BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS045B06

Length=594
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KGN58426.1|  hypothetical protein Csa_3G642670                       243   3e-76   Cucumis sativus [cucumbers]
ref|XP_009798482.1|  PREDICTED: probable inactive serine/threonin...    255   3e-76   Nicotiana sylvestris
ref|XP_009798481.1|  PREDICTED: probable inactive serine/threonin...    255   4e-76   Nicotiana sylvestris
ref|XP_011076582.1|  PREDICTED: probable inactive serine/threonin...    255   4e-76   Sesamum indicum [beniseed]
ref|XP_011076581.1|  PREDICTED: probable inactive serine/threonin...    255   5e-76   Sesamum indicum [beniseed]
gb|EYU20126.1|  hypothetical protein MIMGU_mgv1a001437mg                254   9e-76   Erythranthe guttata [common monkey flower]
ref|XP_009779914.1|  PREDICTED: probable inactive serine/threonin...    253   4e-75   Nicotiana sylvestris
ref|XP_009779913.1|  PREDICTED: probable inactive serine/threonin...    253   4e-75   Nicotiana sylvestris
ref|XP_009623483.1|  PREDICTED: probable inactive serine/threonin...    251   1e-74   Nicotiana tomentosiformis
ref|XP_009623482.1|  PREDICTED: probable inactive serine/threonin...    251   1e-74   Nicotiana tomentosiformis
ref|XP_009590238.1|  PREDICTED: probable inactive serine/threonin...    251   2e-74   Nicotiana tomentosiformis
ref|XP_009590239.1|  PREDICTED: probable inactive serine/threonin...    251   2e-74   Nicotiana tomentosiformis
ref|XP_010322119.1|  PREDICTED: probable inactive serine/threonin...    250   3e-74   Solanum lycopersicum
ref|XP_002280870.1|  PREDICTED: N-terminal kinase-like protein          249   6e-74   Vitis vinifera
ref|XP_002520873.1|  ATP binding protein, putative                      249   6e-74   
ref|XP_006365332.1|  PREDICTED: probable inactive serine/threonin...    249   1e-73   Solanum tuberosum [potatoes]
ref|XP_010321457.1|  PREDICTED: probable inactive serine/threonin...    248   2e-73   
gb|KEH42951.1|  ARM repeat kinase family protein                        231   3e-73   Medicago truncatula
ref|XP_003638544.1|  N-terminal kinase-like protein                     233   5e-73   
ref|XP_004144420.1|  PREDICTED: probable inactive serine/threonin...    246   5e-73   Cucumis sativus [cucumbers]
ref|XP_010252046.1|  PREDICTED: probable inactive serine/threonin...    246   6e-73   Nelumbo nucifera [Indian lotus]
ref|XP_010252047.1|  PREDICTED: probable inactive serine/threonin...    246   8e-73   Nelumbo nucifera [Indian lotus]
ref|XP_006589223.1|  PREDICTED: N-terminal kinase-like protein-li...    229   3e-72   Glycine max [soybeans]
gb|KJB60173.1|  hypothetical protein B456_009G292700                    245   4e-72   Gossypium raimondii
ref|XP_008460279.1|  PREDICTED: probable inactive serine/threonin...    244   4e-72   Cucumis melo [Oriental melon]
ref|XP_004495542.1|  PREDICTED: probable inactive serine/threonin...    244   4e-72   
ref|XP_004495541.1|  PREDICTED: probable inactive serine/threonin...    244   4e-72   Cicer arietinum [garbanzo]
ref|XP_008460276.1|  PREDICTED: probable inactive serine/threonin...    244   5e-72   Cucumis melo [Oriental melon]
ref|XP_010322118.1|  PREDICTED: probable inactive serine/threonin...    244   5e-72   Solanum lycopersicum
ref|XP_003556441.1|  PREDICTED: probable inactive serine/threonin...    243   7e-72   Glycine max [soybeans]
ref|XP_007143981.1|  hypothetical protein PHAVU_007G118900g             242   2e-71   Phaseolus vulgaris [French bean]
gb|KHN14780.1|  N-terminal kinase-like protein                          229   4e-71   Glycine soja [wild soybean]
ref|XP_007011364.1|  Kinase family protein with ARM repeat domain...    237   5e-71   
gb|KDO67547.1|  hypothetical protein CISIN_1g0040251mg                  233   7e-71   Citrus sinensis [apfelsine]
gb|KDP21639.1|  hypothetical protein JCGZ_03310                         241   7e-71   Jatropha curcas
gb|KEH27103.1|  Serine/Threonine kinase family protein                  238   8e-71   Medicago truncatula
gb|KDO67549.1|  hypothetical protein CISIN_1g0040251mg                  233   9e-71   Citrus sinensis [apfelsine]
ref|XP_010031074.1|  PREDICTED: probable inactive serine/threonin...    240   1e-70   Eucalyptus grandis [rose gum]
ref|XP_010031075.1|  PREDICTED: probable inactive serine/threonin...    240   2e-70   Eucalyptus grandis [rose gum]
ref|XP_010031076.1|  PREDICTED: probable inactive serine/threonin...    239   2e-70   Eucalyptus grandis [rose gum]
gb|KCW50335.1|  hypothetical protein EUGRSUZ_J00108                     239   2e-70   Eucalyptus grandis [rose gum]
ref|NP_181605.2|  cytoplasmic tRNA export protein                       238   6e-70   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02142.1|  hypothetical protein                                   238   7e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881735.1|  heat repeat-containing protein                     238   7e-70   Arabidopsis lyrata subsp. lyrata
ref|XP_010554724.1|  PREDICTED: probable inactive serine/threonin...    238   8e-70   Tarenaya hassleriana [spider flower]
gb|KEH27102.1|  Serine/Threonine kinase family protein                  238   8e-70   Medicago truncatula
ref|XP_007011362.1|  Kinase family protein with ARM repeat domain...    238   1e-69   
ref|XP_007011363.1|  Kinase family protein with ARM repeat domain...    238   1e-69   
ref|XP_007225258.1|  hypothetical protein PRUPE_ppa001574mg             237   1e-69   Prunus persica
ref|XP_006293704.1|  hypothetical protein CARUB_v10022662mg             237   2e-69   Capsella rubella
ref|XP_010517510.1|  PREDICTED: N-terminal kinase-like protein          237   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010505824.1|  PREDICTED: N-terminal kinase-like protein          237   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_009141929.1|  PREDICTED: N-terminal kinase-like protein          236   2e-69   Brassica rapa
emb|CDY06969.1|  BnaA04g23460D                                          236   2e-69   
gb|KFK36944.1|  hypothetical protein AALP_AA4G192400                    236   4e-69   Arabis alpina [alpine rockcress]
emb|CDX93162.1|  BnaC04g47340D                                          236   4e-69   
gb|EPS74262.1|  hypothetical protein M569_00492                         236   4e-69   Genlisea aurea
ref|XP_010508814.1|  PREDICTED: N-terminal kinase-like protein is...    236   4e-69   Camelina sativa [gold-of-pleasure]
ref|XP_008782670.1|  PREDICTED: probable inactive serine/threonin...    236   5e-69   Phoenix dactylifera
ref|XP_010667551.1|  PREDICTED: N-terminal kinase-like protein          236   5e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010921160.1|  PREDICTED: probable inactive serine/threonin...    236   7e-69   Elaeis guineensis
ref|XP_010253052.1|  PREDICTED: probable inactive serine/threonin...    233   9e-69   
gb|KJB67947.1|  hypothetical protein B456_010G219100                    235   1e-68   Gossypium raimondii
emb|CDY22472.1|  BnaC03g22820D                                          235   1e-68   Brassica napus [oilseed rape]
gb|KJB67946.1|  hypothetical protein B456_010G219100                    235   1e-68   Gossypium raimondii
gb|KJB67948.1|  hypothetical protein B456_010G219100                    235   1e-68   Gossypium raimondii
gb|KJB67945.1|  hypothetical protein B456_010G219100                    235   1e-68   Gossypium raimondii
ref|XP_006842512.1|  hypothetical protein AMTR_s00077p00108970          234   1e-68   Amborella trichopoda
ref|XP_009133450.1|  PREDICTED: N-terminal kinase-like protein          234   1e-68   Brassica rapa
emb|CDY35443.1|  BnaA03g19170D                                          234   1e-68   Brassica napus [oilseed rape]
ref|XP_010540261.1|  PREDICTED: probable inactive serine/threonin...    234   1e-68   Tarenaya hassleriana [spider flower]
ref|XP_006435941.1|  hypothetical protein CICLE_v10030740mg             234   2e-68   Citrus clementina [clementine]
ref|XP_010111055.1|  putative inactive serine/threonine-protein k...    234   2e-68   
ref|XP_006486152.1|  PREDICTED: LOW QUALITY PROTEIN: N-terminal k...    234   2e-68   
ref|XP_006411339.1|  hypothetical protein EUTSA_v10016269mg             234   2e-68   Eutrema salsugineum [saltwater cress]
ref|XP_008221084.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    233   5e-68   Prunus mume [ume]
ref|XP_010253051.1|  PREDICTED: probable inactive serine/threonin...    232   5e-68   
ref|XP_010938026.1|  PREDICTED: probable inactive serine/threonin...    233   5e-68   Elaeis guineensis
ref|XP_010253050.1|  PREDICTED: probable inactive serine/threonin...    233   5e-68   Nelumbo nucifera [Indian lotus]
gb|KHN29287.1|  N-terminal kinase-like protein                          232   7e-68   Glycine soja [wild soybean]
ref|XP_010253047.1|  PREDICTED: probable inactive serine/threonin...    233   8e-68   
ref|XP_010253049.1|  PREDICTED: probable inactive serine/threonin...    232   9e-68   
gb|KHG02829.1|  N-terminal kinase-like protein                          231   1e-67   Gossypium arboreum [tree cotton]
ref|XP_006587814.1|  PREDICTED: N-terminal kinase-like protein-like     232   1e-67   Glycine max [soybeans]
ref|XP_002319344.2|  HEAT repeat-containing family protein              231   3e-67   
dbj|BAD73565.1|  putative kinase-like protein splice variant 1          224   3e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007139742.1|  hypothetical protein PHAVU_008G055600g             230   5e-67   Phaseolus vulgaris [French bean]
gb|KHN40459.1|  Putative inactive serine/threonine-protein kinase...    230   5e-67   Glycine soja [wild soybean]
tpg|DAA57071.1|  TPA: hypothetical protein ZEAMMB73_658709              222   7e-67   
ref|XP_008810839.1|  PREDICTED: probable inactive serine/threonin...    230   7e-67   Phoenix dactylifera
ref|XP_004297714.1|  PREDICTED: probable inactive serine/threonin...    228   2e-66   Fragaria vesca subsp. vesca
ref|XP_011463428.1|  PREDICTED: probable inactive serine/threonin...    228   2e-66   Fragaria vesca subsp. vesca
tpg|DAA57070.1|  TPA: hypothetical protein ZEAMMB73_658709              223   3e-66   
ref|XP_011010141.1|  PREDICTED: probable inactive serine/threonin...    228   3e-66   Populus euphratica
ref|XP_011010140.1|  PREDICTED: probable inactive serine/threonin...    228   3e-66   Populus euphratica
ref|XP_002458682.1|  hypothetical protein SORBIDRAFT_03g038150          228   5e-66   Sorghum bicolor [broomcorn]
ref|NP_001146277.1|  uncharacterized protein LOC100279852               228   5e-66   Zea mays [maize]
ref|XP_008340425.1|  PREDICTED: probable inactive serine/threonin...    228   5e-66   
tpg|DAA57069.1|  TPA: hypothetical protein ZEAMMB73_658709              223   7e-66   
ref|XP_004970383.1|  PREDICTED: probable inactive serine/threonin...    227   7e-66   Setaria italica
ref|XP_004970384.1|  PREDICTED: probable inactive serine/threonin...    227   7e-66   Setaria italica
gb|AFW84753.1|  hypothetical protein ZEAMMB73_694445                    227   1e-65   
ref|NP_001044644.1|  Os01g0819900                                       226   3e-65   
gb|EEC71713.1|  hypothetical protein OsI_04229                          225   3e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_008674884.1|  PREDICTED: probable inactive serine/threonin...    224   1e-64   Zea mays [maize]
ref|XP_006367546.1|  PREDICTED: probable inactive serine/threonin...    207   1e-64   Solanum tuberosum [potatoes]
ref|XP_011001384.1|  PREDICTED: probable inactive serine/threonin...    223   1e-64   Populus euphratica
ref|XP_002325930.1|  hypothetical protein POPTR_0019s08720g             223   2e-64   
ref|XP_008782671.1|  PREDICTED: probable inactive serine/threonin...    223   2e-64   
ref|XP_006371290.1|  hypothetical protein POPTR_0019s08720g             223   2e-64   Populus trichocarpa [western balsam poplar]
ref|XP_010921159.1|  PREDICTED: probable inactive serine/threonin...    223   3e-64   Elaeis guineensis
ref|XP_009351754.1|  PREDICTED: probable inactive serine/threonin...    221   6e-64   Pyrus x bretschneideri [bai li]
ref|XP_006644915.1|  PREDICTED: probable inactive serine/threonin...    222   7e-64   Oryza brachyantha
ref|XP_003564494.1|  PREDICTED: N-terminal kinase-like protein          221   1e-63   Brachypodium distachyon [annual false brome]
dbj|BAJ85082.1|  predicted protein                                      220   3e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM84765.1|  unnamed protein product                                220   3e-63   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008360002.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    218   1e-62   
ref|XP_002962680.1|  hypothetical protein SELMODRAFT_230150             208   4e-61   
ref|XP_002980417.1|  hypothetical protein SELMODRAFT_444483             213   5e-61   
gb|EMS65875.1|  N-terminal kinase-like protein                          212   4e-60   Triticum urartu
ref|XP_009386930.1|  PREDICTED: probable inactive serine/threonin...    210   9e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001761188.1|  predicted protein                                  210   9e-60   
ref|XP_009386929.1|  PREDICTED: probable inactive serine/threonin...    210   9e-60   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN63376.1|  hypothetical protein VITISV_042412                     202   8e-57   Vitis vinifera
gb|KHG09100.1|  N-terminal kinase-like protein                          198   8e-56   Gossypium arboreum [tree cotton]
gb|EMT22366.1|  N-terminal kinase-like protein                          165   1e-43   
ref|XP_008674885.1|  PREDICTED: probable inactive serine/threonin...    162   1e-42   
ref|XP_002949295.1|  hypothetical protein VOLCADRAFT_80567              150   2e-38   Volvox carteri f. nagariensis
ref|XP_001693766.1|  protein kinase                                     142   3e-35   Chlamydomonas reinhardtii
ref|XP_005649821.1|  ARM repeat-containing protein                      135   7e-34   Coccomyxa subellipsoidea C-169
gb|KIZ00224.1|  putative inactive serine/threonine-protein kinase...    117   1e-29   Monoraphidium neglectum
ref|XP_002506852.1|  predicted protein                                  123   3e-29   Micromonas commoda
ref|XP_011397583.1|  putative inactive serine/threonine-protein k...    119   3e-27   Auxenochlorella protothecoides
ref|XP_003058843.1|  predicted protein                                  108   5e-24   Micromonas pusilla CCMP1545
ref|XP_005843618.1|  hypothetical protein CHLNCDRAFT_140213             106   9e-23   Chlorella variabilis
gb|ENN70165.1|  hypothetical protein YQE_00024                        99.0    7e-22   Dendroctonus ponderosae
ref|XP_007310874.1|  ARM repeat-containing protein                      100   8e-21   Stereum hirsutum FP-91666 SS1
gb|EFA75473.1|  N-terminal kinase-like protein                        96.7    1e-20   Heterostelium album PN500
gb|ERL88617.1|  hypothetical protein D910_06002                       98.6    4e-20   Dendroctonus ponderosae
ref|XP_003437215.1|  AGAP001091-PB                                    98.6    5e-20   Anopheles gambiae str. PEST
ref|XP_318327.5|  AGAP001091-PA                                       98.6    5e-20   Anopheles gambiae str. PEST
dbj|GAM20001.1|  hypothetical protein SAMD00019534_031760             97.1    2e-19   Acytostelium subglobosum LB1
gb|KFB40085.1|  AGAP001091-PB-like protein                            96.3    3e-19   Anopheles sinensis
gb|KDD72431.1|  hypothetical protein H632_c3357p0                     91.7    4e-19   Helicosporidium sp. ATCC 50920
gb|KDR10579.1|  N-terminal kinase-like protein                        94.4    1e-18   Zootermopsis nevadensis
ref|XP_003082766.1|  putative kinase-like protein splice variant ...  93.6    2e-18   Ostreococcus tauri
gb|ETN64322.1|  hypothetical protein AND_003938                       93.6    3e-18   Anopheles darlingi [American malaria mosquito]
emb|CAG09756.1|  unnamed protein product                              92.8    5e-18   Tetraodon nigroviridis
ref|XP_001653616.1|  AAEL008954-PA                                    92.8    5e-18   
gb|EFA06008.1|  hypothetical protein TcasGA2_TC008834                 91.7    9e-18   
ref|XP_975488.1|  PREDICTED: N-terminal kinase-like protein           91.7    1e-17   
