVEENTDQDGNYAVLHLRFDKDMAA  304

Query  504  HSACDFGGGKAEKLSLAKYRQNILAGK  584
            HSACDFGGG+AEKL+LAKYRQ I  G+
Sbjct  305  HSACDFGGGRAEKLALAKYRQVIWQGR  331



>gb|KJB44062.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=308

 Score =   276 bits (707),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 148/180 (82%), Gaps = 17/180 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSSSFMDIFDVDHF+ VLKDDI I+K LPDEFSWSTREYY+
Sbjct  128  KILNATLVIPHLEVNPVWQDSSSFMDIFDVDHFMNVLKDDIPIIKVLPDEFSWSTREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIK APVHASANWY ENV PVL+S GIAAI+PFSHRL+FDN+P +IQ LRCKVN
Sbjct  188  TAIRGTRIKRAPVHASANWYLENVFPVLQSNGIAAISPFSHRLSFDNLPSEIQQLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEG-----------------PQKFVAVHLRFDK  491
            F+ALVFVPHIRALGDAL+HRLRYP  + +                  PQKFV +HLRFDK
Sbjct  248  FKALVFVPHIRALGDALVHRLRYPPGQSQASSTDYLRETTDQNGKQNPQKFVVLHLRFDK  307



>gb|KJB58883.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=489

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 160/194 (82%), Gaps = 12/194 (6%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSSSF DIFDVDHFI VL+D++SIVKELP E+SWS+REYY+
Sbjct  128  KILNATLVIPHLEVNPVWQDSSSFTDIFDVDHFINVLRDEVSIVKELPTEYSWSSREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA+WY ENVLPV++SYGIAAI+PFSHRLAFD +P +IQHLRCK  
Sbjct  188  TGIRATRIKTAPVHASADWYLENVLPVMQSYGIAAISPFSHRLAFDKLPVEIQHLRCK--  245

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
                     ++A G A++ R R   ++ E   KFV +HLRFDKDMAAHSACDFGGGKAEK
Sbjct  246  ---------LQASGTAVL-RERTDDTEKERAGKFVVLHLRFDKDMAAHSACDFGGGKAEK  295

Query  543  LSLAKYRQNILAGK  584
            L+LAKYRQ +  G+
Sbjct  296  LALAKYRQVLWQGR  309



>ref|XP_007047792.1| O-fucosyltransferase family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOX91949.1| O-fucosyltransferase family protein isoform 2, partial [Theobroma 
cacao]
Length=403

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 151/194 (78%), Gaps = 18/194 (9%)
 Frame = +3

Query  57   QDSSSFMDIF-DVDHFIEVLKDDISIVKELPDEFSWSTREYYSTAIRPTRIKTAPVHASA  233
            Q S  ++ +F D     + + DDISIVKELPDEFSWSTREYY+TAIR TRIK APVHASA
Sbjct  99   QKSEGYLQVFLDGGLNQQRMGDDISIVKELPDEFSWSTREYYATAIRATRIKRAPVHASA  158

Query  234  NWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVNFRALVFVPHIRALGDAL  413
            NWY ENVLPVL SYGIAAI+PFSHRL+FDN+P +IQ LRCKVNF+ALVFVPHIRALGDAL
Sbjct  159  NWYLENVLPVLESYGIAAISPFSHRLSFDNLPSEIQKLRCKVNFKALVFVPHIRALGDAL  218

Query  414  IHRLRYPASKDEG-----------------PQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            +HRLRYP  + E                  PQKFV VHLRFDKDMAAHSACDFGGGKAEK
Sbjct  219  VHRLRYPPGESEALSTNYLRETTGQNDKRRPQKFVVVHLRFDKDMAAHSACDFGGGKAEK  278

Query  543  LSLAKYRQNILAGK  584
            L+LAKYRQ I  G+
Sbjct  279  LALAKYRQTIWQGR  292



>ref|XP_002967262.1| hypothetical protein SELMODRAFT_87093 [Selaginella moellendorffii]
 gb|EFJ31861.1| hypothetical protein SELMODRAFT_87093 [Selaginella moellendorffii]
Length=476

 Score =   276 bits (707),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 155/194 (80%), Gaps = 1/194 (1%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+P+L+VNPVWQDSSSF DI+DVD+FI+ L  D+ IVK LP EF WSTREYY+
Sbjct  96   KILNATLVVPHLDVNPVWQDSSSFADIYDVDYFIDYLAADVKIVKGLPSEFYWSTREYYA  155

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T  R TR+K APVHA  +WY  NVLP+L+SYG+AAIAPFSHRLAFD +P +IQ LRCKVN
Sbjct  156  TGFRATRVKDAPVHARPSWYVANVLPILQSYGVAAIAPFSHRLAFDEVPPEIQKLRCKVN  215

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            F AL FV  I ++GD ++ RLR  A  D  P KFVA+HLRFDKDMAAHSACDFGGG+ E+
Sbjct  216  FHALRFVKAITSVGDVIVSRLR-QAQNDSPPSKFVALHLRFDKDMAAHSACDFGGGRVEQ  274

Query  543  LSLAKYRQNILAGK  584
            L+LA YR  +  G+
Sbjct  275  LALAYYRHKVWQGR  288



>ref|XP_002960458.1| hypothetical protein SELMODRAFT_75338 [Selaginella moellendorffii]
 gb|EFJ37997.1| hypothetical protein SELMODRAFT_75338 [Selaginella moellendorffii]
Length=464

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 154/194 (79%), Gaps = 1/194 (1%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+P+L+VNPVWQDSSSF DI+DVD+FI+ L  D+ IVK LP EF WSTREYY+
Sbjct  84   KILNATLVVPHLDVNPVWQDSSSFADIYDVDYFIDYLAADVKIVKGLPSEFYWSTREYYA  143

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T  R TR+K APVHA  +WY  NVLP+L+SYG+AAIAPFSHRLAF  +P +IQ LRCKVN
Sbjct  144  TGFRATRVKDAPVHARPSWYVANVLPILQSYGVAAIAPFSHRLAFGEVPPEIQKLRCKVN  203

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            F AL FV  I ++GD ++ RLR  A  D  P KFVA+HLRFDKDMAAHSACDFGGG+ E+
Sbjct  204  FHALRFVKAITSVGDVIVSRLR-QAQNDSPPSKFVALHLRFDKDMAAHSACDFGGGRVEQ  262

Query  543  LSLAKYRQNILAGK  584
            L+LA YR  +  G+
Sbjct  263  LALAYYRHKVWQGR  276



>gb|EMS64135.1| hypothetical protein TRIUR3_23110 [Triticum urartu]
Length=493

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 160/222 (72%), Gaps = 28/222 (13%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVW+DSS F DIF+VDHFI  LK ++SIV+  P EF+WSTRE+Y 
Sbjct  92   KILNATLVIPHLEVNPVWKDSSLFGDIFNVDHFINTLKGEVSIVRIPPKEFAWSTREFYG  151

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TR+KTAPVHASANWY ENV P+L+SYGIAAIAPFSHRLAFD++P DIQ LRCKVN
Sbjct  152  TGIRATRVKTAPVHASANWYIENVSPILQSYGIAAIAPFSHRLAFDDLPVDIQRLRCKVN  211

Query  363  FRALVFVPHIRALGDALIHRLRYPAS-------------KDEGPQKFVAVHLRFDK----  491
            F AL+FVP+I +LG  L  RLR P                 +   K+  +HLRFDK    
Sbjct  212  FEALIFVPYIISLGRTLEKRLRSPVQGHSTEFAQQVVEENTDQDGKYAVLHLRFDKGIAT  271

Query  492  -----------DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
                       DMAAHSACDFGGG+AEKL+LAKYRQ I  G+
Sbjct  272  LKHLKLTYIFQDMAAHSACDFGGGRAEKLALAKYRQVIWQGR  313



>gb|KDO81174.1| hypothetical protein CISIN_1g020969mg [Citrus sinensis]
Length=319

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 145/180 (81%), Gaps = 17/180 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+P+LEVNPVW+DSSSF DIFDVDHFI  L+D+ISIVKELP E+SWS+REYY+
Sbjct  127  KILNATLVLPHLEVNPVWRDSSSFADIFDVDHFISSLRDEISIVKELPSEYSWSSREYYA  186

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASANWY ENVLP+L+SYGIAAIAPFSHRLAFDN+P +IQHLRCKVN
Sbjct  187  TGIRDTRIKTAPVHASANWYLENVLPILQSYGIAAIAPFSHRLAFDNLPTNIQHLRCKVN  246