ref|XP_001332508.1|  PREDICTED: N-terminal kinase-like protein        91.7    1e-17   Danio rerio [leopard danio]
emb|CCL98356.1|  predicted protein                                    91.7    1e-17   Fibroporia radiculosa
ref|XP_007883863.1|  PREDICTED: N-terminal kinase-like protein        91.3    2e-17   Callorhinchus milii [Australian ghost shark]
gb|EMD37771.1|  hypothetical protein CERSUDRAFT_114433                90.9    2e-17   Gelatoporia subvermispora B
gb|KIP02972.1|  hypothetical protein PHLGIDRAFT_78335                 90.1    2e-17   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_004887795.1|  PREDICTED: N-terminal kinase-like protein is...  90.1    3e-17   
ref|XP_004852456.1|  PREDICTED: N-terminal kinase-like protein is...  90.1    3e-17   
gb|KIO04525.1|  hypothetical protein M404DRAFT_143205                 89.4    4e-17   Pisolithus tinctorius Marx 270
ref|XP_007766334.1|  ARM repeat-containing protein                    89.0    7e-17   Coniophora puteana RWD-64-598 SS2
ref|XP_009547092.1|  hypothetical protein HETIRDRAFT_319485           89.0    8e-17   Heterobasidion irregulare TC 32-1
ref|XP_004808231.1|  PREDICTED: N-terminal kinase-like protein is...  89.0    8e-17   
ref|XP_004770100.1|  PREDICTED: N-terminal kinase-like protein is...  89.0    8e-17   
ref|XP_004770099.1|  PREDICTED: N-terminal kinase-like protein is...  89.0    9e-17   
ref|XP_003288328.1|  hypothetical protein DICPUDRAFT_55347            88.6    1e-16   Dictyostelium purpureum
ref|XP_004852453.1|  PREDICTED: N-terminal kinase-like protein is...  88.2    1e-16   Heterocephalus glaber [naked mole rat]
ref|XP_004887792.1|  PREDICTED: N-terminal kinase-like protein is...  88.2    1e-16   
emb|CDQ83630.1|  unnamed protein product                              88.2    1e-16   Oncorhynchus mykiss
ref|XP_005631807.1|  PREDICTED: N-terminal kinase-like protein        88.2    1e-16   
ref|XP_004852455.1|  PREDICTED: N-terminal kinase-like protein is...  88.2    1e-16   
ref|XP_004887794.1|  PREDICTED: N-terminal kinase-like protein is...  88.2    1e-16   
ref|XP_004852454.1|  PREDICTED: N-terminal kinase-like protein is...  88.2    1e-16   
ref|XP_004887793.1|  PREDICTED: N-terminal kinase-like protein is...  88.2    1e-16   
ref|XP_001421161.1|  predicted protein                                87.8    1e-16   Ostreococcus lucimarinus CCE9901
ref|XP_004264405.1|  PREDICTED: N-terminal kinase-like protein is...  88.2    1e-16   
ref|XP_004328663.1|  PREDICTED: N-terminal kinase-like protein is...  88.2    2e-16   
ref|XP_004328662.1|  PREDICTED: N-terminal kinase-like protein is...  88.2    2e-16   
ref|XP_006937568.1|  PREDICTED: N-terminal kinase-like protein is...  88.2    2e-16   Felis catus [cat]
ref|XP_004394003.1|  PREDICTED: N-terminal kinase-like protein is...  88.2    2e-16   Odobenus rosmarus divergens
ref|XP_006937569.1|  PREDICTED: N-terminal kinase-like protein is...  88.2    2e-16   Felis catus [cat]
ref|XP_004264404.1|  PREDICTED: N-terminal kinase-like protein is...  88.2    2e-16   
ref|XP_006737191.1|  PREDICTED: N-terminal kinase-like protein is...  88.2    2e-16   Leptonychotes weddellii
ref|XP_007462063.1|  PREDICTED: N-terminal kinase-like protein is...  88.2    2e-16   Lipotes vexillifer [baiji]
ref|XP_006737190.1|  PREDICTED: N-terminal kinase-like protein is...  88.2    2e-16   Leptonychotes weddellii
ref|XP_007462064.1|  PREDICTED: N-terminal kinase-like protein is...  88.2    2e-16   Lipotes vexillifer [baiji]
ref|XP_004394002.1|  PREDICTED: N-terminal kinase-like protein is...  88.2    2e-16   Odobenus rosmarus divergens
ref|XP_003970280.1|  PREDICTED: N-terminal kinase-like protein-like   88.2    2e-16   
ref|XP_001744062.1|  hypothetical protein                             87.4    2e-16   Monosiga brevicollis MX1
ref|XP_010781282.1|  PREDICTED: N-terminal kinase-like protein        87.8    2e-16   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_007246440.1|  PREDICTED: N-terminal kinase-like protein-like   87.4    3e-16   Astyanax mexicanus [blind cave fish]
ref|XP_007171007.1|  PREDICTED: N-terminal kinase-like protein is...  87.4    3e-16   Balaenoptera acutorostrata scammoni
ref|XP_007171006.1|  PREDICTED: N-terminal kinase-like protein is...  87.0    3e-16   Balaenoptera acutorostrata scammoni
ref|XP_005105749.1|  PREDICTED: N-terminal kinase-like protein-like   87.0    4e-16   
ref|XP_011305760.1|  PREDICTED: N-terminal kinase-like protein        87.0    4e-16   Fopius arisanus
ref|XP_004596738.1|  PREDICTED: N-terminal kinase-like protein is...  86.7    5e-16   Ochotona princeps [southern American pika]
ref|XP_004596737.1|  PREDICTED: N-terminal kinase-like protein is...  86.7    5e-16   Ochotona princeps [southern American pika]
ref|XP_008325073.1|  PREDICTED: N-terminal kinase-like protein        86.7    6e-16   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010896649.1|  PREDICTED: N-terminal kinase-like protein        86.3    8e-16   Esox lucius
ref|XP_004019945.1|  PREDICTED: N-terminal kinase-like protein        86.3    8e-16   
gb|EGN99569.1|  hypothetical protein SERLA73DRAFT_53136               85.5    8e-16   Serpula lacrymans var. lacrymans S7.3
ref|XP_005660762.1|  PREDICTED: N-terminal kinase-like protein is...  85.9    8e-16   Sus scrofa [pigs]
ref|XP_008292578.1|  PREDICTED: N-terminal kinase-like protein        85.9    9e-16   Stegastes partitus
ref|XP_004627298.1|  PREDICTED: N-terminal kinase-like protein is...  85.9    9e-16   
ref|XP_005660761.1|  PREDICTED: N-terminal kinase-like protein is...  85.9    1e-15   
ref|XP_007396695.1|  hypothetical protein PHACADRAFT_96310            85.1    1e-15   Phanerochaete carnosa HHB-10118-sp
ref|XP_005913411.1|  PREDICTED: N-terminal kinase-like protein-like   85.9    1e-15   Haplochromis burtoni
ref|XP_003798704.1|  PREDICTED: N-terminal kinase-like protein is...  85.5    1e-15   
ref|XP_004545618.1|  PREDICTED: N-terminal kinase-like protein-like   85.9    1e-15   
ref|XP_006101615.1|  PREDICTED: N-terminal kinase-like protein is...  85.5    1e-15   
ref|XP_010836153.1|  PREDICTED: N-terminal kinase-like protein        85.5    1e-15   Bison bison bison
ref|XP_004627297.1|  PREDICTED: N-terminal kinase-like protein is...  85.5    1e-15   
ref|XP_005723139.1|  PREDICTED: N-terminal kinase-like protein-like   85.5    1e-15   Pundamilia nyererei
ref|XP_002126730.2|  PREDICTED: N-terminal kinase-like protein        85.5    1e-15   Ciona intestinalis [sea vase]
ref|XP_006101614.1|  PREDICTED: N-terminal kinase-like protein is...  85.5    1e-15   Myotis lucifugus
ref|XP_006893391.1|  PREDICTED: N-terminal kinase-like protein is...  85.5    1e-15   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|KIM45100.1|  hypothetical protein M413DRAFT_441766                 85.5    1e-15   Hebeloma cylindrosporum h7
ref|XP_003798701.1|  PREDICTED: N-terminal kinase-like protein is...  85.5    1e-15   Otolemur garnettii
ref|XP_006893392.1|  PREDICTED: N-terminal kinase-like protein is...  85.5    1e-15   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005384547.1|  PREDICTED: N-terminal kinase-like protein is...  85.5    1e-15   
ref|XP_007317261.1|  hypothetical protein SERLADRAFT_436901           85.5    1e-15   Serpula lacrymans var. lacrymans S7.9
ref|XP_005384545.1|  PREDICTED: N-terminal kinase-like protein is...  85.5    1e-15   Chinchilla lanigera
ref|XP_005384546.1|  PREDICTED: N-terminal kinase-like protein is...  85.1    1e-15   
ref|XP_003798702.1|  PREDICTED: N-terminal kinase-like protein is...  85.1    2e-15   
ref|XP_003798703.1|  PREDICTED: N-terminal kinase-like protein is...  85.1    2e-15   
ref|XP_005333621.1|  PREDICTED: N-terminal kinase-like protein        85.1    2e-15   
ref|XP_007267076.1|  ARM repeat-containing protein                    84.3    2e-15   Fomitiporia mediterranea MF3/22
gb|EPS93604.1|  hypothetical protein FOMPIDRAFT_1153884               82.8    2e-15   Fomitopsis pinicola FP-58527 SS1
ref|XP_006782030.1|  PREDICTED: N-terminal kinase-like protein-like   85.1    2e-15   Neolamprologus brichardi [lyretail cichlid]
ref|XP_003444779.1|  PREDICTED: N-terminal kinase-like protein-li...  85.1    2e-15   Oreochromis niloticus
ref|XP_008418645.1|  PREDICTED: N-terminal kinase-like protein        85.1    2e-15   Poecilia reticulata
ref|XP_005806600.1|  PREDICTED: N-terminal kinase-like protein-like   85.1    2e-15   
ref|XP_005988943.1|  PREDICTED: N-terminal kinase-like protein        84.7    2e-15   Latimeria chalumnae
gb|EDM12530.1|  rCG47917, isoform CRA_b                               84.7    2e-15   Rattus norvegicus [brown rat]
ref|XP_003353824.1|  PREDICTED: N-terminal kinase-like protein is...  84.7    2e-15   
gb|KIJ19265.1|  hypothetical protein PAXINDRAFT_70414                 84.3    2e-15   Paxillus involutus ATCC 200175
ref|XP_003122606.2|  PREDICTED: N-terminal kinase-like protein is...  84.7    2e-15   Sus scrofa [pigs]
ref|XP_007550401.1|  PREDICTED: N-terminal kinase-like protein is...  84.7    2e-15   Poecilia formosa
ref|NP_001011938.1|  N-terminal kinase-like protein                   84.7    2e-15   Rattus norvegicus [brown rat]
ref|XP_002590882.1|  hypothetical protein BRAFLDRAFT_101148           84.7    3e-15   Branchiostoma floridae
ref|XP_002916685.1|  PREDICTED: N-terminal kinase-like protein        84.3    3e-15   Ailuropoda melanoleuca
ref|XP_006230811.2|  PREDICTED: N-terminal kinase-like protein is...  84.3    3e-15   Rattus norvegicus [brown rat]
ref|XP_010737506.1|  PREDICTED: N-terminal kinase-like protein        84.7    3e-15   
ref|XP_007550400.1|  PREDICTED: N-terminal kinase-like protein is...  84.3    3e-15   
ref|XP_008145181.1|  PREDICTED: N-terminal kinase-like protein is...  84.3    3e-15   Eptesicus fuscus
ref|XP_006980716.1|  PREDICTED: N-terminal kinase-like protein is...  84.3    3e-15   Peromyscus maniculatus bairdii
ref|XP_004656724.1|  PREDICTED: N-terminal kinase-like protein is...  84.3    3e-15   Jaculus jaculus
ref|XP_004656725.1|  PREDICTED: N-terminal kinase-like protein is...  84.0    3e-15   Jaculus jaculus
gb|AAF81422.1|  teratoma-associated tyrosine kinase                   81.3    3e-15   Homo sapiens [man]
gb|EDL33172.1|  SCY1-like 1 (S. cerevisiae), isoform CRA_a            84.0    4e-15   Mus musculus [mouse]
ref|XP_010346899.1|  PREDICTED: N-terminal kinase-like protein        84.0    4e-15   Saimiri boliviensis boliviensis
gb|KJE91874.1|  SCY1 protein kinase                                   84.3    4e-15   Capsaspora owczarzaki ATCC 30864
ref|XP_008576922.1|  PREDICTED: N-terminal kinase-like protein        84.0    4e-15   Galeopterus variegatus [Malayan flying lemur]
ref|XP_005533280.1|  PREDICTED: N-terminal kinase-like protein        84.0    4e-15   
ref|XP_004383791.1|  PREDICTED: N-terminal kinase-like protein        84.0    4e-15   Trichechus manatus latirostris
ref|XP_006860991.1|  PREDICTED: N-terminal kinase-like protein is...  84.0    4e-15   Chrysochloris asiatica
dbj|BAE22111.1|  unnamed protein product                              84.0    4e-15   Mus musculus [mouse]
ref|XP_006531920.1|  PREDICTED: N-terminal kinase-like protein is...  84.0    4e-15   
dbj|BAE26711.1|  unnamed protein product                              84.0    4e-15   Mus musculus [mouse]
ref|XP_005894112.1|  PREDICTED: N-terminal kinase-like protein is...  84.0    4e-15   Bos mutus
ref|XP_006531919.1|  PREDICTED: N-terminal kinase-like protein is...  84.0    4e-15   
ref|XP_005960237.1|  PREDICTED: N-terminal kinase-like protein is...  84.0    4e-15   Pantholops hodgsonii [Tibetan antelope]
ref|XP_005179933.1|  PREDICTED: N-terminal kinase-like protein is...  84.0    4e-15   Musca domestica
ref|NP_076401.1|  N-terminal kinase-like protein                      84.0    4e-15   Mus musculus [mouse]
gb|AAH34519.1|  SCY1-like 1 (S. cerevisiae)                           84.0    4e-15   Mus musculus [mouse]
ref|XP_005960236.1|  PREDICTED: N-terminal kinase-like protein is...  84.0    4e-15   Pantholops hodgsonii [Tibetan antelope]
ref|XP_005179932.1|  PREDICTED: N-terminal kinase-like protein is...  84.0    4e-15   Musca domestica
ref|XP_005227135.1|  PREDICTED: N-terminal kinase-like protein is...  84.0    4e-15   Bos taurus [bovine]
ref|NP_001095491.1|  N-terminal kinase-like protein                   84.0    5e-15   Bos taurus [bovine]
gb|KII92019.1|  hypothetical protein PLICRDRAFT_50465                 84.0    5e-15   Plicaturopsis crispa FD-325 SS-3
ref|XP_006056531.1|  PREDICTED: N-terminal kinase-like protein is...  84.0    5e-15   
ref|XP_005894111.1|  PREDICTED: N-terminal kinase-like protein is...  83.6    5e-15   Bos mutus
ref|XP_006056535.1|  PREDICTED: N-terminal kinase-like protein is...  83.6    5e-15   
ref|XP_006056534.1|  PREDICTED: N-terminal kinase-like protein is...  83.6    5e-15   
ref|XP_006056533.1|  PREDICTED: N-terminal kinase-like protein is...  83.6    5e-15   
ref|XP_010819381.1|  PREDICTED: N-terminal kinase-like protein is...  83.6    5e-15   
ref|XP_006056532.1|  PREDICTED: N-terminal kinase-like protein is...  83.6    5e-15   
ref|XP_010819380.1|  PREDICTED: N-terminal kinase-like protein is...  83.6    5e-15   
ref|XP_006056536.1|  PREDICTED: N-terminal kinase-like protein is...  83.6    5e-15   
emb|CDO75531.1|  hypothetical protein BN946_scf184871.g12             83.6    5e-15   Trametes cinnabarina
ref|XP_004351870.1|  SCY1 family protein kinase                       83.6    5e-15   
gb|KIO18829.1|  hypothetical protein M407DRAFT_31509                  83.2    5e-15   
ref|XP_007863973.1|  ARM repeat-containing protein                    83.2    5e-15   
ref|XP_010955478.1|  PREDICTED: N-terminal kinase-like protein        83.6    6e-15   
ref|XP_008145182.1|  PREDICTED: N-terminal kinase-like protein is...  83.6    6e-15   
ref|XP_010994302.1|  PREDICTED: N-terminal kinase-like protein        83.6    6e-15   
ref|XP_003320098.2|  SCY1 protein kinase                              83.6    6e-15   
ref|XP_005351818.1|  PREDICTED: N-terminal kinase-like protein is...  83.2    6e-15   
gb|KIJ67457.1|  hypothetical protein HYDPIDRAFT_84174                 82.8    6e-15   
emb|CDQ84486.1|  unnamed protein product                              83.2    6e-15   
gb|AAH74449.1|  LOC443710 protein                                     83.2    6e-15   
ref|XP_005351816.1|  PREDICTED: N-terminal kinase-like protein is...  83.2    7e-15   
ref|XP_005351817.1|  PREDICTED: N-terminal kinase-like protein is...  83.2    7e-15   
ref|XP_004051558.1|  PREDICTED: N-terminal kinase-like protein is...  83.2    7e-15   
ref|XP_004618474.1|  PREDICTED: N-terminal kinase-like protein is...  83.2    7e-15   
ref|XP_006980715.1|  PREDICTED: N-terminal kinase-like protein is...  83.2    7e-15   
ref|NP_001085304.1|  N-terminal kinase-like protein                   83.2    7e-15   
gb|KJA27713.1|  hypothetical protein HYPSUDRAFT_130539                82.8    7e-15   
ref|XP_007518662.1|  PREDICTED: N-terminal kinase-like protein is...  83.2    7e-15   
ref|XP_004051559.1|  PREDICTED: N-terminal kinase-like protein is...  83.2    7e-15   
dbj|BAG63559.1|  unnamed protein product                              81.3    7e-15   
ref|XP_006860992.1|  PREDICTED: N-terminal kinase-like protein is...  83.2    8e-15   
ref|XP_007354356.1|  ARM repeat-containing protein                    83.2    8e-15   
ref|XP_008555219.1|  PREDICTED: N-terminal kinase-like protein        82.8    8e-15   
ref|XP_007518661.1|  PREDICTED: N-terminal kinase-like protein is...  83.2    8e-15   
gb|KDQ15249.1|  hypothetical protein BOTBODRAFT_108853                82.4    9e-15   
gb|KIM54429.1|  hypothetical protein SCLCIDRAFT_136847                82.4    9e-15   
ref|XP_004618475.1|  PREDICTED: N-terminal kinase-like protein is...  82.8    9e-15   
emb|CDY23885.1|  BnaC04g01520D                                        79.3    1e-14   
ref|XP_010597468.1|  PREDICTED: LOW QUALITY PROTEIN: N-terminal k...  82.8    1e-14   
ref|XP_005064036.1|  PREDICTED: N-terminal kinase-like protein is...  82.4    1e-14   
ref|XP_005064035.1|  PREDICTED: N-terminal kinase-like protein is...  82.4    1e-14   
ref|XP_011185958.1|  PREDICTED: N-terminal kinase-like protein is...  82.4    1e-14   
ref|XP_011185955.1|  PREDICTED: N-terminal kinase-like protein is...  82.4    1e-14   
gb|KDQ53592.1|  hypothetical protein JAAARDRAFT_183140                82.0    1e-14   
ref|XP_007381554.1|  ARM repeat-containing protein                    82.0    1e-14   
ref|XP_007371472.1|  hypothetical protein DICSQDRAFT_94480            82.4    1e-14   
ref|XP_011185961.1|  PREDICTED: N-terminal kinase-like protein is...  82.4    1e-14   
ref|XP_011185959.1|  PREDICTED: N-terminal kinase-like protein is...  82.4    1e-14   
gb|KEP51446.1|  SCY1 kinase                                           82.4    1e-14   
dbj|BAB55454.1|  kinase-like protein splice variant 2                 82.0    1e-14   
gb|EAW74398.1|  SCY1-like 1 (S. cerevisiae), isoform CRA_d            82.0    2e-14   
ref|XP_004437663.1|  PREDICTED: N-terminal kinase-like protein is...  82.0    2e-14   
ref|XP_004437662.1|  PREDICTED: N-terminal kinase-like protein is...  82.0    2e-14   
ref|XP_004478696.1|  PREDICTED: LOW QUALITY PROTEIN: N-terminal k...  82.0    2e-14   
ref|XP_008820407.1|  PREDICTED: N-terminal kinase-like protein        82.0    2e-14   
ref|XP_008034460.1|  ARM repeat-containing protein                    82.0    2e-14   
gb|EPQ67797.1|  hypothetical protein BGT96224_A20828                  82.0    2e-14   
ref|NP_065731.3|  N-terminal kinase-like protein isoform A            82.0    2e-14   
gb|EAW74395.1|  SCY1-like 1 (S. cerevisiae), isoform CRA_a            81.6    2e-14   
ref|XP_005274175.1|  PREDICTED: N-terminal kinase-like protein is...  81.6    2e-14   
ref|NP_001041683.1|  N-terminal kinase-like protein isoform B         81.6    2e-14   
ref|XP_002429107.1|  conserved hypothetical protein                   81.6    2e-14   
ref|XP_007652329.1|  PREDICTED: N-terminal kinase-like protein is...  81.6    2e-14   
ref|XP_005274178.1|  PREDICTED: N-terminal kinase-like protein is...  81.6    2e-14   
ref|XP_005274177.1|  PREDICTED: N-terminal kinase-like protein is...  81.6    2e-14   
ref|XP_003513951.1|  PREDICTED: N-terminal kinase-like protein is...  81.6    2e-14   
ref|XP_004073266.1|  PREDICTED: N-terminal kinase-like protein        81.6    2e-14   
ref|XP_004921861.1|  PREDICTED: N-terminal kinase-like protein-like   81.3    3e-14   
ref|XP_010362290.1|  PREDICTED: N-terminal kinase-like protein        81.3    3e-14   
ref|XP_003274053.2|  PREDICTED: N-terminal kinase-like protein        81.3    3e-14   
ref|XP_003029203.1|  hypothetical protein SCHCODRAFT_58873            81.3    3e-14   
ref|XP_011212646.1|  PREDICTED: N-terminal kinase-like protein is...  81.3    3e-14   
ref|XP_011212645.1|  PREDICTED: N-terminal kinase-like protein is...  81.3    3e-14   
gb|KIJ52672.1|  hypothetical protein M422DRAFT_156332                 80.9    3e-14   
ref|XP_005577330.1|  PREDICTED: N-terminal kinase-like protein is...  81.3    3e-14   
ref|XP_005577328.1|  PREDICTED: N-terminal kinase-like protein is...  81.3    3e-14   
ref|XP_005577329.1|  PREDICTED: N-terminal kinase-like protein is...  81.3    3e-14   
emb|CEP15877.1|  hypothetical protein                                 81.3    3e-14   
ref|XP_001113670.1|  PREDICTED: n-terminal kinase-like protein-li...  80.9    3e-14   
ref|XP_006818698.1|  PREDICTED: N-terminal kinase-like protein-like   81.3    3e-14   
gb|ELW65112.1|  hypothetical protein TREES_T100019408                 81.3    4e-14   
ref|XP_009183911.1|  PREDICTED: N-terminal kinase-like protein is...  81.3    4e-14   
ref|XP_003909622.1|  PREDICTED: N-terminal kinase-like protein is...  81.3    4e-14   
ref|XP_005577331.1|  PREDICTED: N-terminal kinase-like protein is...  80.9    4e-14   
ref|XP_006150004.1|  PREDICTED: N-terminal kinase-like protein        80.9    4e-14   
ref|XP_003468278.1|  PREDICTED: N-terminal kinase-like protein is...  80.9    4e-14   
emb|CEL58870.1|  N-terminal kinase-like protein OS=Bos taurus GN=...  80.9    4e-14   
ref|XP_003468279.1|  PREDICTED: N-terminal kinase-like protein is...  80.9    4e-14   
ref|XP_001113724.1|  PREDICTED: n-terminal kinase-like protein-li...  80.9    4e-14   
ref|XP_001113697.1|  PREDICTED: n-terminal kinase-like protein-li...  80.9    4e-14   
ref|XP_005003033.1|  PREDICTED: N-terminal kinase-like protein is...  80.9    4e-14   
ref|XP_009421749.1|  PREDICTED: N-terminal kinase-like protein        80.5    5e-14   
ref|XP_006460920.1|  hypothetical protein AGABI2DRAFT_69620           80.1    5e-14   
ref|XP_007327988.1|  hypothetical protein AGABI1DRAFT_36828           80.1    5e-14   
gb|EHJ67207.1|  hypothetical protein KGM_08511                        80.5    5e-14   
ref|XP_011049096.1|  PREDICTED: N-terminal kinase-like protein        80.5    6e-14   
gb|KIM79022.1|  hypothetical protein PILCRDRAFT_823885                80.5    6e-14   
ref|XP_001625668.1|  predicted protein                                80.1    6e-14   
ref|XP_007502790.1|  PREDICTED: N-terminal kinase-like protein        80.5    6e-14   
gb|KFO28409.1|  N-terminal kinase-like protein                        80.1    7e-14   
ref|XP_010634481.1|  PREDICTED: N-terminal kinase-like protein        80.1    8e-14   
dbj|GAN07476.1|  HEAT repeat containing protein                       80.1    8e-14   
gb|KIK09338.1|  hypothetical protein K443DRAFT_83149                  79.3    1e-13   
ref|XP_003707357.1|  PREDICTED: N-terminal kinase-like protein-like   79.7    1e-13   
gb|KIY71145.1|  ARM repeat-containing protein                         79.3    1e-13   
ref|XP_011352268.1|  PREDICTED: N-terminal kinase-like protein        79.3    1e-13   
gb|KIL96329.1|  hypothetical protein FAVG1_01073                      79.3    1e-13   
gb|ESA03952.1|  hypothetical protein GLOINDRAFT_237352                79.0    1e-13   
gb|EPB84957.1|  SCY1 protein kinase                                   79.0    2e-13   
gb|EXX67788.1|  Cex1p                                                 79.0    2e-13   
ref|NP_001016149.1|  N-terminal kinase-like protein                   79.0    2e-13   
gb|KGO77200.1|  Armadillo-like helical                                79.0    2e-13   
ref|XP_002098544.1|  GE23880                                          79.0    2e-13   
ref|XP_001981316.1|  GG11691                                          79.0    2e-13   
ref|NP_651722.1|  yata, isoform A                                     78.6    2e-13   
gb|KHJ30688.1|  putative protein kinase                               78.6    2e-13   
ref|XP_002105388.1|  GD21461                                          78.6    2e-13   
ref|XP_001964779.1|  GF23372                                          78.6    3e-13   
ref|XP_002012829.1|  GL23718                                          78.6    3e-13   
ref|XP_008177909.1|  PREDICTED: N-terminal kinase-like protein is...  78.6    3e-13   
ref|XP_009010861.1|  hypothetical protein HELRODRAFT_72072            78.2    3e-13   
ref|XP_006033270.1|  PREDICTED: N-terminal kinase-like protein        78.2    3e-13   
ref|XP_008207717.1|  PREDICTED: N-terminal kinase-like protein is...  78.2    3e-13   
ref|XP_008207719.1|  PREDICTED: N-terminal kinase-like protein is...  78.2    3e-13   
ref|XP_008707360.1|  PREDICTED: N-terminal kinase-like protein        78.2    4e-13   
ref|XP_006271048.1|  PREDICTED: N-terminal kinase-like protein-like   78.2    4e-13   
ref|XP_007092130.1|  PREDICTED: LOW QUALITY PROTEIN: N-terminal k...  78.2    4e-13   
ref|XP_011260365.1|  PREDICTED: N-terminal kinase-like protein        78.2    4e-13   
gb|ELK24342.1|  N-terminal kinase-like protein                        77.8    4e-13   
ref|XP_003489186.1|  PREDICTED: N-terminal kinase-like protein-like   77.8    4e-13   
gb|KIK80178.1|  hypothetical protein PAXRUDRAFT_245973                77.4    4e-13   
ref|XP_003395829.1|  PREDICTED: n-terminal kinase-like protein-like   77.8    4e-13   
ref|XP_001880447.1|  predicted protein                                77.4    5e-13   
ref|XP_007513571.1|  predicted protein                                77.4    5e-13   
ref|XP_011137884.1|  PREDICTED: N-terminal kinase-like protein        77.4    5e-13   
ref|XP_007834063.1|  hypothetical protein PFICI_07291                 77.4    6e-13   
gb|EFZ14003.1|  hypothetical protein SINV_14974                       77.4    6e-13   
ref|XP_011166123.1|  PREDICTED: N-terminal kinase-like protein        77.4    6e-13   
ref|XP_007819086.1|  protein kinase domain-containing protein ppk3    77.4    6e-13   
gb|KID87229.1|  protein kinase-like protein                           77.4    7e-13   
gb|KFG83858.1|  protein kinase-like protein                           77.4    7e-13   
ref|XP_002055897.1|  GJ10638                                          77.4    7e-13   
ref|XP_001996132.1|  GH14327                                          77.0    7e-13   
ref|XP_004523320.1|  PREDICTED: N-terminal kinase-like protein-li...  77.0    7e-13   
ref|XP_004523319.1|  PREDICTED: N-terminal kinase-like protein-li...  77.0    8e-13   
ref|XP_004363780.1|  telomerase regulation-associated protein         77.0    8e-13   
ref|XP_007984754.1|  PREDICTED: N-terminal kinase-like protein is...  77.0    8e-13   
emb|CDH52972.1|  protein kinase family protein                        77.0    9e-13   
ref|XP_007984799.1|  PREDICTED: N-terminal kinase-like protein is...  77.0    9e-13   
emb|CCA73691.1|  hypothetical protein PIIN_07644                      76.3    9e-13   
gb|KDR75324.1|  hypothetical protein GALMADRAFT_226987                76.6    9e-13   
ref|XP_011385096.1|  PREDICTED: N-terminal kinase-like protein        73.9    9e-13   
ref|XP_005864518.1|  PREDICTED: N-terminal kinase-like protein        76.6    1e-12   
gb|EPQ06525.1|  N-terminal kinase-like protein                        76.6    1e-12   
gb|KFY46052.1|  hypothetical protein V495_02692                       76.6    1e-12   
ref|XP_006136658.1|  PREDICTED: N-terminal kinase-like protein-like   76.6    1e-12   
ref|XP_002070191.1|  GK11922                                          76.6    1e-12   
gb|KID98782.1|  protein kinase-like protein                           76.3    1e-12   
ref|XP_011500938.1|  PREDICTED: N-terminal kinase-like protein        76.3    1e-12   
dbj|GAA94475.1|  hypothetical protein E5Q_01127                       76.6    1e-12   
ref|XP_011433332.1|  PREDICTED: N-terminal kinase-like protein is...  76.6    1e-12   
ref|XP_007688521.1|  hypothetical protein COCMIDRAFT_26796            76.3    1e-12   
gb|KIK39904.1|  hypothetical protein CY34DRAFT_88347                  75.9    1e-12   
gb|EAS31622.2|  SCY1 protein kinase                                   76.3    1e-12   
emb|CCT68465.1|  probable protein kinase family protein               76.3    2e-12   
ref|XP_008021082.1|  hypothetical protein SETTUDRAFT_162652           76.3    2e-12   
emb|CEJ82487.1|  Putative Protein kinase-like protein                 75.9    2e-12   
gb|EWY90523.1|  SCY1 protein kinase                                   75.9    2e-12   
gb|EMT63410.1|  Putative inactive serine/threonine-protein kinase...  75.9    2e-12   
ref|XP_002166845.2|  PREDICTED: N-terminal kinase-like protein-like   75.9    2e-12   
ref|XP_647112.1|  N-terminal kinase-like  protein                     75.9    2e-12   
gb|EXM01863.1|  SCY1 protein kinase                                   75.9    2e-12   
gb|KIL68885.1|  hypothetical protein M378DRAFT_21792                  76.3    2e-12   
gb|EFX80099.1|  hypothetical protein DAPPUDRAFT_212197                75.9    2e-12   
gb|ENH62406.1|  Putative inactive serine/threonine-protein kinase...  75.9    2e-12   
ref|XP_004996885.1|  SCY1 protein kinase                              75.9    2e-12   
gb|EXK39177.1|  SCY1 protein kinase                                   75.9    2e-12   
gb|KHN96916.1|  protein kinase-like protein                           75.9    2e-12   
gb|EXA44712.1|  SCY1 protein kinase                                   75.9    2e-12   
ref|XP_006771770.1|  PREDICTED: N-terminal kinase-like protein        75.9    2e-12   
ref|XP_006666800.1|  protein kinase                                   75.9    2e-12   
gb|EWZ37137.1|  SCY1 protein kinase                                   75.9    2e-12   
ref|XP_001845342.1|  conserved hypothetical protein                   72.0    2e-12   
ref|XP_002585108.1|  conserved hypothetical protein                   75.9    2e-12   
gb|EYE92479.1|  kinase family protein                                 75.5    2e-12   
gb|KFH41094.1|  inactive serine/threonine-protein kinase-like pro...  75.5    2e-12   
emb|CEG05275.1|  unnamed protein product                              75.1    2e-12   
ref|XP_007849678.1|  protein kinase                                   75.5    2e-12   
ref|XP_003070248.1|  HEAT repeat containing protein                   75.5    2e-12   
gb|EYB25823.1|  hypothetical protein FG05_10196                       75.5    2e-12   
gb|EFW23270.1|  protein kinase                                        75.5    2e-12   
ref|XP_003050812.1|  predicted protein                                75.5    2e-12   
ref|XP_009255071.1|  hypothetical protein FPSE_03677                  75.5    3e-12   
ref|XP_006911383.1|  PREDICTED: N-terminal kinase-like protein        75.5    3e-12   
ref|XP_001795700.1|  hypothetical protein SNOG_05293                  75.5    3e-12   
ref|XP_011433331.1|  PREDICTED: N-terminal kinase-like protein is...  75.5    3e-12   
ref|XP_011433330.1|  PREDICTED: N-terminal kinase-like protein is...  75.5    3e-12   
gb|EWG40579.1|  SCY1 protein kinase                                   75.5    3e-12   
gb|KIY53084.1|  ARM repeat-containing protein                         75.1    3e-12   
gb|ELK13348.1|  N-terminal kinase-like protein                        75.5    3e-12   
gb|KFX50904.1|  putative inactive serine/threonine-protein kinase...  75.1    3e-12   
ref|XP_002037241.1|  GM12817                                          75.1    3e-12   
ref|XP_002144171.1|  protein kinase family protein                    75.1    3e-12   
ref|XP_003715511.1|  SCY1 protein kinase                              75.1    3e-12   
gb|EFX80097.1|  hypothetical protein DAPPUDRAFT_318961                72.0    3e-12   
ref|XP_002000790.1|  GI10423                                          75.1    4e-12   
gb|KFY63850.1|  hypothetical protein V496_03636                       75.1    4e-12   
gb|KFX95553.1|  hypothetical protein V490_03782                       74.7    4e-12   
gb|KIW05243.1|  hypothetical protein PV09_03779                       74.7    4e-12   
gb|KFY89791.1|  hypothetical protein V500_05490                       74.7    4e-12   
gb|EUN29160.1|  hypothetical protein COCVIDRAFT_93700                 74.7    4e-12   
gb|KFZ19073.1|  hypothetical protein V502_03858                       74.7    4e-12   
gb|KFY27911.1|  hypothetical protein V493_03238                       74.7    4e-12   
ref|XP_007717643.1|  hypothetical protein COCCADRAFT_9508             74.7    4e-12   
emb|CBJ33351.1|  conserved unknown protein                            74.7    4e-12   
gb|EMD96570.1|  hypothetical protein COCHEDRAFT_1189592               74.7    5e-12   
ref|XP_007675287.1|  hypothetical protein BAUCODRAFT_33274            74.7    5e-12   
ref|XP_007696000.1|  hypothetical protein COCSADRAFT_167623           74.7    5e-12   
emb|CCE28247.1|  uncharacterized protein CPUR_01721                   74.7    5e-12   
emb|CCD49657.1|  similar to kinase family protein                     74.7    5e-12   
ref|XP_003835618.1|  hypothetical protein LEMA_P049590.1              74.7    5e-12   
emb|CCO29747.1|  N-terminal kinase-like protein AltName: Full=SCY...  74.7    5e-12   
gb|KGO38613.1|  Armadillo-like helical                                74.3    5e-12   
gb|EMR86933.1|  putative protein kinase protein                       74.3    5e-12   
gb|EGU12491.1|  Other/SCY1 protein kinase                             74.7    5e-12   
gb|KIK68879.1|  hypothetical protein GYMLUDRAFT_153091                73.9    6e-12   
ref|XP_007943160.1|  PREDICTED: N-terminal kinase-like protein        74.3    6e-12   
gb|KFY43513.1|  hypothetical protein V494_01951                       74.3    6e-12   
ref|XP_008719559.1|  hypothetical protein HMPREF1541_07012            74.3    6e-12   
gb|EQB77728.1|  N-terminal kinase-like protein isoform B              74.3    6e-12   