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDE-----------------GPQKFVAVHLRFDK  491
            F+ALVFVPHIR LG+ ++H LR+P  K +                 G  KF  +HLRFDK
Sbjct  247  FQALVFVPHIRKLGETIVHLLRHPPGKLQASGTEFHKGRIGDSEVTGAGKFTVLHLRFDK  306



>ref|XP_001777077.1| predicted protein [Physcomitrella patens]
 gb|EDQ58070.1| predicted protein, partial [Physcomitrella patens]
Length=437

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 158/208 (76%), Gaps = 9/208 (4%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLV+P+ +VNPVW+DSSSF DIF+VDHF+  L  +++IV +LP EF WSTREYY+
Sbjct  38   KILNATLVLPHFDVNPVWKDSSSFADIFNVDHFLNTLGFEVNIVTKLPPEFEWSTREYYA  97

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSY--GIAAIAPFSHRLAFDNMPKDIQHLRCK  356
            T  R TR+K APV AS  WY  NVLP+LR Y  G+ AIAPFSHRLAF+++P +IQ LRCK
Sbjct  98   TGYRATRVKNAPVQASPEWYITNVLPLLRRYGSGVVAIAPFSHRLAFNDLPDEIQRLRCK  157

Query  357  VNFRALVFVPHIRALGDALIHRLRYP-----ASKDEGPQKFVAVHLRFDKDMAAHSACDF  521
            VNF AL FVP I  +G+ L+ RLR          D G  K++A+HLRFDKDMAAHSACDF
Sbjct  158  VNFEALRFVPSIDNIGNILVERLRKSHAWTVEGDDVGSSKYLALHLRFDKDMAAHSACDF  217

Query  522  GGGKAEKLSLAKYRQNILAGK--SAELS  599
            GGGKAE+L+LAKYR  +  G+  +A+LS
Sbjct  218  GGGKAERLALAKYRGVVWQGRVSNAQLS  245



>ref|XP_011016934.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Populus 
euphratica]
Length=495

 Score =   261 bits (668),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 150/211 (71%), Gaps = 35/211 (17%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVN VWQD+  F                  ++KE P E+ WSTREYY+
Sbjct  123  KILNATLVIPHLEVNAVWQDTRYF------------------VIKEPPSEYWWSTREYYA  164

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR  RIKTAPVH SA+WY ENVLPVL+SYGIAAIAPFSHRLAFD +P DIQ LRCKVN
Sbjct  165  TGIRAMRIKTAPVHGSADWYLENVLPVLQSYGIAAIAPFSHRLAFDKLPPDIQRLRCKVN  224

Query  363  FRALVFVPHIRALGDALIHRLRYPASK-----------------DEGPQKFVAVHLRFDK  491
            F AL+FVPHIR LGD L++RLR+P  K                  EG  KFV +HLRFDK
Sbjct  225  FHALIFVPHIRVLGDTLVNRLRHPFEKFHTSGTGFLKERMNDTESEGSGKFVVLHLRFDK  284

Query  492  DMAAHSACDFGGGKAEKLSLAKYRQNILAGK  584
            DMAAHS+CDFGGGKAE+L+LAKYRQ +  G+
Sbjct  285  DMAAHSSCDFGGGKAERLALAKYRQVLWQGR  315



>gb|KJB58884.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=330

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 144/183 (79%), Gaps = 17/183 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVWQDSSSF DIFDVDHFI VL+D++SIVKELP E+SWS+REYY+
Sbjct  128  KILNATLVIPHLEVNPVWQDSSSFTDIFDVDHFINVLRDEVSIVKELPTEYSWSSREYYA  187

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA+WY ENVLPV++SYGIAAI+PFSHRLAFD +P +IQHLRCKVN
Sbjct  188  TGIRATRIKTAPVHASADWYLENVLPVMQSYGIAAISPFSHRLAFDKLPVEIQHLRCKVN  247

Query  363  FRALVFVPHIRALGDALIHRLRYPASK-----------------DEGPQKFVAVHLRFDK  491
            F AL FVP IR +G+ L++RLR P+ K                  E   KFV +HLRFDK
Sbjct  248  FEALAFVPRIRLIGETLVNRLRDPSGKLQASGTAVLRERTDDTEKERAGKFVVLHLRFDK  307

Query  492  DMA  500
             + 
Sbjct  308  TLC  310



>gb|EEC84568.1| hypothetical protein OsI_31345 [Oryza sativa Indica Group]
Length=519

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 151/194 (78%), Gaps = 16/194 (8%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVW+D+SSF +IFDVDHFI  LK ++SIVK LP EFSWSTREYY 
Sbjct  127  KILNATLVIPHLEVNPVWKDTSSFEEIFDVDHFINTLKAEVSIVKVLPKEFSWSTREYYG  186

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T IR TRIKTAPVHASA+WY ENV P+L+SYGIAAIAPFSHRLAFD++P DIQHLRCK  
Sbjct  187  TGIRATRIKTAPVHASASWYLENVSPILQSYGIAAIAPFSHRLAFDDLPVDIQHLRCKGQ  246

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
               L     I+ +G+          +   G  K+  +HLRFDKDMAAHSACDFGGG+AE+
Sbjct  247  SGEL-----IQEVGE---------DTNQAG--KYAVLHLRFDKDMAAHSACDFGGGRAER  290

Query  543  LSLAKYRQNILAGK  584
            L+LAKYRQ I  G+
Sbjct  291  LALAKYRQVIWQGR  304



>gb|AAX20003.1| unknown protein [Iris tectorum]
Length=251

 Score =   218 bits (555),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATLVIP+LEVNPVW+D+SSF ++FDV+HFI++LK DISIV++LP E+SWSTREYY+
Sbjct  123  KILNATLVIPHLEVNPVWKDTSSFDEVFDVEHFIQILKYDISIVRDLPSEYSWSTREYYA  182

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            TAIR TRIKTAPVHASANWY ENV+PVL+SYGIAAIAPFSHRLAFDNM KDIQ LRCKVN
Sbjct  183  TAIRATRIKTAPVHASANWYLENVVPVLQSYGIAAIAPFSHRLAFDNMTKDIQRLRCKVN  242

Query  363  FRAL  374
            F+A+
Sbjct  243  FQAI  246



>ref|XP_002987806.1| hypothetical protein SELMODRAFT_126689, partial [Selaginella 
moellendorffii]
 gb|EFJ11109.1| hypothetical protein SELMODRAFT_126689, partial [Selaginella 
moellendorffii]
Length=399

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 131/203 (65%), Gaps = 9/203 (4%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            ++LNATLVIPY + +P W D S F DI+D++HF+  LK D+ IV ELP  +SWST  +Y 
Sbjct  9    RLLNATLVIPYFKHHPFWNDPSQFEDIYDLNHFMSTLKGDVKIVTELPAMYSWSTPSFYW  68

Query  183  TAI--RPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCK  356
                 RP  +   P H +  W+ +++LP++  Y +AA+  F H+L F+ +P  I  LRCK
Sbjct  69   GRCLDRPNCMTFLPKHTTPKWFFQHILPIMERYEVAAVDGFEHKLTFEGLPASISKLRCK  128

Query  357  VNFRALVFVPHIRALGDALIHRLRYPA-------SKDEGPQKFVAVHLRFDKDMAAHSAC  515
            VNF AL FV  IR LGDAL  R+R          +++   +K++ +H+RF++DM A+S+C
Sbjct  129  VNFYALRFVKPIRDLGDALTLRMRTKTLSGDPLRNQENSTKKYIGLHVRFERDMLAYSSC  188

Query  516  DFGGGKAEKLSLAKYRQNILAGK  584
            DFGGG+AE+ +LA +R  + + +
Sbjct  189  DFGGGQAEQKALASFRYQVWSNR  211



>ref|XP_002990403.1| hypothetical protein SELMODRAFT_131659, partial [Selaginella 
moellendorffii]
 gb|EFJ08496.1| hypothetical protein SELMODRAFT_131659, partial [Selaginella 
moellendorffii]
Length=399

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 131/203 (65%), Gaps = 9/203 (4%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            ++LNATLVIPY + +P W D S F DI+D++HF+  LK D+ +V ELP  +SWST  +Y 
Sbjct  9    RLLNATLVIPYFKHHPFWNDPSQFEDIYDLNHFMSTLKGDVKVVTELPAMYSWSTPSFYW  68