>gb|KGN58426.1| hypothetical protein Csa_3G642670 [Cucumis sativus]
Length=301

 Score =   243 bits (619),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G+ DLPY    PY SAWGSW H+RGTSKDDG+PVSIF+LSGSNA D
Sbjct  1    MFKFLKGVVGGSGTGLKDLPYNIGDPYPSAWGSWTHFRGTSKDDGSPVSIFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE ET+DGS +KVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAETIDGSASKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH++ KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQVAKAVSFLNND  147



>ref|XP_009798482.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Nicotiana sylvestris]
Length=804

 Score =   255 bits (652),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G+ DLPY    PYSSAWGSWVHYRGTSKDDG PVSIFAL+GSNAND
Sbjct  1    MFKFLKGVVGGSGTGLKDLPYNIGKPYSSAWGSWVHYRGTSKDDGTPVSIFALTGSNAND  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E  DGSTTKVTIYIVTEPVMPL EKLKELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAENFDGSTTKVTIYIVTEPVMPLSEKLKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLHRI KAVSFLNND
Sbjct  121  LKGTQRDEYYAWGLHRIAKAVSFLNND  147



>ref|XP_009798481.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Nicotiana sylvestris]
Length=818

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G+ DLPY    PYSSAWGSWVHYRGTSKDDG PVSIFAL+GSNAND
Sbjct  1    MFKFLKGVVGGSGTGLKDLPYNIGKPYSSAWGSWVHYRGTSKDDGTPVSIFALTGSNAND  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E  DGSTTKVTIYIVTEPVMPL EKLKELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAENFDGSTTKVTIYIVTEPVMPLSEKLKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLHRI KAVSFLNND
Sbjct  121  LKGTQRDEYYAWGLHRIAKAVSFLNND  147



>ref|XP_011076582.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Sesamum indicum]
Length=818

 Score =   255 bits (651),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFLKGVV GSG GV DLPY    PY+SAWGSWVHYRGTSKDDGAPVSIF+LSGSNAND
Sbjct  1    MLKFLKGVVGGSGTGVKDLPYNIGEPYASAWGSWVHYRGTSKDDGAPVSIFSLSGSNAND  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHL AGRNGVKRLRTVRHPNILSFLHSTEVET+DGS+ KVTIY+VTEPVMPL EK+KELG
Sbjct  61   GHLVAGRNGVKRLRTVRHPNILSFLHSTEVETLDGSSAKVTIYMVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L G+QRDEYYAWGLHRI KAVSFLNND
Sbjct  121  LEGSQRDEYYAWGLHRIAKAVSFLNND  147



>ref|XP_011076581.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Sesamum indicum]
Length=820

 Score =   255 bits (651),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFLKGVV GSG GV DLPY    PY+SAWGSWVHYRGTSKDDGAPVSIF+LSGSNAND
Sbjct  1    MLKFLKGVVGGSGTGVKDLPYNIGEPYASAWGSWVHYRGTSKDDGAPVSIFSLSGSNAND  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHL AGRNGVKRLRTVRHPNILSFLHSTEVET+DGS+ KVTIY+VTEPVMPL EK+KELG
Sbjct  61   GHLVAGRNGVKRLRTVRHPNILSFLHSTEVETLDGSSAKVTIYMVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L G+QRDEYYAWGLHRI KAVSFLNND
Sbjct  121  LEGSQRDEYYAWGLHRIAKAVSFLNND  147



>gb|EYU20126.1| hypothetical protein MIMGU_mgv1a001437mg [Erythranthe guttata]
Length=820

 Score =   254 bits (649),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFLKGVVAGSGAG+ DLPY    PYSSAWGSWVH+RGTSKDDGAPVSIF+LSGSNAND
Sbjct  1    MLKFLKGVVAGSGAGLKDLPYNIGEPYSSAWGSWVHHRGTSKDDGAPVSIFSLSGSNAND  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHL AGRNGVKRLRTVRHPNILSFLHSTE ET+DG++TKVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLVAGRNGVKRLRTVRHPNILSFLHSTEAETLDGNSTKVTIYIVTEPVMPLAEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L G+QRDEYYAWGLHRI KAVSFLNND
Sbjct  121  LEGSQRDEYYAWGLHRIAKAVSFLNND  147



>ref|XP_009779914.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Nicotiana sylvestris]
Length=818

 Score =   253 bits (645),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M  FLKGVV+GSG G+ DLPY    PYSSAWGSWVHYRGTSKDDG PVSIFALSGSN ND
Sbjct  1    MFNFLKGVVSGSGTGLKDLPYNIGEPYSSAWGSWVHYRGTSKDDGTPVSIFALSGSNTND  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E  DGSTTKVTIYIVTEPVMPL EKLKELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAENFDGSTTKVTIYIVTEPVMPLSEKLKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLHRI KAVSFLNND
Sbjct  121  LKGTQRDEYYAWGLHRIAKAVSFLNND  147



>ref|XP_009779913.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Nicotiana sylvestris]
Length=820

 Score =   253 bits (645),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M  FLKGVV+GSG G+ DLPY    PYSSAWGSWVHYRGTSKDDG PVSIFALSGSN ND
Sbjct  1    MFNFLKGVVSGSGTGLKDLPYNIGEPYSSAWGSWVHYRGTSKDDGTPVSIFALSGSNTND  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E  DGSTTKVTIYIVTEPVMPL EKLKELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAENFDGSTTKVTIYIVTEPVMPLSEKLKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLHRI KAVSFLNND
Sbjct  121  LKGTQRDEYYAWGLHRIAKAVSFLNND  147



>ref|XP_009623483.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Nicotiana tomentosiformis]
Length=817

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G+ DLPY    PYSSAWGSWVH RGTSKDDG PVSIFAL+GSNAND
Sbjct  1    MFKFLKGVVGGSGTGLKDLPYNIGEPYSSAWGSWVHCRGTSKDDGTPVSIFALTGSNAND  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E  DGSTTKVTIYIVTEPVMPL EKLKELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAENFDGSTTKVTIYIVTEPVMPLSEKLKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLHRI KAVSFLNND
Sbjct  121  LKGTQRDEYYAWGLHRIAKAVSFLNND  147



>ref|XP_009623482.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Nicotiana tomentosiformis]
Length=819

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G+ DLPY    PYSSAWGSWVH RGTSKDDG PVSIFAL+GSNAND
Sbjct  1    MFKFLKGVVGGSGTGLKDLPYNIGEPYSSAWGSWVHCRGTSKDDGTPVSIFALTGSNAND  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E  DGSTTKVTIYIVTEPVMPL EKLKELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAENFDGSTTKVTIYIVTEPVMPLSEKLKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLHRI KAVSFLNND
Sbjct  121  LKGTQRDEYYAWGLHRIAKAVSFLNND  147



>ref|XP_009590238.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Nicotiana tomentosiformis]
Length=820

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M  FLKGVV+GSG G+ DLPY    PYSSAWGSWVHYRGTSKDDG PVSIFALSGSN ND
Sbjct  1    MFNFLKGVVSGSGTGLKDLPYSIGEPYSSAWGSWVHYRGTSKDDGTPVSIFALSGSNTND  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E  DGSTTKV IYIVTEPVMPL EKLKELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAENFDGSTTKVIIYIVTEPVMPLSEKLKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLHRI KAVSFLNND
Sbjct  121  LKGTQRDEYYAWGLHRIAKAVSFLNND  147



>ref|XP_009590239.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Nicotiana tomentosiformis]
Length=818

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M  FLKGVV+GSG G+ DLPY    PYSSAWGSWVHYRGTSKDDG PVSIFALSGSN ND
Sbjct  1    MFNFLKGVVSGSGTGLKDLPYSIGEPYSSAWGSWVHYRGTSKDDGTPVSIFALSGSNTND  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E  DGSTTKV IYIVTEPVMPL EKLKELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAENFDGSTTKVIIYIVTEPVMPLSEKLKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLHRI KAVSFLNND
Sbjct  121  LKGTQRDEYYAWGLHRIAKAVSFLNND  147



>ref|XP_010322119.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Solanum lycopersicum]
Length=820

 Score =   250 bits (638),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G+ DLPY    PYS AWGSWVHYRGTSKDDGAPVSIFAL+G NAND
Sbjct  1    MFKFLKGVVGGSGTGLKDLPYNIGEPYSIAWGSWVHYRGTSKDDGAPVSIFALTGCNAND  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFL+STE ET DGSTTKVTIYIVTEPVMPL EKLKELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLYSTEAETFDGSTTKVTIYIVTEPVMPLSEKLKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L G QRDEYYAWGLHRI KAVSFLNND
Sbjct  121  LKGNQRDEYYAWGLHRIAKAVSFLNND  147



>ref|XP_002280870.1| PREDICTED: N-terminal kinase-like protein [Vitis vinifera]
 emb|CBI25347.3| unnamed protein product [Vitis vinifera]
Length=794

 Score =   249 bits (636),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFLKGVVAGSGAG+ DLPY    PYSSAWGSW H RGTSKDDG+PVSIF+LSGSNA D
Sbjct  1    MLKFLKGVVAGSGAGLKDLPYNIGEPYSSAWGSWTHSRGTSKDDGSPVSIFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE ET DGS+TKVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAETFDGSSTKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>ref|XP_002520873.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF41582.1| ATP binding protein, putative [Ricinus communis]
Length=792

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFLKGVV GSG GV DLPY    PY SAWGSW H+RGTSKDDG+PVS+F+LSGSNA D
Sbjct  1    MLKFLKGVVGGSGTGVKDLPYNIGEPYPSAWGSWTHHRGTSKDDGSPVSVFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTEVET DGST+KVTIY+VTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETFDGSTSKVTIYMVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>ref|XP_006365332.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like [Solanum tuberosum]
Length=818

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            ML FLKGVV+GSG G+ DLPY    PYSSAWGSW+HYRGTSKDDG PVS+FALSGS+ ND
Sbjct  1    MLNFLKGVVSGSGTGLKDLPYNIGEPYSSAWGSWIHYRGTSKDDGTPVSVFALSGSSTND  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E  DGST KVTIYIVTEPVMPL EKLKELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAENFDGSTAKVTIYIVTEPVMPLSEKLKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLHRI KAVSFLNND
Sbjct  121  LKGTQRDEYYAWGLHRIAKAVSFLNND  147



>ref|XP_010321457.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 [Solanum lycopersicum]
Length=818

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            ML FLKGVV+GSG G+ DLPY    PYSSAWGSW+HYRGTSKDDG PVS+FALSGS+ ND
Sbjct  1    MLNFLKGVVSGSGTGLKDLPYNIGEPYSSAWGSWIHYRGTSKDDGTPVSVFALSGSSTND  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E  DGS+ KVTIYIVTEPVMPL EKLKELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAENFDGSSAKVTIYIVTEPVMPLAEKLKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLHRI KAVSFLNND
Sbjct  121  LKGTQRDEYYAWGLHRIAKAVSFLNND  147



>gb|KEH42951.1| ARM repeat kinase family protein [Medicago truncatula]
Length=200

 Score =   231 bits (590),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KF K  V  + AG+ DLPY    PYSSAWGSW+H+RGTSKDDG+PVSIF+L+GSNA D
Sbjct  1    MFKFFKDFVGVTVAGLNDLPYTIGEPYSSAWGSWLHHRGTSKDDGSPVSIFSLAGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLR VRHPNILSFLHSTE+ET DG ++KVTIYIVTEP MPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRAVRHPNILSFLHSTEIETFDGGSSKVTIYIVTEPAMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L G QRDEYYA GLH+I KAVSFLNND
Sbjct  121  LEGAQRDEYYARGLHQIAKAVSFLNND  147



>ref|XP_003638544.1| N-terminal kinase-like protein [Medicago truncatula]
Length=271

 Score =   233 bits (595),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VV GSG G+ DLPY    PY SAWGSW+H+RGTSKDDG+PVSIF+LSG+NA D
Sbjct  1    MFKFLKEVVGGSGTGLRDLPYNIGEPYPSAWGSWLHHRGTSKDDGSPVSIFSLSGTNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE+ET DG ++KVTIYIVTEPVMPL +K++ELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEIETFDGGSSKVTIYIVTEPVMPLSDKIQELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGL +I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLLQIAKAVSFLNND  147



>ref|XP_004144420.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like [Cucumis sativus]
 ref|XP_004160990.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like [Cucumis sativus]
Length=796

 Score =   246 bits (629),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G+ DLPY    PY SAWGSW H+RGTSKDDG+PVSIF+LSGSNA D
Sbjct  1    MFKFLKGVVGGSGTGLKDLPYNIGDPYPSAWGSWTHFRGTSKDDGSPVSIFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE ET+DGS +KVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAETIDGSASKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH++ KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQVAKAVSFLNND  147



>ref|XP_010252046.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Nelumbo nucifera]
Length=796

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVVAGSGAG+ DLPY    PYSSAWGSW HYRGTSKDDG+ VSIF+LSGSNA D
Sbjct  1    MFKFLKGVVAGSGAGIKDLPYNIGEPYSSAWGSWTHYRGTSKDDGSLVSIFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE ET DGS TKVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTETETFDGSITKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>ref|XP_010252047.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Nelumbo nucifera]
Length=794

 Score =   246 bits (628),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVVAGSGAG+ DLPY    PYSSAWGSW HYRGTSKDDG+ VSIF+LSGSNA D
Sbjct  1    MFKFLKGVVAGSGAGIKDLPYNIGEPYSSAWGSWTHYRGTSKDDGSLVSIFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE ET DGS TKVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTETETFDGSITKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>ref|XP_006589223.1| PREDICTED: N-terminal kinase-like protein-like isoform X1 [Glycine 
max]
Length=192

 Score =   229 bits (583),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VV+GSG G+ DLPY    PY+SAWGSW+H+RGTSKDDG+PV IF+LSGS A D
Sbjct  1    MFKFLKEVVSGSGTGLKDLPYNTGEPYASAWGSWLHFRGTSKDDGSPVPIFSLSGSKAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVK LRTVRHPNILSFLHSTE+ETVD  + KVTIY+VTEPVMP  +K+KEL 
Sbjct  61   GHLAAGRNGVKSLRTVRHPNILSFLHSTEIETVDAGSPKVTIYMVTEPVMPPLDKIKELS  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>gb|KJB60173.1| hypothetical protein B456_009G292700 [Gossypium raimondii]
 gb|KJB60174.1| hypothetical protein B456_009G292700 [Gossypium raimondii]
Length=858

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +2

Query  143  R*TMLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSN  322
            R  MLKFLKGVV GSGAG+ DLPY    PY SAWGSW H+RGTSKDDG+PVSIF+LSGSN
Sbjct  53   RKKMLKFLKGVVGGSGAGLKDLPYNIGDPYPSAWGSWSHFRGTSKDDGSPVSIFSLSGSN  112

Query  323  ANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLK  502
              DGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE+ DGS++KVTIYIVTEPVMPL EK+K
Sbjct  113  PQDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVESFDGSSSKVTIYIVTEPVMPLSEKIK  172

Query  503  ELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            ELGL GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  173  ELGLEGTQRDEYYAWGLHQIAKAVSFLNND  202



>ref|XP_008460279.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Cucumis melo]
Length=794

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G+ DLPY    PY SAWGSW H+RGTSKDDG+PVS+F+LSGSNA D
Sbjct  1    MFKFLKGVVGGSGTGLKDLPYNIGDPYPSAWGSWTHFRGTSKDDGSPVSVFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHS E ET+DGS +KVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSNEAETIDGSASKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH++ KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQVAKAVSFLNND  147



>ref|XP_004495542.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like isoform X2 [Cicer arietinum]
Length=793

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VV GSG G+ DLPY    PY SAWGSW+H+RGTSKDDG+PVSIF+LSGSNA D
Sbjct  1    MFKFLKEVVGGSGTGIKDLPYNIGEPYPSAWGSWLHHRGTSKDDGSPVSIFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE+ET DG ++KVTIYIVTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEIETFDGGSSKVTIYIVTEPVMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>ref|XP_004495541.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like isoform X1 [Cicer arietinum]
Length=794

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VV GSG G+ DLPY    PY SAWGSW+H+RGTSKDDG+PVSIF+LSGSNA D
Sbjct  1    MFKFLKEVVGGSGTGIKDLPYNIGEPYPSAWGSWLHHRGTSKDDGSPVSIFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE+ET DG ++KVTIYIVTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEIETFDGGSSKVTIYIVTEPVMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>ref|XP_008460276.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Cucumis melo]
 ref|XP_008460277.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Cucumis melo]
 ref|XP_008460278.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Cucumis melo]
Length=797

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G+ DLPY    PY SAWGSW H+RGTSKDDG+PVS+F+LSGSNA D
Sbjct  1    MFKFLKGVVGGSGTGLKDLPYNIGDPYPSAWGSWTHFRGTSKDDGSPVSVFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHS E ET+DGS +KVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSNEAETIDGSASKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH++ KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQVAKAVSFLNND  147



>ref|XP_010322118.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Solanum lycopersicum]
Length=824

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 131/151 (87%), Gaps = 4/151 (3%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G+ DLPY    PYS AWGSWVHYRGTSKDDGAPVSIFAL+G NAND
Sbjct  1    MFKFLKGVVGGSGTGLKDLPYNIGEPYSIAWGSWVHYRGTSKDDGAPVSIFALTGCNAND  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFL+STE ET DGSTTKVTIYIVTEPVMPL EKLKELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLYSTEAETFDGSTTKVTIYIVTEPVMPLSEKLKELG  120

Query  512  LVGTQ----RDEYYAWGLHRITKAVSFLNND  592
            L G Q    RDEYYAWGLHRI KAVSFLNND
Sbjct  121  LKGNQSICGRDEYYAWGLHRIAKAVSFLNND  151



>ref|XP_003556441.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like [Glycine max]
 gb|KHN04976.1| Putative inactive serine/threonine-protein kinase scy1 [Glycine 
soja]
Length=793

 Score =   243 bits (621),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VV+GSG G+ DLPY    PY+SAWGSW+H+RGTSKDDG+PVSIF+LSGSN+ D
Sbjct  1    MFKFLKEVVSGSGTGLKDLPYNIGEPYASAWGSWLHFRGTSKDDGSPVSIFSLSGSNSQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE+ETVD  + KVTIY+VTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEIETVDAGSPKVTIYMVTEPVMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>ref|XP_007143981.1| hypothetical protein PHAVU_007G118900g [Phaseolus vulgaris]
 gb|ESW15975.1| hypothetical protein PHAVU_007G118900g [Phaseolus vulgaris]
Length=793

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VVAGSG G+ DLPY    PY+SAWGSW+H+RG SKDDG+PVSIF+LSGSNA D
Sbjct  1    MFKFLKEVVAGSGTGLKDLPYNIGEPYASAWGSWLHFRGISKDDGSPVSIFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE+ETVD  + KVTIY+VTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEIETVDAGSPKVTIYMVTEPVMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>gb|KHN14780.1| N-terminal kinase-like protein [Glycine soja]
Length=274

 Score =   229 bits (583),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VV+GSG G+ DLPY    PY+SAWGSW+H+RGTSKDDG+PV IF+LSGS A D
Sbjct  1    MFKFLKEVVSGSGTGLKDLPYNTGEPYASAWGSWLHFRGTSKDDGSPVPIFSLSGSKAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVK LRTVRHPNILSFLHSTE+ETVD  + KVTIY+VTEPVMP  +K+KEL 
Sbjct  61   GHLAAGRNGVKSLRTVRHPNILSFLHSTEIETVDAGSPKVTIYMVTEPVMPPLDKIKELS  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>ref|XP_007011364.1| Kinase family protein with ARM repeat domain isoform 3 [Theobroma 
cacao]
 gb|EOY20174.1| Kinase family protein with ARM repeat domain isoform 3 [Theobroma 
cacao]
Length=584

 Score =   237 bits (605),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G+ DLPY    PY SAWGSW H RGTSKDDG+ VSIF+LSGSN  D
Sbjct  1    MFKFLKGVVGGSGTGLKDLPYNIGDPYPSAWGSWSHSRGTSKDDGSSVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTEVE +DGS+TK TIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEVEALDGSSTKFTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>gb|KDO67547.1| hypothetical protein CISIN_1g0040251mg, partial [Citrus sinensis]
 gb|KDO67548.1| hypothetical protein CISIN_1g0040251mg, partial [Citrus sinensis]
Length=433

 Score =   233 bits (594),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSGAGV DLPY    PY SAWGSW H++GTSKDDG+PVSIF++SG+NA D
Sbjct  1    MFKFLKGVVGGSGAGVKDLPYNIGDPYPSAWGSWSHFQGTSKDDGSPVSIFSISGTNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAA RNGVKRLRTVRHPNIL+FLHSTEVE +D ++TK+TIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAARNGVKRLRTVRHPNILAFLHSTEVENIDATSTKITIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L G+QRDEYYAWGL++I KAVSFLNND
Sbjct  121  LEGSQRDEYYAWGLNQIAKAVSFLNND  147



>gb|KDP21639.1| hypothetical protein JCGZ_03310 [Jatropha curcas]
Length=799

 Score =   241 bits (614),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVVAGSGAG+ DLPY    PY SAWGSW H+RGTSKDDG+PVSIF+LSGSNA D
Sbjct  1    MFKFLKGVVAGSGAGLKDLPYNIGEPYPSAWGSWTHHRGTSKDDGSPVSIFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFL+STEVET DGS +++T+Y+VTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLYSTEVETFDGSASRITLYMVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>gb|KEH27103.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=633

 Score =   238 bits (606),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VV GSG G+ DLPY    PY SAWGSW+H+RGTSKDDG+PVSIF+LSG+NA D
Sbjct  1    MFKFLKEVVGGSGTGLRDLPYNIGEPYPSAWGSWLHHRGTSKDDGSPVSIFSLSGTNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE+ET DG ++KVTIYIVTEPVMPL +K++ELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEIETFDGGSSKVTIYIVTEPVMPLSDKIQELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGL +I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLLQIAKAVSFLNND  147



>gb|KDO67549.1| hypothetical protein CISIN_1g0040251mg, partial [Citrus sinensis]
Length=440

 Score =   233 bits (594),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSGAGV DLPY    PY SAWGSW H++GTSKDDG+PVSIF++SG+NA D
Sbjct  1    MFKFLKGVVGGSGAGVKDLPYNIGDPYPSAWGSWSHFQGTSKDDGSPVSIFSISGTNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAA RNGVKRLRTVRHPNIL+FLHSTEVE +D ++TK+TIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAARNGVKRLRTVRHPNILAFLHSTEVENIDATSTKITIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L G+QRDEYYAWGL++I KAVSFLNND
Sbjct  121  LEGSQRDEYYAWGLNQIAKAVSFLNND  147



>ref|XP_010031074.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Eucalyptus grandis]
 gb|KCW50336.1| hypothetical protein EUGRSUZ_J00108 [Eucalyptus grandis]
Length=801

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFLKGVV GSG GV DLPY    PYSSAWGSW+H RGTSKDDG+PVSIF+LSG+N  D
Sbjct  1    MLKFLKGVVGGSGTGVKDLPYNIGEPYSSAWGSWLHCRGTSKDDGSPVSIFSLSGNNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E  DG+T KVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAEVSDGATMKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGL++I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLNQIAKAVSFLNND  147



>ref|XP_010031075.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Eucalyptus grandis]
Length=799

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFLKGVV GSG GV DLPY    PYSSAWGSW+H RGTSKDDG+PVSIF+LSG+N  D
Sbjct  1    MLKFLKGVVGGSGTGVKDLPYNIGEPYSSAWGSWLHCRGTSKDDGSPVSIFSLSGNNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E  DG+T KVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAEVSDGATMKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGL++I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLNQIAKAVSFLNND  147



>ref|XP_010031076.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X3 [Eucalyptus grandis]
Length=798

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFLKGVV GSG GV DLPY    PYSSAWGSW+H RGTSKDDG+PVSIF+LSG+N  D
Sbjct  1    MLKFLKGVVGGSGTGVKDLPYNIGEPYSSAWGSWLHCRGTSKDDGSPVSIFSLSGNNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E  DG+T KVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAEVSDGATMKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGL++I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLNQIAKAVSFLNND  147



>gb|KCW50335.1| hypothetical protein EUGRSUZ_J00108 [Eucalyptus grandis]
Length=775

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFLKGVV GSG GV DLPY    PYSSAWGSW+H RGTSKDDG+PVSIF+LSG+N  D
Sbjct  1    MLKFLKGVVGGSGTGVKDLPYNIGEPYSSAWGSWLHCRGTSKDDGSPVSIFSLSGNNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E  DG+T KVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAEVSDGATMKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGL++I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLNQIAKAVSFLNND  147



>ref|NP_181605.2| cytoplasmic tRNA export protein [Arabidopsis thaliana]
 gb|AEC09869.1| cytoplasmic tRNA export protein [Arabidopsis thaliana]
Length=798

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVVAGSG G+ DLPY    PY SAWGSW H+RGTSKDDG+PVSIFALSG+NA D
Sbjct  1    MFKFLKGVVAGSGTGLKDLPYNIGDPYPSAWGSWSHFRGTSKDDGSPVSIFALSGNNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTEVET DGSTTKVTIYIVTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETHDGSTTKVTIYIVTEPVMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L  TQRDEY+A GLH+I KAVSFLNND
Sbjct  121  LKATQRDEYFALGLHQIGKAVSFLNND  147



>dbj|BAF02142.1| hypothetical protein [Arabidopsis thaliana]
Length=798

 Score =   238 bits (607),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVVAGSG G+ DLPY    PY SAWGSW H+RGTSKDDG+PVSIFALSG+NA D
Sbjct  1    MFKFLKGVVAGSGTGLKDLPYNIGDPYPSAWGSWSHFRGTSKDDGSPVSIFALSGNNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTEVET DGSTTKVTIYIVTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETHDGSTTKVTIYIVTEPVMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L  TQRDEY+A GLH+I KAVSFLNND
Sbjct  121  LKATQRDEYFALGLHQIGKAVSFLNND  147



>ref|XP_002881735.1| heat repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57994.1| heat repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=798

 Score =   238 bits (607),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVVAGSG G+ DLPY    PY SAWGSW H+RGTSKDDG+PVSIFALSG+NA D
Sbjct  1    MFKFLKGVVAGSGTGLKDLPYNIGDPYPSAWGSWSHFRGTSKDDGSPVSIFALSGNNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTEVET DGSTTKVTIYIVTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETHDGSTTKVTIYIVTEPVMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L  TQRDEY+A GLH+I KAVSFLNND
Sbjct  121  LKATQRDEYFALGLHQIGKAVSFLNND  147



>ref|XP_010554724.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 [Tarenaya hassleriana]
Length=801

 Score =   238 bits (606),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G+ DLPY    PY S+WGSW H+RGTSKDDG+PVSIFALS SNA D
Sbjct  1    MFKFLKGVVGGSGTGLKDLPYNIGDPYPSSWGSWSHFRGTSKDDGSPVSIFALSSSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE+ET DGS TKVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEIETHDGSATKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+A GLH+I KAVSFLNND
Sbjct  121  LKGTQRDEYFALGLHQIAKAVSFLNND  147



>gb|KEH27102.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=798

 Score =   238 bits (606),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VV GSG G+ DLPY    PY SAWGSW+H+RGTSKDDG+PVSIF+LSG+NA D
Sbjct  1    MFKFLKEVVGGSGTGLRDLPYNIGEPYPSAWGSWLHHRGTSKDDGSPVSIFSLSGTNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE+ET DG ++KVTIYIVTEPVMPL +K++ELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEIETFDGGSSKVTIYIVTEPVMPLSDKIQELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGL +I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLLQIAKAVSFLNND  147



>ref|XP_007011362.1| Kinase family protein with ARM repeat domain isoform 1 [Theobroma 
cacao]
 gb|EOY20172.1| Kinase family protein with ARM repeat domain isoform 1 [Theobroma 
cacao]
Length=802

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G+ DLPY    PY SAWGSW H RGTSKDDG+ VSIF+LSGSN  D
Sbjct  1    MFKFLKGVVGGSGTGLKDLPYNIGDPYPSAWGSWSHSRGTSKDDGSSVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTEVE +DGS+TK TIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEVEALDGSSTKFTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>ref|XP_007011363.1| Kinase family protein with ARM repeat domain isoform 2 [Theobroma 
cacao]
 gb|EOY20173.1| Kinase family protein with ARM repeat domain isoform 2 [Theobroma 
cacao]
Length=803

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G+ DLPY    PY SAWGSW H RGTSKDDG+ VSIF+LSGSN  D
Sbjct  1    MFKFLKGVVGGSGTGLKDLPYNIGDPYPSAWGSWSHSRGTSKDDGSSVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTEVE +DGS+TK TIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEVEALDGSSTKFTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>ref|XP_007225258.1| hypothetical protein PRUPE_ppa001574mg [Prunus persica]
 gb|EMJ26457.1| hypothetical protein PRUPE_ppa001574mg [Prunus persica]
Length=800

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFLKGVV GSG G  DLPY    PY SAWGSW H+RGTSKDDG+PVS+F++SGSNA D
Sbjct  1    MLKFLKGVVGGSGTGPKDLPYNIGEPYPSAWGSWTHFRGTSKDDGSPVSVFSISGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAA RNGVKRLRTVRHPNILSFLHSTE ET+D STTK TIYIVTEPVMPL EK+KEL 
Sbjct  61   GHLAAARNGVKRLRTVRHPNILSFLHSTEAETLDASTTKQTIYIVTEPVMPLSEKIKELS  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L G QRDEY+AWGLH+I KAVSFLNND
Sbjct  121  LQGIQRDEYFAWGLHQIAKAVSFLNND  147



>ref|XP_006293704.1| hypothetical protein CARUB_v10022662mg [Capsella rubella]
 gb|EOA26602.1| hypothetical protein CARUB_v10022662mg [Capsella rubella]
Length=798

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVVAGSG G+ DLPY    PY SAWGSW H+RGTSKDDG+PVSIFALSG+NA D
Sbjct  1    MFKFLKGVVAGSGTGLKDLPYNIGDPYPSAWGSWSHFRGTSKDDGSPVSIFALSGNNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTEVET DGST+KVTIYIVTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETHDGSTSKVTIYIVTEPVMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L  TQRDEY+A GLH+I KAVSFLNND
Sbjct  121  LKATQRDEYFALGLHQIGKAVSFLNND  147



>ref|XP_010517510.1| PREDICTED: N-terminal kinase-like protein [Camelina sativa]
Length=797

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVVAGSG G+ DLPY    PY SAWGSW H+RGTSKDDG+PVSIFALSG+NA D
Sbjct  1    MFKFLKGVVAGSGTGLKDLPYNIGDPYPSAWGSWSHFRGTSKDDGSPVSIFALSGNNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTEVET DGST+KVTIYIVTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETHDGSTSKVTIYIVTEPVMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L  TQRDEY+A GLH+I KAVSFLNND
Sbjct  121  LKATQRDEYFALGLHQIGKAVSFLNND  147



>ref|XP_010505824.1| PREDICTED: N-terminal kinase-like protein [Camelina sativa]
Length=798

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVVAGSG G+ DLPY    PY SAWGSW H+RGTSKDDG+PVSIFALSG+NA D
Sbjct  1    MFKFLKGVVAGSGTGLKDLPYNIGDPYPSAWGSWSHFRGTSKDDGSPVSIFALSGNNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTEVET DGST+KVTIYIVTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETHDGSTSKVTIYIVTEPVMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L  TQRDEY+A GLH+I KAVSFLNND
Sbjct  121  LKATQRDEYFALGLHQIGKAVSFLNND  147



>ref|XP_009141929.1| PREDICTED: N-terminal kinase-like protein [Brassica rapa]
Length=796

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M  FLKGVV GSG G+ DLPY    PY SAWGSW+HYRGTSKDDG+ VSIFALSG+NA D
Sbjct  1    MFNFLKGVVGGSGTGLKDLPYNIGDPYPSAWGSWIHYRGTSKDDGSQVSIFALSGNNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTEVET DGST+KVTIYIVTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETHDGSTSKVTIYIVTEPVMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L  TQRDEY+A GLH+ITKAVSFLNND
Sbjct  121  LKATQRDEYFALGLHQITKAVSFLNND  147



>emb|CDY06969.1| BnaA04g23460D [Brassica napus]
Length=793

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M  FLKGVV GSG G+ DLPY    PY SAWGSW+HYRGTSKDDG+ VSIFALSG+NA D
Sbjct  1    MFNFLKGVVGGSGTGLKDLPYNIGDPYPSAWGSWIHYRGTSKDDGSQVSIFALSGNNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTEVET DGST+KVTIYIVTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETHDGSTSKVTIYIVTEPVMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L  TQRDEY+A GLH+ITKAVSFLNND
Sbjct  121  LKATQRDEYFALGLHQITKAVSFLNND  147



>gb|KFK36944.1| hypothetical protein AALP_AA4G192400 [Arabis alpina]
Length=807

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVVAGSG G+ DLPY    PY SAWGSW H+RGTSKDDG+PVSIF LSG+NA D
Sbjct  1    MFKFLKGVVAGSGTGLKDLPYNIGDPYPSAWGSWNHFRGTSKDDGSPVSIFTLSGNNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPN+LSFLHSTEVET DGST+KVTIYIVTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNVLSFLHSTEVETHDGSTSKVTIYIVTEPVMPLADKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L  TQRDEY+A GLH+ITKAVSFLNND
Sbjct  121  LKATQRDEYFALGLHQITKAVSFLNND  147



>emb|CDX93162.1| BnaC04g47340D [Brassica napus]
Length=795

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M  FLKGVV+GSG G+ DLPY    PY SAWGSWVHYRGTSKDDG+ VSIFAL G+NA D
Sbjct  1    MFNFLKGVVSGSGTGLKDLPYNVGDPYPSAWGSWVHYRGTSKDDGSQVSIFALCGNNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTEVET DGST+KVTIYIVTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETHDGSTSKVTIYIVTEPVMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L  TQRDEY+A GLH+ITKAVSFLNND
Sbjct  121  LKATQRDEYFALGLHQITKAVSFLNND  147