Query  183  TAI--RPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCK  356
                 RP  +   P H +  W+ +++LP++  Y +AA+  F H+L F+ +P  I  LRCK
Sbjct  69   GRCLDRPNCMTFLPKHTTPKWFFQHILPIMERYEVAAVDGFEHKLTFEGLPASISKLRCK  128

Query  357  VNFRALVFVPHIRALGDALIHRLRYPA-------SKDEGPQKFVAVHLRFDKDMAAHSAC  515
            VNF AL FV  IR LGDAL  R+R          +++   +K++ +H+RF++DM A+S+C
Sbjct  129  VNFYALRFVKPIRDLGDALTLRMRTKTLSGDPLRNQENSTKKYIGLHVRFERDMLAYSSC  188

Query  516  DFGGGKAEKLSLAKYRQNILAGK  584
            DFGGG+AE+ +LA +R  + + +
Sbjct  189  DFGGGQAEQKALASFRYQVWSNR  211



>ref|XP_006290838.1| hypothetical protein CARUB_v10016949mg [Capsella rubella]
 gb|EOA23736.1| hypothetical protein CARUB_v10016949mg [Capsella rubella]
Length=557

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 132/188 (70%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D++ F DIFDVDHFI+ LKDD+ IV+++PD F+    E +S
Sbjct  185  KIMNATLILPVLKQDQIWKDTTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFT-DKAELFS  243

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +ASA +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  244  S-IRRT-VKNIPKYASAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  301

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D+L+ R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  302  YHALKFLPEIEQMADSLVSRMR---NRTGNPNPYMALHLRFEKGMVGLSFCDFVGTREEK  358

Query  543  LSLAKYRQ  566
            + +A+YRQ
Sbjct  359  VKMAEYRQ  366



>ref|XP_010425341.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=559

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 132/188 (70%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATL++P L+ + +W+D++ F DIFDVDHFI+ LKDD+ IV+++PD F+    E +S
Sbjct  187  KILNATLILPVLKQDQIWKDTTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFT-DKAELFS  245

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A+A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  246  S-IRRT-VKNIPKYAAAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  303

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D+L+ R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  304  YHALKFLPEIEQMADSLVSRMR---NRTGNPNPYMALHLRFEKGMVGLSFCDFVGTREEK  360

Query  543  LSLAKYRQ  566
            + +A+YRQ
Sbjct  361  VKMAEYRQ  368



>gb|AAT08765.1| auxin-independent growth protein [Hyacinthus orientalis]
Length=211

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 124/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D ++  DIFDVDHFIE LKDD+ IV+++PD F+     +  
Sbjct  12   KIMNATLILPVLKQDQIWKDKTNLEDIFDVDHFIEYLKDDVRIVRDIPDWFTDKAELF--  69

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  70   TSIRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPPEINRLRCRVN  128

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + + L  R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  129  YHALKFLPEIDEMANLLASRMR---NRTGNPNPYMALHLRFEKGMVGLSFCDFVGTREEK  185

Query  543  LSLAKYRQ  566
              +A YRQ
Sbjct  186  AMMAAYRQ  193



>ref|XP_002875314.1| hypothetical protein ARALYDRAFT_484400 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51573.1| hypothetical protein ARALYDRAFT_484400 [Arabidopsis lyrata subsp. 
lyrata]
Length=556

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 132/188 (70%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D++ F DIFDVDHFI+ LKDD+ IV+++PD F+    E +S
Sbjct  184  KIMNATLILPVLKQDQIWKDTTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFT-DKAELFS  242

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A+A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  243  S-IRRT-VKNIPKYAAAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  300

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D+L+ R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  301  YHALKFLPEIEQMADSLVSRMR---NRTGNPNPYMALHLRFEKGMVGLSFCDFVGTREEK  357

Query  543  LSLAKYRQ  566
            + +A+YRQ
Sbjct  358  VKMAEYRQ  365



>ref|NP_566791.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 dbj|BAB02197.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAE98825.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77150.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=557

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 132/188 (70%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D++ F DIFDVDHFI+ LKDD+ IV+++PD F+    E +S
Sbjct  185  KIMNATLILPVLKQDQIWKDTTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFT-DKAELFS  243

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A+A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  244  S-IRRT-VKNIPKYAAAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  301

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D+L+ R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  302  YHALKFLPEIEQMADSLVSRMR---NRTGNPNPYMALHLRFEKGMVGLSFCDFVGTREEK  358

Query  543  LSLAKYRQ  566
            + +A+YRQ
Sbjct  359  VKMAEYRQ  366



>ref|XP_010506989.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=627

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 132/188 (70%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D++ F DIFDVDHFI+ LKDD+ IV+++PD F+    E +S
Sbjct  255  KIMNATLILPVLKQDQIWKDTTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFT-DKAELFS  313

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A+A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  314  S-IRRT-VKNIPKYAAAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  371

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D+L+ R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  372  YHALKFLPEIEQMADSLVSRMR---NRTGNPNPYMALHLRFEKGMVGLSFCDFVGTREEK  428

Query  543  LSLAKYRQ  566
            + +A+YRQ
Sbjct  429  VRMAEYRQ  436



>ref|XP_010502552.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
 ref|XP_010502553.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=559

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 132/188 (70%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D++ F DIFDVDHFI+ LKDD+ IV+++PD F+    E +S
Sbjct  187  KIMNATLILPVLKQDQIWKDTTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFT-DKAELFS  245

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A+A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  246  S-IRRT-VKNIPKYAAAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  303

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D+L+ R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  304  YHALKFLPEIEQMADSLVSRMR---NRTGNPNPYMALHLRFEKGMVGLSFCDFVGTREEK  360

Query  543  LSLAKYRQ  566
            + +A+YRQ
Sbjct  361  VRMAEYRQ  368



>ref|XP_010514284.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=559

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 132/188 (70%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D++ F DIFDVDHFI+ LKDD+ IV+++PD F+    E +S
Sbjct  187  KIMNATLILPVLKQDQIWKDTTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFT-DKAELFS  245

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A+A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  246  S-IRRT-VKNIPKYAAAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  303

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D+L+ R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  304  YHALKFLPEIEQMADSLVSRMR---NRTGNPNPYMALHLRFEKGMVGLSFCDFVGTREEK  360

Query  543  LSLAKYRQ  566
            + +A+YRQ
Sbjct  361  VRMAEYRQ  368



>ref|XP_009121525.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Brassica rapa]
Length=538

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 129/188 (69%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IVK++PD F+  T  +  
Sbjct  166  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVKDIPDWFTDKTELF--  223

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            ++IR T +K  P +A+A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  224  SSIRRT-VKNIPKYAAAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  282

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D++  R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  283  YHALKFLPEIEQMADSIASRMR---NRTGTPNPYMALHLRFEKGMVGLSFCDFVGTREEK  339

Query  543  LSLAKYRQ  566
              +A+YRQ
Sbjct  340  ARMAEYRQ  347



>ref|XP_009121532.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Brassica rapa]
Length=533

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 129/188 (69%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IVK++PD F+  T  +  
Sbjct  161  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVKDIPDWFTDKTELF--  218

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            ++IR T +K  P +A+A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  219  SSIRRT-VKNIPKYAAAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  277

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D++  R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  278  YHALKFLPEIEQMADSIASRMR---NRTGTPNPYMALHLRFEKGMVGLSFCDFVGTREEK  334

Query  543  LSLAKYRQ  566
              +A+YRQ
Sbjct  335  ARMAEYRQ  342



>emb|CDY56370.1| BnaAnng14230D [Brassica napus]
Length=531

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 129/188 (69%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IVK++PD F+  T  +  
Sbjct  159  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVKDIPDWFTDKTELF--  216

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            ++IR T +K  P +A+A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  217  SSIRRT-VKNIPKYAAAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  275

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D++  R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  276  YHALKFLPEIEQMADSIASRMR---NRTGTPNPYMALHLRFEKGMVGLSFCDFVGTREEK  332

Query  543  LSLAKYRQ  566
              +A+YRQ
Sbjct  333  ARMAEYRQ  340



>emb|CDY22004.1| BnaC09g01100D [Brassica napus]
Length=533

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 129/188 (69%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IVK++PD F+  T  +  
Sbjct  161  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVKDIPDWFTDKTELF--  218

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            ++IR T +K  P +A+A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  219  SSIRRT-VKNIPKYAAAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  277

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D++  R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  278  YHALKFLPEIEQMADSIASRMR---NRTGTPNPYMALHLRFEKGMVGLSFCDFVGTREEK  334

Query  543  LSLAKYRQ  566
              +A+YRQ
Sbjct  335  ARMAEYRQ  342



>emb|CDX83614.1| BnaC07g23540D [Brassica napus]
Length=554

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 130/188 (69%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++PD F+    E +S
Sbjct  182  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFT-DKAELFS  240