>gb|EPS74262.1| hypothetical protein M569_00492, partial [Genlisea aurea]
Length=835

 Score =   236 bits (603),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFLKGVV GSG  V DLPY    PYS+AWGSWVH RG SK DG+PVSIF+LSGS+AND
Sbjct  1    MLKFLKGVVGGSGTAVKDLPYSIGEPYSTAWGSWVHQRGASKVDGSPVSIFSLSGSSAND  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHL AGRNGVKRLRTVRHPNILSFLHSTE E  DGS+TKVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLTAGRNGVKRLRTVRHPNILSFLHSTETEIFDGSSTKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L G QRDEYYAWG+++I KAVSFLNND
Sbjct  121  LEGKQRDEYYAWGINQIAKAVSFLNND  147



>ref|XP_010508814.1| PREDICTED: N-terminal kinase-like protein isoform X1 [Camelina 
sativa]
 ref|XP_010508816.1| PREDICTED: N-terminal kinase-like protein isoform X2 [Camelina 
sativa]
Length=799

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVVAGSG G+ DLPY    PY SAWGSW H+RGTSKDDG+PVSIFALSG+NA D
Sbjct  1    MFKFLKGVVAGSGTGLKDLPYNIGDPYPSAWGSWSHFRGTSKDDGSPVSIFALSGNNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTEVET DG+T+KVTIYIVTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETHDGATSKVTIYIVTEPVMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L  TQRDEY+A GLH+I KAVSFLNND
Sbjct  121  LKATQRDEYFALGLHQIGKAVSFLNND  147



>ref|XP_008782670.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Phoenix dactylifera]
Length=826

 Score =   236 bits (602),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M +FLKGVVAGSGAG+ DLPY    PY SAWGSW HYRGTSKDDG+ VSIF+LSGSN+ D
Sbjct  1    MFRFLKGVVAGSGAGIRDLPYNVGEPYPSAWGSWTHYRGTSKDDGSMVSIFSLSGSNSQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E VDGST K TIYIVTEPV PL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAEIVDGSTAKHTIYIVTEPVTPLAEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LEGTQRDEYFAWGLHQISKAVSFLNND  147



>ref|XP_010667551.1| PREDICTED: N-terminal kinase-like protein [Beta vulgaris subsp. 
vulgaris]
Length=799

 Score =   236 bits (601),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 129/147 (88%), Gaps = 1/147 (1%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVVAGSG GV DLPY    PYSSAWGSW H  GTSKDDG+PVSIF+LSG N  D
Sbjct  1    MFKFLKGVVAGSGTGVKDLPYNIGEPYSSAWGSWTHSHGTSKDDGSPVSIFSLSG-NVQD  59

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GH+AAGRNGVKRLRTVRHPNILSFLHSTEVET DGSTTKVTIYIVTEPVMPL EK+KELG
Sbjct  60   GHIAAGRNGVKRLRTVRHPNILSFLHSTEVETHDGSTTKVTIYIVTEPVMPLSEKIKELG  119

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L G QRDEYYAWGLH+I KAVSFLNND
Sbjct  120  LDGKQRDEYYAWGLHQIAKAVSFLNND  146



>ref|XP_010921160.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Elaeis guineensis]
Length=826

 Score =   236 bits (601),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVVAGSGAG+ DLPY    PY SAWGSW HYRGT+KDDG+ VSIF+LSGSN+ D
Sbjct  1    MFKFLKGVVAGSGAGIRDLPYNVGEPYPSAWGSWTHYRGTAKDDGSMVSIFSLSGSNSQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E VDGST K TIYIVTEPV PL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAEIVDGSTAKHTIYIVTEPVTPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LEGTQRDEYFAWGLHQISKAVSFLNND  147



>ref|XP_010253052.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X5 [Nelumbo nucifera]
Length=642

 Score =   233 bits (593),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFL+GVVAGSG G+ DLPY    PYS+AWGSW HYRGTSKDDG+ VSIF+LSGSNA D
Sbjct  1    MFKFLRGVVAGSGTGIKDLPYYIGEPYSTAWGSWTHYRGTSKDDGSLVSIFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGV+RLRTVRHPNILSFL STE ET DG+  KVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVRRLRTVRHPNILSFLRSTEAETFDGTVMKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGL +I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLCQIAKAVSFLNND  147



>gb|KJB67947.1| hypothetical protein B456_010G219100 [Gossypium raimondii]
Length=789

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M  FLKGVV GSG G  DLPY    PY SAW SW H+RGTSKDDG+PVSIF+LSGSN  D
Sbjct  1    MFNFLKGVVGGSGGGQKDLPYNIGDPYPSAWSSWSHFRGTSKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            G LAAGRNGVKRLRTVRHPNILSFL+STEVETVDGS TKVTIYIVTEP MPL EK+KEL 
Sbjct  61   GRLAAGRNGVKRLRTVRHPNILSFLYSTEVETVDGSGTKVTIYIVTEPAMPLSEKIKELS  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>emb|CDY22472.1| BnaC03g22820D [Brassica napus]
Length=797

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G+ DLPY    PY SAWGSW H+RGTSKDDG+PVSIF+LSG++A D
Sbjct  1    MFKFLKGVVGGSGTGLKDLPYNIGDPYPSAWGSWNHFRGTSKDDGSPVSIFSLSGNDAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTEVET DGST+KVTIYIVTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETHDGSTSKVTIYIVTEPVMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L  TQRDEY+A GLH+ITKAVSFLNND
Sbjct  121  LKSTQRDEYFALGLHQITKAVSFLNND  147



>gb|KJB67946.1| hypothetical protein B456_010G219100 [Gossypium raimondii]
Length=799

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M  FLKGVV GSG G  DLPY    PY SAW SW H+RGTSKDDG+PVSIF+LSGSN  D
Sbjct  1    MFNFLKGVVGGSGGGQKDLPYNIGDPYPSAWSSWSHFRGTSKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            G LAAGRNGVKRLRTVRHPNILSFL+STEVETVDGS TKVTIYIVTEP MPL EK+KEL 
Sbjct  61   GRLAAGRNGVKRLRTVRHPNILSFLYSTEVETVDGSGTKVTIYIVTEPAMPLSEKIKELS  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>gb|KJB67948.1| hypothetical protein B456_010G219100 [Gossypium raimondii]
Length=800

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M  FLKGVV GSG G  DLPY    PY SAW SW H+RGTSKDDG+PVSIF+LSGSN  D
Sbjct  1    MFNFLKGVVGGSGGGQKDLPYNIGDPYPSAWSSWSHFRGTSKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            G LAAGRNGVKRLRTVRHPNILSFL+STEVETVDGS TKVTIYIVTEP MPL EK+KEL 
Sbjct  61   GRLAAGRNGVKRLRTVRHPNILSFLYSTEVETVDGSGTKVTIYIVTEPAMPLSEKIKELS  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>gb|KJB67945.1| hypothetical protein B456_010G219100 [Gossypium raimondii]
Length=796

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M  FLKGVV GSG G  DLPY    PY SAW SW H+RGTSKDDG+PVSIF+LSGSN  D
Sbjct  1    MFNFLKGVVGGSGGGQKDLPYNIGDPYPSAWSSWSHFRGTSKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            G LAAGRNGVKRLRTVRHPNILSFL+STEVETVDGS TKVTIYIVTEP MPL EK+KEL 
Sbjct  61   GRLAAGRNGVKRLRTVRHPNILSFLYSTEVETVDGSGTKVTIYIVTEPAMPLSEKIKELS  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>ref|XP_006842512.1| hypothetical protein AMTR_s00077p00108970 [Amborella trichopoda]
 gb|ERN04187.1| hypothetical protein AMTR_s00077p00108970 [Amborella trichopoda]
Length=795

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KF+K VVAGSGAG+ DLPY    PYSSAWGSW+HYRGTSK+DG  VSIFALSG+NA D
Sbjct  1    MFKFIKTVVAGSGAGIKDLPYNIGEPYSSAWGSWIHYRGTSKEDGTSVSIFALSGTNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFL+STEVE  D S  K TIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLYSTEVEAGDASHIKPTIYIVTEPVMPLAEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>ref|XP_009133450.1| PREDICTED: N-terminal kinase-like protein [Brassica rapa]
Length=797

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G+ DLPY    PY SAWGSW H+RGTSKDDG+PVSIF+LSG++A D
Sbjct  1    MFKFLKGVVGGSGTGLKDLPYNIGDPYPSAWGSWNHFRGTSKDDGSPVSIFSLSGNDAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTEVET DGST+KVTIYIVTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETHDGSTSKVTIYIVTEPVMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L  TQRDEY+A GLH+ITKAVSFLNND
Sbjct  121  LKSTQRDEYFALGLHQITKAVSFLNND  147



>emb|CDY35443.1| BnaA03g19170D [Brassica napus]
Length=797

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G+ DLPY    PY SAWGSW H+RGTSKDDG+PVSIF+LSG++A D
Sbjct  1    MFKFLKGVVGGSGTGLKDLPYNIGDPYPSAWGSWNHFRGTSKDDGSPVSIFSLSGNDAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTEVET DGST+KVTIYIVTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETHDGSTSKVTIYIVTEPVMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L  TQRDEY+A GLH+ITKAVSFLNND
Sbjct  121  LKSTQRDEYFALGLHQITKAVSFLNND  147



>ref|XP_010540261.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 [Tarenaya hassleriana]
Length=812

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M  FLKGVV GSG G+ DLPY    P+ S+WGSW H+RGTSKDDG+PVSIF++SGSNA D
Sbjct  1    MFNFLKGVVGGSGTGLKDLPYNIGDPFPSSWGSWSHFRGTSKDDGSPVSIFSISGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE+ET DGS TKVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEIETHDGSATKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+A GLH+I KAVSFLNND
Sbjct  121  LKGTQRDEYFALGLHQIAKAVSFLNND  147



>ref|XP_006435941.1| hypothetical protein CICLE_v10030740mg [Citrus clementina]
 gb|ESR49181.1| hypothetical protein CICLE_v10030740mg [Citrus clementina]
Length=796

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSGAGV DLPY    PY SAWGSW H++GTSKDDG+PVSIF++SG+NA D
Sbjct  1    MFKFLKGVVGGSGAGVKDLPYNIGDPYPSAWGSWSHFQGTSKDDGSPVSIFSISGTNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAA RNGVKRLRTVRHPNIL+FLHSTEVE +D ++TK+TIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAARNGVKRLRTVRHPNILAFLHSTEVENIDATSTKITIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L G+QRDEYYAWGL++I KAVSFLNND
Sbjct  121  LEGSQRDEYYAWGLNQIAKAVSFLNND  147



>ref|XP_010111055.1| putative inactive serine/threonine-protein kinase scy1 [Morus 
notabilis]
 gb|EXC29917.1| putative inactive serine/threonine-protein kinase scy1 [Morus 
notabilis]
Length=815

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 133/166 (80%), Gaps = 19/166 (11%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSK------------------  277
            MLKFLKGVV GSG G+ DLPY    PY SAWGSW H+RGTS+                  
Sbjct  1    MLKFLKGVVGGSGTGLKDLPYNIGEPYPSAWGSWTHFRGTSRIDIDRFKSNAQFGKPGKI  60

Query  278  -DDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVT  454
             DDG+PVSIF+LSGSNA DGHLAAGRNGVKRLRTVRHPNILSFLHSTE ET+DGSTTKVT
Sbjct  61   NDDGSPVSIFSLSGSNAQDGHLAAGRNGVKRLRTVRHPNILSFLHSTETETLDGSTTKVT  120

Query  455  IYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            IYIVTEPVMPL EK+KELGL GTQRDEY+AWGL++I KAVSFLNND
Sbjct  121  IYIVTEPVMPLSEKIKELGLEGTQRDEYFAWGLNQIAKAVSFLNND  166



>ref|XP_006486152.1| PREDICTED: LOW QUALITY PROTEIN: N-terminal kinase-like protein-like 
[Citrus sinensis]
Length=799

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSGAGV DLPY    PY SAWGSW H++GTSKDDG+PVSIF++SG+NA D
Sbjct  1    MFKFLKGVVGGSGAGVKDLPYNIGDPYPSAWGSWSHFQGTSKDDGSPVSIFSISGTNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAA RNGVKRLRTVRHPNIL+FLHSTEVE +D ++TK+TIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAARNGVKRLRTVRHPNILAFLHSTEVENIDATSTKITIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L G+QRDEYYAWGL++I KAVSFLNND
Sbjct  121  LEGSQRDEYYAWGLNQIAKAVSFLNND  147



>ref|XP_006411339.1| hypothetical protein EUTSA_v10016269mg [Eutrema salsugineum]
 gb|ESQ52792.1| hypothetical protein EUTSA_v10016269mg [Eutrema salsugineum]
Length=798

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVVAGSG G+ DLPY    PY SAWGSW H+RGTSKDDG+PVSIFALSG++A D
Sbjct  1    MFKFLKGVVAGSGTGLKDLPYNIGDPYPSAWGSWNHFRGTSKDDGSPVSIFALSGNSAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTEVET DG+T+KVTIYIVTEPVMPL +K+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETHDGTTSKVTIYIVTEPVMPLSDKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L  TQRDEY+A GLH+I KAVSFLNND
Sbjct  121  LKATQRDEYFALGLHQIAKAVSFLNND  147



>ref|XP_008221084.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive serine/threonine-protein 
kinase scy1 [Prunus mume]
Length=796

 Score =   233 bits (594),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFLKGVV GSG G  DLPY    PY SAWGSW H+RGTSKDDG+ VS+F++SGSNA D
Sbjct  1    MLKFLKGVVGGSGTGPKDLPYNIGEPYPSAWGSWTHFRGTSKDDGSLVSVFSISGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAA RNGVKRLRTVRHPNILSFLHSTE ET+D STTK TIYIVTEPVMPL EK+KEL 
Sbjct  61   GHLAAARNGVKRLRTVRHPNILSFLHSTEAETLDASTTKQTIYIVTEPVMPLSEKIKELS  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L G QRDEY+AWGLH+I KAVSFLNND
Sbjct  121  LQGIQRDEYFAWGLHQIAKAVSFLNND  147



>ref|XP_010253051.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X4 [Nelumbo nucifera]
Length=725

 Score =   232 bits (591),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFL+GVVAGSG G+ DLPY    PYS+AWGSW HYRGTSKDDG+ VSIF+LSGSNA D
Sbjct  1    MFKFLRGVVAGSGTGIKDLPYYIGEPYSTAWGSWTHYRGTSKDDGSLVSIFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGV+RLRTVRHPNILSFL STE ET DG+  KVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVRRLRTVRHPNILSFLRSTEAETFDGTVMKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGL +I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLCQIAKAVSFLNND  147



>ref|XP_010938026.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 [Elaeis guineensis]
Length=826

 Score =   233 bits (595),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M +FL+ VVAGSGAG+ DLPY    PY SAWGSW HYRGTSKDDG+ VSIF+LSGSN+ D
Sbjct  1    MFRFLREVVAGSGAGIKDLPYNVGEPYPSAWGSWTHYRGTSKDDGSMVSIFSLSGSNSQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E  DGS TK TIYIVTEPV PL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAEIFDGSATKHTIYIVTEPVTPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LEGTQRDEYFAWGLHQISKAVSFLNND  147



>ref|XP_010253050.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X3 [Nelumbo nucifera]
Length=796

 Score =   233 bits (594),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFL+GVVAGSG G+ DLPY    PYS+AWGSW HYRGTSKDDG+ VSIF+LSGSNA D
Sbjct  1    MFKFLRGVVAGSGTGIKDLPYYIGEPYSTAWGSWTHYRGTSKDDGSLVSIFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGV+RLRTVRHPNILSFL STE ET DG+  KVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVRRLRTVRHPNILSFLRSTEAETFDGTVMKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGL +I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLCQIAKAVSFLNND  147



>gb|KHN29287.1| N-terminal kinase-like protein [Glycine soja]
Length=780

 Score =   232 bits (592),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VV GSG GV DLPY    PY SAWGSW H RGTSKDDG+PVS+F+LSGSNA D
Sbjct  1    MFKFLKEVVGGSGTGVKDLPYTIAEPYPSAWGSWTHSRGTSKDDGSPVSVFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAA RNGVKRLRTVRHPNILSFLHS E+ET D  + KVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAARNGVKRLRTVRHPNILSFLHSAEIETYDAGSPKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYA GLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYALGLHQIAKAVSFLNND  147



>ref|XP_010253047.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Nelumbo nucifera]
 ref|XP_010253048.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Nelumbo nucifera]
Length=815

 Score =   233 bits (593),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFL+GVVAGSG G+ DLPY    PYS+AWGSW HYRGTSKDDG+ VSIF+LSGSNA D
Sbjct  1    MFKFLRGVVAGSGTGIKDLPYYIGEPYSTAWGSWTHYRGTSKDDGSLVSIFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGV+RLRTVRHPNILSFL STE ET DG+  KVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVRRLRTVRHPNILSFLRSTEAETFDGTVMKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGL +I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLCQIAKAVSFLNND  147



>ref|XP_010253049.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Nelumbo nucifera]
Length=810

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFL+GVVAGSG G+ DLPY    PYS+AWGSW HYRGTSKDDG+ VSIF+LSGSNA D
Sbjct  1    MFKFLRGVVAGSGTGIKDLPYYIGEPYSTAWGSWTHYRGTSKDDGSLVSIFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGV+RLRTVRHPNILSFL STE ET DG+  KVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAGRNGVRRLRTVRHPNILSFLRSTEAETFDGTVMKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGL +I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLCQIAKAVSFLNND  147