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A+A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  241  S-IRRT-VKNIPKYAAAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  298

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D+L+ R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  299  YHALKFLPEIEQMADSLVSRMR---NRTGNPNPYMALHLRFEKGMVGLSFCDFVGTREEK  355

Query  543  LSLAKYRQ  566
              +A+YRQ
Sbjct  356  ARMAEYRQ  363



>ref|XP_009152062.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=554

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 130/188 (69%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++PD F+    E +S
Sbjct  182  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFT-DKAELFS  240

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A+A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  241  S-IRRT-VKNIPKYAAAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  298

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D+L+ R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  299  YHALKFLPEIEQMADSLVSRMR---NRTGNPNPYMALHLRFEKGMVGLSFCDFVGTREEK  355

Query  543  LSLAKYRQ  566
              +A+YRQ
Sbjct  356  ARMAEYRQ  363



>emb|CDY13629.1| BnaA06g32940D [Brassica napus]
Length=554

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 130/188 (69%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++PD F+    E +S
Sbjct  182  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFT-DKAELFS  240

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A+A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  241  S-IRRT-VKNIPKYAAAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  298

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D+L+ R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  299  YHALKFLPEIEQMADSLVSRMR---NRTGNPNPYMALHLRFEKGMVGLSFCDFVGTREEK  355

Query  543  LSLAKYRQ  566
              +A+YRQ
Sbjct  356  ARMAEYRQ  363



>ref|XP_008390090.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=401

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 126/187 (67%), Gaps = 6/187 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++P+ F+  T  +  
Sbjct  29   KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPEWFTDKTELF--  86

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  87   TSIRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  145

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++  G   ++A+HLRF+K M   S CDF G + EK
Sbjct  146  YHALKFLPEIEEMADLLASRMR---NRTGGSNPYMALHLRFEKGMVGLSFCDFVGTREEK  202

Query  543  LSLAKYR  563
              +AKYR
Sbjct  203  ALMAKYR  209



>ref|XP_006395561.1| hypothetical protein EUTSA_v10003920mg [Eutrema salsugineum]
 gb|ESQ32847.1| hypothetical protein EUTSA_v10003920mg [Eutrema salsugineum]
Length=563

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 130/188 (69%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++PD F+    E +S
Sbjct  191  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFT-DKAELFS  249

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A+A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  250  S-IRRT-VKNIPKYAAAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  307

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D+L+ R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  308  YHALKFLPEIEQMADSLVARMR---NRTGNPNPYMALHLRFEKGMVGLSFCDFVGTREEK  364

Query  543  LSLAKYRQ  566
              +A+YRQ
Sbjct  365  ARMAEYRQ  372



>gb|KFK33567.1| hypothetical protein AALP_AA5G030400 [Arabis alpina]
Length=552

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 129/188 (69%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++PD F+    E +S
Sbjct  180  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFT-DKAELFS  238

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A+A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  239  S-IRRT-VKNIPKYAAAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  296

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D+L+ R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  297  YHALKFLPEIEQMADSLVSRMR---NRTGNPNPYMALHLRFEKGMVGLSFCDFVGTREEK  353

Query  543  LSLAKYRQ  566
              +A YRQ
Sbjct  354  AKMAVYRQ  361



>ref|XP_001765982.1| predicted protein [Physcomitrella patens]
 gb|EDQ69303.1| predicted protein, partial [Physcomitrella patens]
Length=451

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 131/212 (62%), Gaps = 19/212 (9%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            K++NATL+IPY   + VW+D S F DI+D DHFI   + D+ IV++LP+E++WS  + Y+
Sbjct  52   KLVNATLLIPYFRKSLVWKDPSQFGDIYDTDHFIAYFEKDLRIVRQLPEEYAWSVPDLYA  111

Query  183  TAI--RPTRIKTAPVHASANWYSENVLPVLRSYGIAAI------APFSHRLAFDNMPKDI  338
                 RP  +     H++ NWY E V P+L+++G+A +      + + H+L F+ +P  I
Sbjct  112  ERCLERPNCLTYVRKHSTMNWYLEKVPPLLQTHGVAVLDGPTQYSGWDHKLTFEGLPVHI  171

Query  339  QHLRCKVNFRALVFVPHIRALGDALIHRLRYPA---------SKDEGPQ--KFVAVHLRF  485
              LRC+ NF  L FVP I+  G  L++R+R  +         S + G Q  +++ +H+RF
Sbjct  172  TQLRCRANFEGLQFVPAIQEFGKLLVNRIRAKSLAVQSSEMLSGNSGDQVHRYLGLHVRF  231

Query  486  DKDMAAHSACDFGGGKAEKLSLAKYRQNILAG  581
            +KDM AHSAC +GGG+AEK +LA +R  I  G
Sbjct  232  EKDMIAHSACYYGGGRAEKRALAAFRAKIWRG  263



>gb|AFW75945.1| hypothetical protein ZEAMMB73_097274 [Zea mays]
Length=208

 Score =   166 bits (421),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 122/187 (65%), Gaps = 6/187 (3%)
 Frame = +3

Query  9    LNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYSTA  188
            +NATL++P L+ + +W+D + F DIFDVDHFI  LK+D+ IV+++PD F+   ++   T+
Sbjct  1    MNATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKEDVHIVRDIPDWFT--EKDDLFTS  58

Query  189  IRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVNFR  368
            I+ T +K  P +ASA +Y +NVLP ++   I +I PF  RL +DN+P +I  LRC+VN+ 
Sbjct  59   IKRT-VKNVPKYASAQFYIDNVLPRIKEKKIMSIKPFVDRLGYDNVPMEINRLRCRVNYH  117

Query  369  ALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  548
            AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK  
Sbjct  118  ALKFLPDIEEMADKLATRMR---NRTGSLNPYMALHLRFEKGMVGLSFCDFAGTREEKAM  174

Query  549  LAKYRQN  569
            +A YRQ 
Sbjct  175  MATYRQQ  181



>gb|KJB50269.1| hypothetical protein B456_008G161400 [Gossypium raimondii]
Length=502

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 126/188 (67%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI  LKDD+ IV+++P+ F+  +  +  
Sbjct  182  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKDDVRIVRDIPEWFTDKSELF--  239

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +A A +Y +NVLP ++   I ++ PF  RL +DN+P +I  LRC+VN
Sbjct  240  TSIRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMSLKPFVDRLGYDNVPPEINRLRCRVN  298

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L+ R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  299  YHALKFLPEIEQMSDLLVSRMR---NRTGSPNPYMALHLRFEKGMVGLSFCDFVGTREEK  355

Query  543  LSLAKYRQ  566
              +A+YRQ
Sbjct  356  ARMAEYRQ  363



>gb|EPS71835.1| hypothetical protein M569_02912, partial [Genlisea aurea]
Length=561

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 128/187 (68%), Gaps = 4/187 (2%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IVK++P+ F+ S+  +  
Sbjct  188  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVKDIPEWFTDSSELF--  245

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+I+ T +K  P +A A +Y +NVLP ++   + ++ PF  RL +DN+P++I  LRC+VN
Sbjct  246  TSIKRT-VKNIPKYAPAQFYIDNVLPRIKEKRVMSLKPFVDRLGYDNVPQEINKLRCRVN  304

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+PHI ++ + L+ R+R   +    P  F+A+HLRF+K M   S CDF G + EK
Sbjct  305  YHALKFLPHIESMANLLVSRMRN-QTGSSNPNPFMALHLRFEKGMVGLSFCDFVGTRVEK  363

Query  543  LSLAKYR  563
              +A YR
Sbjct  364  ALMAIYR  370



>gb|EMS46071.1| hypothetical protein TRIUR3_08015 [Triticum urartu]
Length=420

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 123/188 (65%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI  LKDD+ IV+++PD F  + ++   
Sbjct  47   KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKDDVRIVRDIPDWF--TEKDELF  104

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +A A +Y +NVLP ++   I +I PF  RL +DN+P  I  LRC+VN
Sbjct  105  TSIRRT-VKNIPKYAPAQFYVDNVLPRIKEKKIMSIKPFVDRLGYDNVPMKINRLRCRVN  163

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  164  YHALKFLPGIEEMADKLATRMR---NRTGSVNPYMALHLRFEKGMVGLSFCDFAGTREEK  220

Query  543  LSLAKYRQ  566
              +A+YRQ
Sbjct  221  AMMAEYRQ  228



>gb|KHG25699.1| hypothetical protein F383_04430 [Gossypium arboreum]
Length=554

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 126/188 (67%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI  LKDD+ IV+++P+ F+  +  +  
Sbjct  182  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKDDVRIVRDIPEWFTDKSELF--  239

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +A A +Y +NVLP ++   I ++ PF  RL +DN+P +I  LRC+VN
Sbjct  240  TSIRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMSLKPFVDRLGYDNVPPEINRLRCRVN  298

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L+ R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  299  YHALKFLPEIEQMSDLLVSRMR---NRTGSPNPYMALHLRFEKGMVGLSFCDFVGTREEK  355

Query  543  LSLAKYRQ  566
              +A+YRQ
Sbjct  356  ARMAEYRQ  363



>gb|KJB50270.1| hypothetical protein B456_008G161400 [Gossypium raimondii]
Length=558

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 126/188 (67%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI  LKDD+ IV+++P+ F+  +  +  
Sbjct  182  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKDDVRIVRDIPEWFTDKSELF--  239

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +A A +Y +NVLP ++   I ++ PF  RL +DN+P +I  LRC+VN
Sbjct  240  TSIRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMSLKPFVDRLGYDNVPPEINRLRCRVN  298

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L+ R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  299  YHALKFLPEIEQMSDLLVSRMR---NRTGSPNPYMALHLRFEKGMVGLSFCDFVGTREEK  355

Query  543  LSLAKYRQ  566
              +A+YRQ
Sbjct  356  ARMAEYRQ  363



>ref|XP_008799030.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008799031.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008799032.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Phoenix 
dactylifera]
Length=563

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 124/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFIE LKDD+ IV+++PD F+     +  
Sbjct  191  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIEYLKDDVRIVRDIPDWFTEKAELF--  248

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +ASA +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  249  TSIRRT-VKNIPKYASAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPPEINRLRCRVN  307

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  308  YHALKFLPEIEEMADKLAARMR---NRTGSLNPYMALHLRFEKGMVGLSFCDFVGTREEK  364

Query  543  LSLAKYRQ  566
              +A YRQ
Sbjct  365  AMMASYRQ  372



>ref|XP_007044839.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 ref|XP_007044840.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY00671.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY00672.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
Length=596

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 127/188 (68%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++P+ F+  +  +  
Sbjct  224  KIINATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPEWFTDKSELF--  281

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  282  TSIRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPPEINRLRCRVN  340

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L+ R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  341  YHALKFLPEIEEMADLLVSRMR---NRTGSPNPYMALHLRFEKGMVGLSFCDFVGTREEK  397

Query  543  LSLAKYRQ  566
              +A+YR+
Sbjct  398  ARMAEYRK  405



>gb|KJB78030.1| hypothetical protein B456_012G173200 [Gossypium raimondii]
Length=556

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 126/188 (67%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++P  F+  +  +  
Sbjct  184  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPGWFTDKSELF--  241

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  242  TSIRRT-VKNIPKYAPAQFYIDNVLPRVKEKKIMALKPFVDRLGYDNVPPEINRLRCRVN  300

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + + L+ R+R   ++   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  301  YHALKFLPQIEQMANLLVSRMR---NRTGSPNPYMALHLRFEKGMVGLSFCDFVGTREEK  357

Query  543  LSLAKYRQ  566
              +A+YRQ
Sbjct  358  AKMAEYRQ  365



>ref|XP_010682284.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=556

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 127/188 (68%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ I++++P+ F+  +  +  
Sbjct  184  KILNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVPIIRDIPEWFTDKSELF--  241

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +ASA +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  242  TSIRRT-VKNIPKYASAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPREINRLRCRVN  300

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  301  YHALKFLPEIEQMADQLASRMR---NRTANSNPYMALHLRFEKGMVGLSFCDFVGTREEK  357

Query  543  LSLAKYRQ  566
              +A+YR+
Sbjct  358  AKMAEYRK  365



>ref|XP_004135279.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004167367.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 gb|KGN51743.1| hypothetical protein Csa_5G598020 [Cucumis sativus]
Length=552

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATL++P L+ + +W+D + F DIFDVDHFI  LK+D+ +V+++PD F+  T  +  
Sbjct  180  KILNATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKNDVRVVRDIPDWFTDKTELF--  237

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  238  TSIRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPSEINRLRCRVN  296

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   S+      ++A+HLRF+K M   S CDF G + EK
Sbjct  297  YHALKFLPDIEHMADVLASRMR---SRTNSSNPYMALHLRFEKGMVGLSFCDFVGTREEK  353

Query  543  LSLAKYRQ  566
            + +A+YR+
Sbjct  354  VKMAEYRK  361



>gb|AFW75944.1| auxin-independent growth promoter-like protein, mRNA [Zea mays]
Length=391

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI  LK+D+ IV+++PD F+   ++   
Sbjct  182  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKEDVHIVRDIPDWFT--EKDDLF  239

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+I+ T +K  P +ASA +Y +NVLP ++   I +I PF  RL +DN+P +I  LRC+VN
Sbjct  240  TSIKRT-VKNVPKYASAQFYIDNVLPRIKEKKIMSIKPFVDRLGYDNVPMEINRLRCRVN  298

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  299  YHALKFLPDIEEMADKLATRMR---NRTGSLNPYMALHLRFEKGMVGLSFCDFAGTREEK  355

Query  543  LSLAKYRQN  569
              +A YRQ 
Sbjct  356  AMMATYRQQ  364



>ref|XP_009759798.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana sylvestris]
Length=564

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 127/188 (68%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI  LKDD+ IV+++P+ F+  +  +  
Sbjct  192  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKDDVRIVRDIPEWFTDKSELF--  249

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +ASA++Y +NVLP ++   I ++ PF  RL +DN+P +I  LRC+VN
Sbjct  250  TSIRRT-VKNIPKYASADFYIDNVLPRIKEKKIMSLKPFVDRLGYDNVPPEINRLRCRVN  308

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L+ R+R   ++      F+A+HLRF+K M   S CDF G ++EK
Sbjct  309  YHALKFLPEIEQMADQLVSRMR---NRTGSSNPFMALHLRFEKGMVGLSFCDFVGTRSEK  365

Query  543  LSLAKYRQ  566
              +A YR+
Sbjct  366  ALMAAYRK  373



>ref|XP_010248690.1| PREDICTED: uncharacterized protein At1g04910 [Nelumbo nucifera]
Length=553

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++PD F   +  +  
Sbjct  181  KIMNATLILPLLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFPDKSELF--  238

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +ASA +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  239  TSIRRT-VKNIPKYASAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPPEINRLRCRVN  297

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  298  YHALKFLPEIEQMADQLASRMR---NRTGSSNPYMALHLRFEKGMVGLSFCDFVGTREEK  354

Query  543  LSLAKYRQ  566
              +A+YR+
Sbjct  355  ARMAEYRK  362



>ref|XP_002969133.1| hypothetical protein SELMODRAFT_90475, partial [Selaginella moellendorffii]
 gb|EFJ30249.1| hypothetical protein SELMODRAFT_90475, partial [Selaginella moellendorffii]
Length=458

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 124/190 (65%), Gaps = 10/190 (5%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSW--STREY  176
            +I+N TL+IP ++ + +W+D + F D+FDVDHFIE LKDD+ IVK++P   SW     + 
Sbjct  86   RIMNVTLIIPLMKQDQIWKDKTRFEDVFDVDHFIESLKDDVRIVKDIP---SWLPDKGDL  142

Query  177  YSTAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCK  356
            Y++  R   +K  P +ASA WY +NVLP ++   + A+ PF  RL +DN+P +I  LRC+
Sbjct  143  YTSLKR--TVKNIPKYASAQWYLDNVLPRIKEKRVMALKPFVDRLGYDNVPAEINKLRCR  200

Query  357  VNFRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKA  536
            VN+ AL F+PHI  + D L+ R+R   ++    + ++A+HLRF+K M   S CDF G + 
Sbjct  201  VNYHALKFLPHIEEMADVLVSRMR---NRTGLLKPYMALHLRFEKGMVGLSFCDFVGNRE  257

Query  537  EKLSLAKYRQ  566
            EK  +A YR+
Sbjct  258  EKAMMAAYRK  267



>ref|XP_002973931.1| hypothetical protein SELMODRAFT_100522, partial [Selaginella 
moellendorffii]
 gb|EFJ24886.1| hypothetical protein SELMODRAFT_100522, partial [Selaginella 
moellendorffii]
Length=458