>gb|KHG02829.1| N-terminal kinase-like protein [Gossypium arboreum]
Length=723

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M  FLKGVV GSG G  DLPY    PY SAW SW H+RGTSKDDG+ VSIF+LSGSN  D
Sbjct  1    MFNFLKGVVGGSGGGQKDLPYNIGDPYPSAWSSWSHFRGTSKDDGSHVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            G LAAGRNGVKRLRTVRHPNILSFL+STEVETVDGS TKVTIYIVTEP MPL EK+KEL 
Sbjct  61   GRLAAGRNGVKRLRTVRHPNILSFLYSTEVETVDGSGTKVTIYIVTEPAMPLYEKIKELS  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYAWGLHQIAKAVSFLNND  147



>ref|XP_006587814.1| PREDICTED: N-terminal kinase-like protein-like [Glycine max]
Length=793

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VV GSG GV DLPY    PY SAWGSW H RGTSKDDG+PVS+F+LSGSNA D
Sbjct  1    MFKFLKEVVGGSGTGVKDLPYTIAEPYPSAWGSWTHSRGTSKDDGSPVSVFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAA RNGVKRLRTVRHPNILSFLHS E+ET D  + KVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAARNGVKRLRTVRHPNILSFLHSAEIETYDAGSPKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYA GLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYALGLHQIAKAVSFLNND  147



>ref|XP_002319344.2| HEAT repeat-containing family protein [Populus trichocarpa]
 gb|EEE95267.2| HEAT repeat-containing family protein [Populus trichocarpa]
Length=842

 Score =   231 bits (590),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 139/167 (83%), Gaps = 5/167 (3%)
 Frame = +2

Query  107  SSPVNGGWRITG---R*TMLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSK  277
            + P  G  +IT    +  ML+FLKGVV GSG G+ DLPY    PY SAWGSW H+RGTSK
Sbjct  25   AEPTQGHSQITDSNRKKKMLRFLKGVVGGSGTGLKDLPYNIGDPYPSAWGSWTHHRGTSK  84

Query  278  DD--GAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKV  451
            DD  G+ VSIF+LSGSNA DGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE+V+GS+++V
Sbjct  85   DDDGGSAVSIFSLSGSNALDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVESVEGSSSRV  144

Query  452  TIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            TIYIVTEPVMPL EK+KELGL G QRDEYYAWGL++I KAVSFLNND
Sbjct  145  TIYIVTEPVMPLSEKIKELGLEGAQRDEYYAWGLNQIAKAVSFLNND  191



>dbj|BAD73565.1| putative kinase-like protein splice variant 1 [Oryza sativa Japonica 
Group]
Length=442

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VVAGSG+G+ D PY    PY+SAWGSW H+RGTSKDDG+PVSIF+LSGSN  D
Sbjct  1    MFKFLKEVVAGSGSGLKDFPYTIGEPYASAWGSWTHHRGTSKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
             HL AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPV PL EKLKEL 
Sbjct  61   RHLVAGRNGVKRLRTVRHPNILSFLHSTEAEVPDGPAMKHTIYIVTEPVTPLSEKLKELN  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LGGTQRDEYFAWGLHQISKAVSFLNND  147



>ref|XP_007139742.1| hypothetical protein PHAVU_008G055600g [Phaseolus vulgaris]
 gb|ESW11736.1| hypothetical protein PHAVU_008G055600g [Phaseolus vulgaris]
Length=796

 Score =   230 bits (587),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VV GSG G+ DLPY    P+ SAWGSW H RGTSKDDG+PVS+F+LSGSNA D
Sbjct  1    MFKFLKEVVGGSGTGLKDLPYNIAEPFPSAWGSWTHSRGTSKDDGSPVSVFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAA RNGVKRLRTVRHPNILSFLHS E+ET D  + KVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAARNGVKRLRTVRHPNILSFLHSAEIETYDAGSPKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYA GLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYALGLHQIAKAVSFLNND  147



>gb|KHN40459.1| Putative inactive serine/threonine-protein kinase scy1 [Glycine 
soja]
Length=790

 Score =   230 bits (586),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VV GSG GV DLPY     Y SAWGSW H RGTSKDDG+PVS+F+LSGSNA D
Sbjct  1    MFKFLKEVVGGSGTGVKDLPYTIAESYPSAWGSWTHSRGTSKDDGSPVSVFSLSGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAA RNGVKRLRTVRHPNILSFLHSTE+ET D  + KVTIYIVTEPVMPL EK+KELG
Sbjct  61   GHLAAARNGVKRLRTVRHPNILSFLHSTEIETYDAGSPKVTIYIVTEPVMPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEYYA GLH+I KAVSFLNND
Sbjct  121  LEGTQRDEYYALGLHQIAKAVSFLNND  147



>tpg|DAA57071.1| TPA: hypothetical protein ZEAMMB73_658709 [Zea mays]
Length=417

 Score =   222 bits (566),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VVAGSG+G+ D PY     Y+SAWGSW H+RGTSKDDG+PVSIF+LSGSN  D
Sbjct  1    MFKFLKEVVAGSGSGLKDFPYTIGETYASAWGSWTHHRGTSKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
             H+ AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPVMPL EKLKEL 
Sbjct  61   RHMVAGRNGVKRLRTVRHPNILSFLHSTEAEVADGPAIKHTIYIVTEPVMPLSEKLKELN  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LGGTQRDEYFAWGLHQISKAVSFLNND  147



>ref|XP_008810839.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 [Phoenix dactylifera]
Length=825

 Score =   230 bits (586),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M +FLK VVAGSGAG+ DLPY    PY SAWGSW HYRGTSKDDG+ VSIF+LSGSN+ D
Sbjct  1    MFRFLKEVVAGSGAGIKDLPYNVGEPYPSAWGSWTHYRGTSKDDGSMVSIFSLSGSNSQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E  DGSTTK TIYIVTEPV PL EK+KEL 
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAEIFDGSTTKHTIYIVTEPVTPLSEKIKELS  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGL +I+KAV+FLNND
Sbjct  121  LEGTQRDEYFAWGLQQISKAVNFLNND  147



>ref|XP_004297714.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Fragaria vesca subsp. vesca]
Length=798

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFL  VV GSG+G  DLPY    PY SAWGSW H RGTSKDDG+ VSIF+++GSNA D
Sbjct  1    MLKFLNRVVGGSGSGPKDLPYNIGEPYPSAWGSWSHCRGTSKDDGSQVSIFSITGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAA RNGVKRLRTVRHPNILSFLHSTE+ET+D STTK TIYIVTEPVMPL EK+KEL 
Sbjct  61   GHLAAARNGVKRLRTVRHPNILSFLHSTEIETMDASTTKHTIYIVTEPVMPLSEKIKELS  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L   QRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LQNIQRDEYYAWGLHQIAKAVSFLNND  147



>ref|XP_011463428.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Fragaria vesca subsp. vesca]
Length=797

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFL  VV GSG+G  DLPY    PY SAWGSW H RGTSKDDG+ VSIF+++GSNA D
Sbjct  1    MLKFLNRVVGGSGSGPKDLPYNIGEPYPSAWGSWSHCRGTSKDDGSQVSIFSITGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAA RNGVKRLRTVRHPNILSFLHSTE+ET+D STTK TIYIVTEPVMPL EK+KEL 
Sbjct  61   GHLAAARNGVKRLRTVRHPNILSFLHSTEIETMDASTTKHTIYIVTEPVMPLSEKIKELS  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L   QRDEYYAWGLH+I KAVSFLNND
Sbjct  121  LQNIQRDEYYAWGLHQIAKAVSFLNND  147



>tpg|DAA57070.1| TPA: hypothetical protein ZEAMMB73_658709 [Zea mays]
Length=491

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VVAGSG+G+ D PY     Y+SAWGSW H+RGTSKDDG+PVSIF+LSGSN  D
Sbjct  1    MFKFLKEVVAGSGSGLKDFPYTIGETYASAWGSWTHHRGTSKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
             H+ AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPVMPL EKLKEL 
Sbjct  61   RHMVAGRNGVKRLRTVRHPNILSFLHSTEAEVADGPAIKHTIYIVTEPVMPLSEKLKELN  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LGGTQRDEYFAWGLHQISKAVSFLNND  147



>ref|XP_011010141.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Populus euphratica]
Length=800

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 131/149 (88%), Gaps = 2/149 (1%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDD--GAPVSIFALSGSNA  325
            ML+FLKGVV GSG G+ DLPY    PY +AWGSW H+RGTSKDD  G+ VSIF+LSGSNA
Sbjct  1    MLRFLKGVVGGSGTGLKDLPYNIGDPYPTAWGSWTHHRGTSKDDDGGSAVSIFSLSGSNA  60

Query  326  NDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKE  505
             DGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE+V+GS+++VTIYIVTEPVMPL EK+KE
Sbjct  61   MDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVESVEGSSSRVTIYIVTEPVMPLSEKIKE  120

Query  506  LGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            LGL G  RDEYYAWGL++I KAVSFLNND
Sbjct  121  LGLEGAHRDEYYAWGLNQIAKAVSFLNND  149



>ref|XP_011010140.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Populus euphratica]
 ref|XP_011010142.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Populus euphratica]
 ref|XP_011010143.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Populus euphratica]
 ref|XP_011010144.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Populus euphratica]
 ref|XP_011010146.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Populus euphratica]
Length=801

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 131/149 (88%), Gaps = 2/149 (1%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDD--GAPVSIFALSGSNA  325
            ML+FLKGVV GSG G+ DLPY    PY +AWGSW H+RGTSKDD  G+ VSIF+LSGSNA
Sbjct  1    MLRFLKGVVGGSGTGLKDLPYNIGDPYPTAWGSWTHHRGTSKDDDGGSAVSIFSLSGSNA  60

Query  326  NDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKE  505
             DGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE+V+GS+++VTIYIVTEPVMPL EK+KE
Sbjct  61   MDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVESVEGSSSRVTIYIVTEPVMPLSEKIKE  120

Query  506  LGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            LGL G  RDEYYAWGL++I KAVSFLNND
Sbjct  121  LGLEGAHRDEYYAWGLNQIAKAVSFLNND  149



>ref|XP_002458682.1| hypothetical protein SORBIDRAFT_03g038150 [Sorghum bicolor]
 gb|EES03802.1| hypothetical protein SORBIDRAFT_03g038150 [Sorghum bicolor]
Length=824

 Score =   228 bits (581),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VVAGSG+G+ D PY    PY+SAWGSW H+RGTSKDDG+PVSIF+LSGSN  D
Sbjct  1    MFKFLKEVVAGSGSGLKDFPYTIGEPYASAWGSWTHHRGTSKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
             H+ AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPVMPL EKLKEL 
Sbjct  61   RHMVAGRNGVKRLRTVRHPNILSFLHSTEAEVADGPAMKHTIYIVTEPVMPLSEKLKELN  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LGGTQRDEYFAWGLHQISKAVSFLNND  147



>ref|NP_001146277.1| uncharacterized protein LOC100279852 [Zea mays]
 gb|ACL53620.1| unknown [Zea mays]
Length=823

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VVAGSG+G+ D PY    PY+SAWGSW H+RGTSKDDG+PVSIF+LSGSN  D
Sbjct  1    MFKFLKEVVAGSGSGLKDFPYTIGEPYASAWGSWKHHRGTSKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
             H+ AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPVMPL EKLKEL 
Sbjct  61   RHMVAGRNGVKRLRTVRHPNILSFLHSTEAEAADGPAMKYTIYIVTEPVMPLSEKLKELN  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LGGTQRDEYFAWGLHQISKAVSFLNND  147



>ref|XP_008340425.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 [Malus domestica]
Length=797

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 126/148 (85%), Gaps = 1/148 (1%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFLKGVV GSG G  DLPY    PY SAWGSW H+RGTSKDDG+PVSIF++SGSNA D
Sbjct  1    MLKFLKGVVGGSGTGPKDLPYNIGDPYPSAWGSWTHFRGTSKDDGSPVSIFSISGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGST-TKVTIYIVTEPVMPLCEKLKEL  508
            GHLAA RNGVKRLRTVRHPNILSFLHSTE ETVD S+ TK TIYIVTEPVMPL +K+KEL
Sbjct  61   GHLAAARNGVKRLRTVRHPNILSFLHSTEAETVDASSATKQTIYIVTEPVMPLSDKIKEL  120

Query  509  GLVGTQRDEYYAWGLHRITKAVSFLNND  592
             L G QRDEY+A GLH+I KAVSFLNND
Sbjct  121  NLQGIQRDEYFACGLHQIAKAVSFLNND  148



>tpg|DAA57069.1| TPA: hypothetical protein ZEAMMB73_658709 [Zea mays]
Length=539

 Score =   223 bits (567),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VVAGSG+G+ D PY     Y+SAWGSW H+RGTSKDDG+PVSIF+LSGSN  D
Sbjct  1    MFKFLKEVVAGSGSGLKDFPYTIGETYASAWGSWTHHRGTSKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
             H+ AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPVMPL EKLKEL 
Sbjct  61   RHMVAGRNGVKRLRTVRHPNILSFLHSTEAEVADGPAIKHTIYIVTEPVMPLSEKLKELN  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LGGTQRDEYFAWGLHQISKAVSFLNND  147



>ref|XP_004970383.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like isoform X1 [Setaria italica]
Length=826

 Score =   227 bits (579),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VVAGSG+G+ D PY    PY+SAWGSW H+RGTSKDDG+PVSIF+LSGSN  D
Sbjct  1    MFKFLKEVVAGSGSGLKDFPYTIGEPYASAWGSWTHHRGTSKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
             HL AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPVMPL EKLKEL 
Sbjct  61   RHLVAGRNGVKRLRTVRHPNILSFLHSTESEVPDGPAMKHTIYIVTEPVMPLSEKLKELN  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LGGTQRDEYFAWGLHQISKAVSFLNND  147



>ref|XP_004970384.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like isoform X2 [Setaria italica]
Length=824

 Score =   227 bits (579),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VVAGSG+G+ D PY    PY+SAWGSW H+RGTSKDDG+PVSIF+LSGSN  D
Sbjct  1    MFKFLKEVVAGSGSGLKDFPYTIGEPYASAWGSWTHHRGTSKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
             HL AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPVMPL EKLKEL 
Sbjct  61   RHLVAGRNGVKRLRTVRHPNILSFLHSTESEVPDGPAMKHTIYIVTEPVMPLSEKLKELN  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LGGTQRDEYFAWGLHQISKAVSFLNND  147



>gb|AFW84753.1| hypothetical protein ZEAMMB73_694445 [Zea mays]
Length=865

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VVAGSG+G+ D PY    PY+SAWGSW H+RGTSKDDG+PVSIF+LSGSN  D
Sbjct  1    MFKFLKEVVAGSGSGLKDFPYTIGEPYASAWGSWKHHRGTSKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
             H+ AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPVMPL EKLKEL 
Sbjct  61   RHMVAGRNGVKRLRTVRHPNILSFLHSTEAEAADGPAMKYTIYIVTEPVMPLSEKLKELN  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LGGTQRDEYFAWGLHQISKAVSFLNND  147



>ref|NP_001044644.1| Os01g0819900 [Oryza sativa Japonica Group]
 dbj|BAD73564.1| putative kinase-like protein splice variant 1 [Oryza sativa Japonica 
Group]
 dbj|BAF06558.1| Os01g0819900 [Oryza sativa Japonica Group]
 dbj|BAG90404.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64980.1| hypothetical protein OsJ_19897 [Oryza sativa Japonica Group]
Length=825

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VVAGSG+G+ D PY    PY+SAWGSW H+RGTSKDDG+PVSIF+LSGSN  D
Sbjct  1    MFKFLKEVVAGSGSGLKDFPYTIGEPYASAWGSWTHHRGTSKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
             HL AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPV PL EKLKEL 
Sbjct  61   RHLVAGRNGVKRLRTVRHPNILSFLHSTEAEVPDGPAMKHTIYIVTEPVTPLSEKLKELN  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LGGTQRDEYFAWGLHQISKAVSFLNND  147



>gb|EEC71713.1| hypothetical protein OsI_04229 [Oryza sativa Indica Group]
Length=825

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VVAGSG+G+ D PY    PY+SAWGSW H+RGTSKDDG+PVSIF+LSGSN  D
Sbjct  1    MFKFLKEVVAGSGSGLKDFPYTIGEPYASAWGSWTHHRGTSKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
             HL AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPV PL EKLKEL 
Sbjct  61   RHLVAGRNGVKRLRTVRHPNILSFLHSTEAEVPDGPAMKHTIYIVTEPVTPLSEKLKELN  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LGGTQRDEYFAWGLHQISKAVSFLNND  147



>ref|XP_008674884.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Zea mays]
Length=823

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VVAGSG+G+ D PY     Y+SAWGSW H+RGTSKDDG+PVSIF+LSGSN  D
Sbjct  1    MFKFLKEVVAGSGSGLKDFPYTIGETYASAWGSWTHHRGTSKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
             H+ AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPVMPL EKLKEL 
Sbjct  61   RHMVAGRNGVKRLRTVRHPNILSFLHSTEAEVADGPAIKHTIYIVTEPVMPLSEKLKELN  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LGGTQRDEYFAWGLHQISKAVSFLNND  147



>ref|XP_006367546.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like [Solanum tuberosum]
Length=141

 Score =   207 bits (528),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G+ DLPY    PYS+AWGSWVHYRGTSKDDGAPVSIF L+GSNAND
Sbjct  1    MFKFLKGVVGGSGTGLKDLPYNIGEPYSTAWGSWVHYRGTSKDDGAPVSIFVLTGSNAND  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFL+STE ET DGSTTKVTIYIVTEPVMPL EKLKELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLYSTEAETFDGSTTKVTIYIVTEPVMPLSEKLKELG  120