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 124/190 (65%), Gaps = 10/190 (5%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSW--STREY  176
            +I+N TL+IP ++ + +W+D + F D+FDVDHFIE LKDD+ IVK++P   SW     + 
Sbjct  86   RIMNVTLIIPLMKQDQIWKDKTRFEDVFDVDHFIESLKDDVRIVKDIP---SWLPDKGDL  142

Query  177  YSTAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCK  356
            Y++  R   +K  P +ASA WY +NVLP ++   + A+ PF  RL +DN+P +I  LRC+
Sbjct  143  YTSLKR--TVKNIPKYASAQWYLDNVLPRIKEKRVMALKPFVDRLGYDNVPAEINKLRCR  200

Query  357  VNFRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKA  536
            VN+ AL F+PHI  + D L+ R+R   ++    + ++A+HLRF+K M   S CDF G + 
Sbjct  201  VNYHALKFLPHIEEMADVLVSRMR---NRTGLLKPYMALHLRFEKGMVGLSFCDFVGNRE  257

Query  537  EKLSLAKYRQ  566
            EK  +A YR+
Sbjct  258  EKAMMAAYRK  267



>ref|XP_008446146.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis melo]
Length=552

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATL++P L+ + +W+D + F DIFDVDHFI  LK+D+ +V+++PD F+  +  +  
Sbjct  180  KILNATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKNDVRVVRDIPDWFTDKSELF--  237

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  238  TSIRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPSEINRLRCRVN  296

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   S+      ++A+HLRF+K M   S CDF G + EK
Sbjct  297  YHALKFLPDIEHMADVLASRMR---SRTNSSNPYMALHLRFEKGMVGLSFCDFVGTREEK  353

Query  543  LSLAKYRQ  566
            + +A+YR+
Sbjct  354  VKMAEYRK  361



>ref|XP_010932070.1| PREDICTED: uncharacterized protein At1g04910 [Elaeis guineensis]
Length=563

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 122/188 (65%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFIE LKDD+ IV+++PD F+     +  
Sbjct  191  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIEYLKDDVRIVRDIPDWFTEKAELF--  248

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P  I  LRC+VN
Sbjct  249  TSIRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPPQINRLRCRVN  307

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  308  YHALKFLPEIEGMADKLAARMR---NRTGSLNPYMALHLRFEKGMVGLSFCDFVGTREEK  364

Query  543  LSLAKYRQ  566
              +A YRQ
Sbjct  365  AMMATYRQ  372



>ref|XP_010100364.1| hypothetical protein L484_027673 [Morus notabilis]
 gb|EXB82498.1| hypothetical protein L484_027673 [Morus notabilis]
Length=550

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 127/188 (68%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D ++F DIFDVDHFI+ LKDD+ IV+++PD F+  T  +  
Sbjct  178  KIMNATLILPVLKQDQIWKDKTNFEDIFDVDHFIDYLKDDVRIVRDIPDWFTDKTELF--  235

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            ++IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  236  SSIRRT-VKNIPKYAPAQFYIDNVLPRVKEKKIMALKPFVDRLGYDNVPPEINRLRCRVN  294

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  295  YHALKFLPEIEQMADLLAARMR---NRTGSSNPYMALHLRFEKGMVGLSFCDFVGTREEK  351

Query  543  LSLAKYRQ  566
             S+A+YR+
Sbjct  352  ASMAEYRK  359



>ref|XP_007222914.1| hypothetical protein PRUPE_ppa003660mg [Prunus persica]
 gb|EMJ24113.1| hypothetical protein PRUPE_ppa003660mg [Prunus persica]
Length=558

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 126/188 (67%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++P+ F+  T  +  
Sbjct  186  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPEWFTDKTELF--  243

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            ++IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  244  SSIRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  302

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  303  YHALKFLPEIEQMADLLASRMR---NRTGSSNPYMALHLRFEKGMVGLSFCDFVGTREEK  359

Query  543  LSLAKYRQ  566
              +AKYR+
Sbjct  360  ALMAKYRE  367



>ref|XP_008221889.1| PREDICTED: uncharacterized protein At1g04910 [Prunus mume]
Length=558

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 126/188 (67%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++P+ F+  T  +  
Sbjct  186  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPEWFTDKTELF--  243

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            ++IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  244  SSIRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  302

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  303  YHALKFLPEIEQMADLLASRMR---NRTGSSNPYMALHLRFEKGMVGLSFCDFVGTREEK  359

Query  543  LSLAKYRQ  566
              +AKYR+
Sbjct  360  ALMAKYRE  367



>ref|XP_008340083.1| PREDICTED: uncharacterized protein At1g04910 [Malus domestica]
Length=558

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 125/187 (67%), Gaps = 6/187 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++P+ F+     +  
Sbjct  186  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPEWFTDKAELF--  243

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  244  TSIRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  302

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++  G   ++A+HLRF+K M   S CDF G + EK
Sbjct  303  YHALKFLPEIEEMADLLASRMR---NRTGGSNPYMALHLRFEKGMVGLSFCDFVGTREEK  359

Query  543  LSLAKYR  563
              +A+YR
Sbjct  360  ALMAEYR  366



>ref|XP_004951839.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=574

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            +I++ATL++P L+ + +W+D + F DIFDVDHFI  LKDD+ IV+++PD F+   ++   
Sbjct  202  RIMSATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKDDVRIVRDIPDWFT--EKDELF  259

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+I+ T +K  P +ASA +Y +NVLP ++   I +I PF  RL +DN+P +I  LRC+VN
Sbjct  260  TSIKRT-VKNIPKYASAQFYIDNVLPRIKEKKIMSIKPFVDRLGYDNVPMEINRLRCRVN  318

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+PHI  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  319  YHALKFLPHIEEMADKLAARMR---NRTGSINPYMALHLRFEKGMVGLSFCDFAGTREEK  375

Query  543  LSLAKYRQ  566
              +A YRQ
Sbjct  376  AMMAAYRQ  383



>ref|XP_009359192.1| PREDICTED: uncharacterized protein At1g04910 [Pyrus x bretschneideri]
Length=559

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 125/187 (67%), Gaps = 6/187 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++P+ F+     +  
Sbjct  187  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPEWFTDKAELF--  244

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  245  TSIRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  303

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++  G   ++A+HLRF+K M   S CDF G + EK
Sbjct  304  YHALKFLPEIEEMADLLASRMR---NRTGGSNPYMALHLRFEKGMVGLSFCDFVGTREEK  360

Query  543  LSLAKYR  563
              +A+YR
Sbjct  361  ALMAEYR  367



>ref|XP_002438900.1| hypothetical protein SORBIDRAFT_10g027900 [Sorghum bicolor]
 gb|EER90267.1| hypothetical protein SORBIDRAFT_10g027900 [Sorghum bicolor]
Length=560

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI  LK+D+ IV+++PD F+   ++   
Sbjct  187  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKEDVRIVRDIPDWFT--EKDELF  244

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+I+ T +K  P +ASA +Y +NVLP ++   I +I PF  RL +DN+P +I  LRC+VN
Sbjct  245  TSIKRT-VKNVPKYASAQFYIDNVLPRIKEKKIMSIKPFVDRLGYDNVPTEINRLRCRVN  303

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  304  YHALKFLPDIEEMADKLATRMR---NRTGSLNPYMALHLRFEKGMVGLSFCDFAGTREEK  360

Query  543  LSLAKYRQN  569
              +A YRQ 
Sbjct  361  AMMATYRQQ  369



>ref|XP_006657268.1| PREDICTED: uncharacterized protein At1g04910-like [Oryza brachyantha]
Length=561

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVD+FI  LKDD+ IV+E+P+ F+   ++   
Sbjct  188  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDYFINYLKDDVRIVREIPEWFT--EKDELF  245

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+I+ T +K  P +ASA +Y +NVLP ++   I +I PF  RL +DN+P +I  LRC+VN
Sbjct  246  TSIKRT-VKNIPKYASAQFYIDNVLPRIKEKKIMSIKPFVDRLGYDNVPMEINRLRCRVN  304

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  305  YHALKFLPEIEEMADKLATRMR---NRTGSVNPYMALHLRFEKGMVGLSFCDFAGTRDEK  361

Query  543  LSLAKYRQ  566
              +A+YRQ
Sbjct  362  AMMAEYRQ  369



>ref|XP_004298993.2| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=570

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 126/188 (67%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++P+ F+  T  +  
Sbjct  198  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPEWFTDRTELF--  255

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            ++IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  256  SSIRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  314

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  315  YHALKFLPEIEQMADLLASRMR---NRTGSSNPYMALHLRFEKGMVGLSFCDFVGTREEK  371

Query  543  LSLAKYRQ  566
              +AKYR+
Sbjct  372  ALMAKYRE  379



>ref|XP_010528094.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=574

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 124/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LK D+ IV+++P+ F+    E +S
Sbjct  202  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKADVRIVRDIPEWFT-DKSELFS  260

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  261  S-IRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPPEINRLRCRVN  318

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + ALVF+P I  + D L+ R+R    K   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  319  YHALVFLPEIEQMADLLVSRMRNRTGK---PNPYMALHLRFEKGMVGLSFCDFVGTREEK  375

Query  543  LSLAKYRQ  566
              +A YR 
Sbjct  376  AKMAVYRH  383



>gb|KDO82190.1| hypothetical protein CISIN_1g008884mg [Citrus sinensis]
Length=449

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++PD F+    E +S
Sbjct  178  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFT-DKSELFS  236

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  237  S-IRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPPEINRLRCRVN  294

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R++   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  295  YHALKFLPEIEQMSDLLASRMK---NRTGSSNPYMALHLRFEKGMVGLSFCDFVGTREEK  351

Query  543  LSLAKYRQ  566
              +A+YR+
Sbjct  352  AKMAEYRK  359



>ref|NP_001169204.1| hypothetical protein [Zea mays]
 gb|ACN31937.1| unknown [Zea mays]
 gb|AFW69196.1| hypothetical protein ZEAMMB73_758834 [Zea mays]
Length=372

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 121/187 (65%), Gaps = 6/187 (3%)
 Frame = +3

Query  9    LNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYSTA  188
            +NATL++P L+ + +W+D + F DIFDVDHFI  LK+D+ IV+++PD F+   ++   T+
Sbjct  1    MNATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKEDVRIVRDIPDWFT--EKDELFTS  58

Query  189  IRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVNFR  368
            I+ T +K  P +ASA +Y +NV P ++   I +I PF  RL +DN+P +I  LRC+VN+ 
Sbjct  59   IKRT-VKNVPKYASAQFYIDNVFPRIKEKKIMSIKPFVDRLGYDNVPMEINRLRCRVNYH  117

Query  369  ALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  548
            AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK  
Sbjct  118  ALKFLPDIEEMADKLATRMR---NRTGSLNPYMALHLRFEKGMVGLSFCDFAGTREEKAM  174

Query  549  LAKYRQN  569
            +A YRQ 
Sbjct  175  MATYRQQ  181



>ref|NP_001152550.1| auxin-independent growth promoter-like protein [Zea mays]
 gb|ACG48173.1| auxin-independent growth promoter-like protein [Zea mays]
Length=555

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI  LK+D+ IV+++PD F+   ++   
Sbjct  182  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKEDVRIVRDIPDWFT--EKDDLF  239

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+I+ T +K  P +ASA +Y +NVLP ++   I +I PF  RL +DN+P +I  LRC+VN
Sbjct  240  TSIKRT-VKNVPKYASAQFYIDNVLPRIKEKKIMSIKPFVDRLGYDNVPMEINRLRCRVN  298

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  299  YHALKFLPDIEEMADKLATRMR---NRTGSLNPYMALHLRFEKGMVGLSFCDFAGTREEK  355

Query  543  LSLAKYRQN  569
              +A YRQ 
Sbjct  356  AMMATYRQQ  364



>ref|XP_010023452.1| PREDICTED: uncharacterized protein At1g04910 [Eucalyptus grandis]
 gb|KCW59721.1| hypothetical protein EUGRSUZ_H02475 [Eucalyptus grandis]
Length=572

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 127/188 (68%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++P+ F+  +  +  
Sbjct  200  KILNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPEWFTDKSELF--  257

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P++I  LRC+VN
Sbjct  258  TSIRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPQEINRLRCRVN  316

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + ++L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  317  YHALKFLPEIEEMSNSLASRMR---NRTGSQNPYMALHLRFEKGMVGLSFCDFVGTREEK  373

Query  543  LSLAKYRQ  566
              +A+YR+
Sbjct  374  AKMAEYRK  381



>gb|EMT20301.1| hypothetical protein F775_28818 [Aegilops tauschii]
Length=450

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 121/197 (61%), Gaps = 12/197 (6%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI  LKDD+ IV+++PD F+     + S
Sbjct  65   KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKDDVRIVRDIPDWFTEKDELFTS  124

Query  183  TAIRPTR---------IKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKD  335
             + R  +         +K  P +A A +Y +NVLP ++   I +I PF  RL +DN+P  
Sbjct  125  ISFRYLQVTYAFLMRTVKNIPKYAPAQFYVDNVLPRIKEKKIMSIKPFVDRLGYDNVPMK  184

Query  336  IQHLRCKVNFRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSAC  515
            I  LRC+VN+ AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S C
Sbjct  185  INRLRCRVNYHALKFLPGIEEMADKLATRMR---NRTGNVNPYMALHLRFEKGMVGLSFC  241

Query  516  DFGGGKAEKLSLAKYRQ  566
            DF G + EK  +A+YRQ
Sbjct  242  DFAGTREEKAMMAEYRQ  258



>ref|XP_006438229.1| hypothetical protein CICLE_v10031037mg [Citrus clementina]
 gb|ESR51469.1| hypothetical protein CICLE_v10031037mg [Citrus clementina]
Length=488

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++PD F+    E +S
Sbjct  217  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFT-DKSELFS  275

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  276  S-IRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPPEINRLRCRVN  333

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R++   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  334  YHALKFLPEIEQMSDLLASRMK---NRTGSSNPYMALHLRFEKGMVGLSFCDFVGTREEK  390

Query  543  LSLAKYRQ  566
              +A+YR+
Sbjct  391  AKMAEYRK  398



>dbj|BAK05991.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=445

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 123/188 (65%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+ ATL++P L+ + +W+D + F DIFDVDHFI  LKDD+ IV+++PD F+   ++   
Sbjct  72   KIMEATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKDDVRIVRDIPDWFT--EKDELF  129

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+I+ T +K  P +ASA +Y +NVLP ++   I +I PF  RL +DN+P +I  LRC+VN
Sbjct  130  TSIKRT-VKNIPKYASAQFYIDNVLPRIKEKTIMSIKPFVDRLGYDNVPTEINRLRCRVN  188

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  ++R   ++      ++A+HLR++K M   S CDF G + EK
Sbjct  189  YHALKFLPDIEEMADKLATKMR---NRTTSGNPYMALHLRYEKGMVGLSFCDFAGTRDEK  245

Query  543  LSLAKYRQ  566
              +A YRQ
Sbjct  246  AMMAAYRQ  253



>gb|KDP26681.1| hypothetical protein JCGZ_17839 [Jatropha curcas]
Length=551

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 126/188 (67%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++P+ F+    E +S
Sbjct  179  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPEWFT-DKSELFS  237

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  238  S-IRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPPEINRLRCRVN  295

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L+ R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  296  YHALKFLPEIEQMADLLVSRMR---NRTGSSNPYMALHLRFEKGMVGLSFCDFVGTREEK  352

Query  543  LSLAKYRQ  566
              +A+YR+
Sbjct  353  ARMAEYRK  360



>dbj|BAJ98197.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=561

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 123/188 (65%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI  LKDD+ IV+++PD F  + ++   
Sbjct  188  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKDDVRIVRDIPDWF--TEKDELF  245

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +A A +Y +NVLP ++   I +I PF  RL +DN+P  I  LRC+VN
Sbjct  246  TSIRRT-VKNIPKYAPAQFYVDNVLPRIKEKTIMSIKPFVDRLGYDNVPMKINRLRCRVN  304

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  305  YHALKFLPGIEEMADKLAARMR---NRTGNVNPYMALHLRFEKGMVGLSFCDFVGTREEK  361

Query  543  LSLAKYRQ  566
              +A+YRQ
Sbjct  362  AMMAEYRQ  369



>gb|EMT25019.1| hypothetical protein F775_14193 [Aegilops tauschii]
Length=528

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 124/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+ ATL++P L+ + +W+D + F DIFDVDHFI  LKDD+ IV+++PD F+   ++   
Sbjct  155  KIMEATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKDDVRIVRDIPDWFT--EKDELF  212

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+I+ T +K  P +ASA +Y +NVLP ++   I +I PF  RL +DN+P +I  LRC+VN
Sbjct  213  TSIKRT-VKNIPKYASAQFYIDNVLPRIKEKTIMSIKPFVDRLGYDNVPMEINRLRCRVN  271

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  ++R   ++      ++A+HLR++K M   S CDF G + EK
Sbjct  272  YHALKFLPDIEEMADKLATKMR---NRTSSGNPYMALHLRYEKGMVGLSFCDFAGTREEK  328

Query  543  LSLAKYRQ  566
            + +A YRQ
Sbjct  329  VMMAAYRQ  336



>gb|ACF86391.1| unknown [Zea mays]
 gb|ACL53611.1| unknown [Zea mays]
Length=555

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI  LK+D+ IV+++PD F+   ++   
Sbjct  182  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKEDVHIVRDIPDWFT--EKDDLF  239

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+I+ T +K  P +ASA +Y +NVLP ++   I +I PF  RL +DN+P +I  LRC+VN
Sbjct  240  TSIKRT-VKNVPKYASAQFYIDNVLPRIKEKKIMSIKPFVDRLGYDNVPMEINRLRCRVN  298

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  299  YHALKFLPDIEEMADKLATRMR---NRTGSLNPYMALHLRFEKGMVGLSFCDFAGTREEK  355

Query  543  LSLAKYRQN  569
              +A YRQ 
Sbjct  356  AMMATYRQQ  364



>ref|XP_006648331.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Oryza 
brachyantha]
Length=531

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 124/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+ ATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++PD F+   ++   
Sbjct  156  KIMKATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFT--EKDELF  213

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+I+ T +K  P +ASA +Y +NVLP ++   I +I PF  RL +DN+P +I  LRC+VN
Sbjct  214  TSIKRT-VKNIPKYASAQFYIDNVLPRIKEKKIMSIKPFVDRLGYDNVPMEINRLRCRVN  272

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  273  YHALKFLPDIEEMADKLAARMR---NRTGSINPYMALHLRFEKGMVGLSFCDFAGTREEK  329

Query  543  LSLAKYRQ  566
              +A YRQ
Sbjct  330  EMMAAYRQ  337



>ref|XP_002285492.1| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
 emb|CBI16804.3| unnamed protein product [Vitis vinifera]
Length=552

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 124/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++P+ F+   +    
Sbjct  180  KIMNATLILPLLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPEWFT--DKSELL  237

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  238  TSIRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPPEINRLRCRVN  296

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  297  YHALKFLPEIEQMADQLASRMR---NRTGSSNPYMALHLRFEKGMVGLSFCDFVGTREEK  353

Query  543  LSLAKYRQ  566
              +A+YR+
Sbjct  354  AQMAEYRK  361



>ref|XP_010556342.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
Length=560

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIF VDHFI+ LKDD+ IV+++P+ F+    E +S
Sbjct  188  KIMNATLILPVLKQDQIWKDQTKFEDIFYVDHFIDYLKDDVRIVRDIPEWFT-DKSELFS  246

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T IK  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  247  S-IRRT-IKNIPKYAPAQFYIDNVLPRVKEKKIMALKPFVDRLGYDNVPPEINRLRCRVN  304

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L+ R+R    K   P  ++A+HLRF+K M   S CDF G + EK
Sbjct  305  YHALKFLPEIEQMADLLVSRMRNRTGK---PNPYMALHLRFEKGMVGLSFCDFVGTREEK  361

Query  543  LSLAKYRQ  566
              +A+YR+
Sbjct  362  AKMAEYRK  369



>gb|KHG19982.1| hypothetical protein F383_25836 [Gossypium arboreum]
Length=602

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++P  F+  +  +  
Sbjct  230  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPGWFTDKSELF--  287

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  288  TSIRRT-VKNIPKYAPAQFYIDNVLPRVKEKKIMALKPFVDRLGYDNVPPEINRLRCRVN  346

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + + L+ R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  347  YHALKFLPEIEEMANLLVSRMR---NRTGSSNPYMALHLRFEKGMVGLSFCDFVGTREEK  403

Query  543  LSLAKYRQ  566
              +A+YRQ
Sbjct  404  AKMAEYRQ  411



>ref|XP_006438227.1| hypothetical protein CICLE_v10031037mg [Citrus clementina]
 gb|ESR51467.1| hypothetical protein CICLE_v10031037mg [Citrus clementina]
Length=572

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++PD F+    E +S
Sbjct  200  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFT-DKSELFS  258

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  259  S-IRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPPEINRLRCRVN  316

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R++   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  317  YHALKFLPEIEQMSDLLASRMK---NRTGSSNPYMALHLRFEKGMVGLSFCDFVGTREEK  373

Query  543  LSLAKYRQ  566
              +A+YR+
Sbjct  374  AKMAEYRK  381



>ref|XP_002530048.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32348.1| conserved hypothetical protein [Ricinus communis]
Length=552

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 126/188 (67%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KILNATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++P+ F+    E +S
Sbjct  180  KILNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPEWFT-DKAELFS  238

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  239  S-IRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPPEINRLRCRVN  296

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L+ R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  297  YHALKFLPEIEQMADLLVSRMR---NRTGNSNPYMALHLRFEKGMVGLSFCDFVGTREEK  353

Query  543  LSLAKYRQ  566
              +A+YR+
Sbjct  354  AIMAEYRK  361



>ref|XP_006483965.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=550

 Score =   167 bits (424),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++PD F+    E +S
Sbjct  178  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFT-DKSELFS  236

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  237  S-IRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPPEINRLRCRVN  294

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R++   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  295  YHALKFLPEIEQMSDLLASRMK---NRTGSSNPYMALHLRFEKGMVGLSFCDFVGTREEK  351

Query  543  LSLAKYRQ  566
              +A+YR+
Sbjct  352  AKMAEYRK  359



>gb|KDO82189.1| hypothetical protein CISIN_1g008884mg [Citrus sinensis]
Length=550

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++PD F+    E +S
Sbjct  178  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPDWFT-DKSELFS  236

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            + IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  237  S-IRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPPEINRLRCRVN  294

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R++   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  295  YHALKFLPEIEQMSDLLASRMK---NRTGSSNPYMALHLRFEKGMVGLSFCDFVGTREEK  351

Query  543  LSLAKYRQ  566
              +A+YR+
Sbjct  352  AKMAEYRK  359



>ref|XP_002451572.1| hypothetical protein SORBIDRAFT_04g004090 [Sorghum bicolor]
 gb|EES04548.1| hypothetical protein SORBIDRAFT_04g004090 [Sorghum bicolor]
Length=570

 Score =   167 bits (424),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 123/188 (65%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+ ATL++P L+ + +W+D + F DIFDVDHFI  LKDD+ IV+++PD F+   ++   
Sbjct  198  KIMRATLILPVLKQDQIWKDQTKFEDIFDVDHFINYLKDDVRIVRDIPDWFT--EKDELF  255

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            T+I+ T +K  P +ASA +Y +NVLP ++   I +I PF  RL +DN+P +I  LRC+VN
Sbjct  256  TSIKRT-VKNIPKYASAQFYIDNVLPRIKEKKIMSIKPFVDRLGYDNVPMEINRLRCRVN  314

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  315  YHALKFLPDIEEMADKLAARMR---NRTGNINPYMALHLRFEKGMVGLSFCDFAGTREEK  371

Query  543  LSLAKYRQ  566
              +A YRQ
Sbjct  372  AMMAAYRQ  379



>ref|XP_004502388.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=551

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = +3

Query  3    KILNATLVIPYLEVNPVWQDSSSFMDIFDVDHFIEVLKDDISIVKELPDEFSWSTREYYS  182
            KI+NATL++P L+ + +W+D + F DIFDVDHFI+ LKDD+ IV+++P+ F+  T  +  
Sbjct  179  KIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVRIVRDIPEWFTDKTELF--  236

Query  183  TAIRPTRIKTAPVHASANWYSENVLPVLRSYGIAAIAPFSHRLAFDNMPKDIQHLRCKVN  362
            ++IR T +K  P +A A +Y +NVLP ++   I A+ PF  RL +DN+P +I  LRC+VN
Sbjct  237  SSIRRT-VKNIPKYAPAQFYIDNVLPRIKEKKIMALKPFVDRLGYDNVPPEINKLRCRVN  295

Query  363  FRALVFVPHIRALGDALIHRLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEK  542
            + AL F+P I  + D L  R+R   ++      ++A+HLRF+K M   S CDF G + EK
Sbjct  296  YHALKFLPDIEQMADLLASRMR---NRTGSSNPYMALHLRFEKGMVGLSFCDFVGTREEK  352

Query  543  LSLAKYRQ  566
              +A+YR+
Sbjct  353  AKMAEYRK  360



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520