Query  512  LVGTQRDE  535
            L G QR E
Sbjct  121  LKGNQRYE  128



>ref|XP_011001384.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 [Populus euphratica]
Length=801

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 127/150 (85%), Gaps = 3/150 (2%)
 Frame = +2

Query  152  MLKFLKgvvagsgag-vxDLPYXXXXPYSSAWGSWVHYRGTSK--DDGAPVSIFALSGSN  322
            ML+FLKGVV G+    + DLPY    PY SAWGSW H+RGTS   DDG+PVSIF+ S SN
Sbjct  1    MLRFLKGVVGGASGTGLKDLPYNIGDPYPSAWGSWTHHRGTSSKDDDGSPVSIFSFSASN  60

Query  323  ANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLK  502
            A D HLAA RNGVKRLRTVRHPNILSFLHSTEVE+V+GS++++TIYIVTEPVMPL EK+K
Sbjct  61   AQDAHLAAARNGVKRLRTVRHPNILSFLHSTEVESVEGSSSRITIYIVTEPVMPLSEKIK  120

Query  503  ELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            ELGL GTQRDEYYAWGL++I KAVSFLNND
Sbjct  121  ELGLEGTQRDEYYAWGLNQIAKAVSFLNND  150



>ref|XP_002325930.1| hypothetical protein POPTR_0019s08720g [Populus trichocarpa]
 gb|EEF00312.1| hypothetical protein POPTR_0019s08720g [Populus trichocarpa]
Length=794

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 127/150 (85%), Gaps = 3/150 (2%)
 Frame = +2

Query  152  MLKFLKgvvagsgag-vxDLPYXXXXPYSSAWGSWVHYRGTSK--DDGAPVSIFALSGSN  322
            ML+FLKGVV G+    + DLPY    PY SAWGSW H+RGTS   DDG+PVSIF+ S SN
Sbjct  1    MLRFLKGVVGGASGTGLKDLPYNIGDPYPSAWGSWTHHRGTSSKDDDGSPVSIFSFSASN  60

Query  323  ANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLK  502
            A D HLAA RNGVKRLRTVRHPNILSFLHSTEVE+V+GS++++TIYIVTEPVMPL EK+K
Sbjct  61   AQDAHLAAARNGVKRLRTVRHPNILSFLHSTEVESVEGSSSRITIYIVTEPVMPLSEKIK  120

Query  503  ELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            ELGL GTQRDEYYAWGL++I KAVSFLNND
Sbjct  121  ELGLEGTQRDEYYAWGLNQIAKAVSFLNND  150



>ref|XP_008782671.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Phoenix dactylifera]
Length=816

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M +FLKGVVAGSGAG+ DLPY    PY SAWGSW HYRGTSKDDG+ VSIF+LSGSN+ D
Sbjct  1    MFRFLKGVVAGSGAGIRDLPYNVGEPYPSAWGSWTHYRGTSKDDGSMVSIFSLSGSNSQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E VDGST K TIYIVTEPV PL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAEIVDGSTAKHTIYIVTEPVTPLAEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAV  574
            L GTQRDEY+AWGLH+I+KAV
Sbjct  121  LEGTQRDEYFAWGLHQISKAV  141



>ref|XP_006371290.1| hypothetical protein POPTR_0019s08720g [Populus trichocarpa]
 gb|ERP49087.1| hypothetical protein POPTR_0019s08720g [Populus trichocarpa]
Length=801

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 127/150 (85%), Gaps = 3/150 (2%)
 Frame = +2

Query  152  MLKFLKgvvagsgag-vxDLPYXXXXPYSSAWGSWVHYRGTSK--DDGAPVSIFALSGSN  322
            ML+FLKGVV G+    + DLPY    PY SAWGSW H+RGTS   DDG+PVSIF+ S SN
Sbjct  1    MLRFLKGVVGGASGTGLKDLPYNIGDPYPSAWGSWTHHRGTSSKDDDGSPVSIFSFSASN  60

Query  323  ANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLK  502
            A D HLAA RNGVKRLRTVRHPNILSFLHSTEVE+V+GS++++TIYIVTEPVMPL EK+K
Sbjct  61   AQDAHLAAARNGVKRLRTVRHPNILSFLHSTEVESVEGSSSRITIYIVTEPVMPLSEKIK  120

Query  503  ELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            ELGL GTQRDEYYAWGL++I KAVSFLNND
Sbjct  121  ELGLEGTQRDEYYAWGLNQIAKAVSFLNND  150



>ref|XP_010921159.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Elaeis guineensis]
Length=816

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVVAGSGAG+ DLPY    PY SAWGSW HYRGT+KDDG+ VSIF+LSGSN+ D
Sbjct  1    MFKFLKGVVAGSGAGIRDLPYNVGEPYPSAWGSWTHYRGTAKDDGSMVSIFSLSGSNSQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHSTE E VDGST K TIYIVTEPV PL EK+KELG
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSTEAEIVDGSTAKHTIYIVTEPVTPLSEKIKELG  120

Query  512  LVGTQRDEYYAWGLHRITKAV  574
            L GTQRDEY+AWGLH+I+KAV
Sbjct  121  LEGTQRDEYFAWGLHQISKAV  141



>ref|XP_009351754.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 [Pyrus x bretschneideri]
Length=798

 Score =   221 bits (564),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFLKGVV GSG G  DLPY    PY  AWGSW H+RGTSKDDG+PVSIF++SGSNA D
Sbjct  1    MLKFLKGVVGGSGTGPKDLPYNIGDPYPCAWGSWTHFRGTSKDDGSPVSIFSISGSNAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGST-TKVTIYIVTEPVMPLCEKLKEL  508
            GHLAA RNGVKRLRTVRHPNILSFLHS E ETVD S+ TK  IYIVTEPVMPL +K+KEL
Sbjct  61   GHLAAARNGVKRLRTVRHPNILSFLHSIEAETVDASSATKQIIYIVTEPVMPLSDKIKEL  120

Query  509  GLVGTQRDEYYAWGLHRITKAVSFLNND  592
             L G QRDEY+A GLH+I KAVSFLNND
Sbjct  121  NLQGIQRDEYFACGLHQIAKAVSFLNND  148



>ref|XP_006644915.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like [Oryza brachyantha]
Length=822

 Score =   222 bits (565),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VVAGSG+G+ D PY    PY+SAWGSW H+RGTSKDDG+ VSIF+LSGSN  D
Sbjct  1    MFKFLKEVVAGSGSGLKDFPYTVGEPYASAWGSWTHHRGTSKDDGSAVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
             HL AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPV PL EKLKEL 
Sbjct  61   RHLVAGRNGVKRLRTVRHPNILSFLHSTEAEVPDGPAMKHTIYIVTEPVTPLSEKLKELN  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LGGTQRDEYFAWGLHQISKAVSFLNND  147



>ref|XP_003564494.1| PREDICTED: N-terminal kinase-like protein [Brachypodium distachyon]
Length=823

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VV+GSG+G+ D PY    P++SAWGSW H+RG SKDDG+PVSIF+LSGSN  D
Sbjct  1    MFKFLKDVVSGSGSGLKDFPYTVGEPHASAWGSWTHHRGASKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
             HL AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPV PL EK+KEL 
Sbjct  61   RHLVAGRNGVKRLRTVRHPNILSFLHSTEAEVADGPAVKHTIYIVTEPVTPLSEKVKELN  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LGGTQRDEYFAWGLHQISKAVSFLNND  147



>dbj|BAJ85082.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=824

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VVAGSG+G+ D PY    P++SAWGSW H+RG SKDDG+PVSIF+LSGSN  D
Sbjct  1    MFKFLKDVVAGSGSGLKDFPYTIGEPHASAWGSWTHHRGASKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
             H+ AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPV PL EK+KEL 
Sbjct  61   RHMVAGRNGVKRLRTVRHPNILSFLHSTEAEVPDGPAIKHTIYIVTEPVTPLSEKIKELN  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LGGTQRDEYFAWGLHQISKAVSFLNND  147



>emb|CDM84765.1| unnamed protein product [Triticum aestivum]
Length=824

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VVAGSG+G+ D PY    P++SAWGSW H+RG SKDDG+PVSIF+LSGSN  D
Sbjct  1    MFKFLKDVVAGSGSGLKDFPYTIGEPHASAWGSWTHHRGASKDDGSPVSIFSLSGSNPQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
             H+ AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPV PL EK+KEL 
Sbjct  61   RHMVAGRNGVKRLRTVRHPNILSFLHSTEAEVPDGPAIKHTIYIVTEPVTPLSEKIKELN  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LGGTQRDEYFAWGLHQISKAVSFLNND  147



>ref|XP_008360002.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive serine/threonine-protein 
kinase scy1 [Malus domestica]
Length=798

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFLKGVV GSG G  DLPY    PY SAWGSW H+RGTSKDDG PVSIF++SGS+A D
Sbjct  1    MLKFLKGVVGGSGTGPKDLPYNIGEPYLSAWGSWTHFRGTSKDDGTPVSIFSISGSSAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDG-STTKVTIYIVTEPVMPLCEKLKEL  508
            GHLAA RNGVKRLRTVRHPNILSFLHSTE ETVD  S  K  IYIVTEPVMPL EK+KEL
Sbjct  61   GHLAAARNGVKRLRTVRHPNILSFLHSTEAETVDAXSAVKQIIYIVTEPVMPLSEKIKEL  120

Query  509  GLVGTQRDEYYAWGLHRITKAVSFLNND  592
             L G QRDEY+A GL++I KAVSFLNND
Sbjct  121  NLQGIQRDEYFACGLNQIAKAVSFLNND  148



>ref|XP_002962680.1| hypothetical protein SELMODRAFT_230150 [Selaginella moellendorffii]
 gb|EFJ36143.1| hypothetical protein SELMODRAFT_230150 [Selaginella moellendorffii]
Length=445

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 122/147 (83%), Gaps = 3/147 (2%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFLKGVV  +  G+ DLPY    PY+++WGSW H +GTSK+D +PVSIF+ + S A D
Sbjct  1    MLKFLKGVVGSAAGGIKDLPYSIGDPYAASWGSWTHCQGTSKEDNSPVSIFSFTASGAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            G LA  RNGVKRLRTVRHPN+LSFLHSTEVE ++G   K+TIY+VTEPVMPL EK+K++G
Sbjct  61   GRLAPARNGVKRLRTVRHPNVLSFLHSTEVEGMEG---KITIYVVTEPVMPLAEKIKDMG  117

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L+ TQRDEY+AWGLH+++KAVSFLNND
Sbjct  118  LIDTQRDEYFAWGLHQVSKAVSFLNND  144



>ref|XP_002980417.1| hypothetical protein SELMODRAFT_444483 [Selaginella moellendorffii]
 gb|EFJ18677.1| hypothetical protein SELMODRAFT_444483 [Selaginella moellendorffii]
Length=769

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 123/147 (84%), Gaps = 3/147 (2%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFLKGVV  +  G+ DLPY    PY+++WGSW H +GTSK+D +PVSIF+ + S A D
Sbjct  1    MLKFLKGVVGSAAGGIKDLPYSIGDPYAASWGSWTHCQGTSKEDNSPVSIFSFTASGAQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            G LA  RNGVKRLRTVRHPN+LSFLHSTEVE V+G   K+TIY+VTEPVMPL EK+K++G
Sbjct  61   GRLAPARNGVKRLRTVRHPNVLSFLHSTEVEGVEG---KITIYVVTEPVMPLAEKIKDMG  117

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L+GTQRDEY+AWGLH+++KAVSFLNND
Sbjct  118  LIGTQRDEYFAWGLHQVSKAVSFLNND  144



>gb|EMS65875.1| N-terminal kinase-like protein [Triticum urartu]
Length=910

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLK VVAGSG+G+ D PY    P++SAWGSW H+RG SKDDG+PVSIF+LSGSN  D
Sbjct  100  MFKFLKDVVAGSGSGLKDFPYTIGEPHASAWGSWTHHRGASKDDGSPVSIFSLSGSNPQD  159

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
             H+ AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPV PL EK+KEL 
Sbjct  160  RHMVAGRNGVKRLRTVRHPNILSFLHSTEAEVPDGPAIKHTIYIVTEPVTPLSEKIKELN  219

Query  512  L-VGTQRDEYYAWGLHRITKAVSFLNND  592
            L V   RDEY+AWGLH+I+KAVSFLNND
Sbjct  220  LGVSCSRDEYFAWGLHQISKAVSFLNND  247



>ref|XP_009386930.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Musa acuminata subsp. malaccensis]
Length=819

 Score =   210 bits (535),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G  DLPY    PY SAWGSW H RGTSK+DG+ VSIF+LSGS++ D
Sbjct  1    MFKFLKGVVGGSGTGPKDLPYNIGEPYPSAWGSWTHQRGTSKEDGSSVSIFSLSGSSSQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHS+E E  DGST K TIYIVTEPVMPL EK+KEL 
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSSEAEISDGSTMKHTIYIVTEPVMPLSEKIKELN  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LTGTQRDEYFAWGLHQISKAVSFLNND  147



>ref|XP_001761188.1| predicted protein [Physcomitrella patens]
 gb|EDQ73910.1| predicted protein [Physcomitrella patens]
Length=805

 Score =   210 bits (535),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            MLKFLKGVV   G    DLPY    PYS+AWG W H+RGTSKDD +PVSIF+ +GSNA D
Sbjct  1    MLKFLKGVVGSGGGIK-DLPYNIGEPYSTAWGGWAHFRGTSKDDNSPVSIFSYTGSNAQD  59

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
              LAA RNG KRLR VRHPN+L+FLHSTEVE +DG   K TIY+VTEPVMPL EK++EL 
Sbjct  60   ARLAAARNGAKRLRVVRHPNVLAFLHSTEVENIDGGVAKPTIYLVTEPVMPLSEKIQELD  119

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQR+EYYAWGL++I +AVSFLNND
Sbjct  120  LQGTQRNEYYAWGLNQIARAVSFLNND  146



>ref|XP_009386929.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Musa acuminata subsp. malaccensis]
Length=823

 Score =   210 bits (535),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  152  MLKFLKgvvagsgagvxDLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND  331
            M KFLKGVV GSG G  DLPY    PY SAWGSW H RGTSK+DG+ VSIF+LSGS++ D
Sbjct  1    MFKFLKGVVGGSGTGPKDLPYNIGEPYPSAWGSWTHQRGTSKEDGSSVSIFSLSGSSSQD  60

Query  332  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG  511
            GHLAAGRNGVKRLRTVRHPNILSFLHS+E E  DGST K TIYIVTEPVMPL EK+KEL 
Sbjct  61   GHLAAGRNGVKRLRTVRHPNILSFLHSSEAEISDGSTMKHTIYIVTEPVMPLSEKIKELN  120

Query  512  LVGTQRDEYYAWGLHRITKAVSFLNND  592
            L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  121  LTGTQRDEYFAWGLHQISKAVSFLNND  147



>emb|CAN63376.1| hypothetical protein VITISV_042412 [Vitis vinifera]
Length=770

 Score =   202 bits (513),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  266  GTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTT  445
            G  +DDG+PVSIF+LSGSNA DGHLAAGRNGVKRLRTVRHPNILSFLHSTE ET DGS+T
Sbjct  22   GIFRDDGSPVSIFSLSGSNAQDGHLAAGRNGVKRLRTVRHPNILSFLHSTEAETFDGSST  81

Query  446  KVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            KVTIYIVTEPVMPL EK+KELGL GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  82   KVTIYIVTEPVMPLSEKIKELGLEGTQRDEYYAWGLHQIAKAVSFLNND  130



>gb|KHG09100.1| N-terminal kinase-like protein [Gossypium arboreum]
Length=703

 Score =   198 bits (504),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +2

Query  278  DDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTI  457
            DDG+PVSIF+LSGSN  DGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE+ DGS++KVTI
Sbjct  9    DDGSPVSIFSLSGSNPQDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVESFDGSSSKVTI  68

Query  458  YIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            YIVTEPVMPL EK+KELGL GTQRDEYYAWGLH+I KAVSFLNND
Sbjct  69   YIVTEPVMPLSEKIKELGLEGTQRDEYYAWGLHQIAKAVSFLNND  113



>gb|EMT22366.1| N-terminal kinase-like protein [Aegilops tauschii]
Length=808

 Score =   165 bits (418),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 82/110 (75%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +2

Query  266  GTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTT  445
            G   DDG+PVSIF+LSGSN  D H+ AGRNGVKRLRTVRHPNILSFLHSTE E  DG   
Sbjct  36   GWPADDGSPVSIFSLSGSNPQDRHMVAGRNGVKRLRTVRHPNILSFLHSTEAEVPDGPAI  95

Query  446  KVTIYIVTEPVMPLCEKLKELGL-VGTQRDEYYAWGLHRITKAVSFLNND  592
            K TIYIVTEPV PL EK+KEL L V   RDEY+AWGLH+I+KAVSFLNND
Sbjct  96   KHTIYIVTEPVTPLSEKIKELNLGVSCSRDEYFAWGLHQISKAVSFLNND  145



>ref|XP_008674885.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Zea mays]
Length=778

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +2

Query  308  LSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPL  487
            L GSN  D H+ AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPVMPL
Sbjct  8    LQGSNPQDRHMVAGRNGVKRLRTVRHPNILSFLHSTEAEVADGPAIKHTIYIVTEPVMPL  67

Query  488  CEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             EKLKEL L GTQRDEY+AWGLH+I+KAVSFLNND
Sbjct  68   SEKLKELNLGGTQRDEYFAWGLHQISKAVSFLNND  102



>ref|XP_002949295.1| hypothetical protein VOLCADRAFT_80567 [Volvox carteri f. nagariensis]
 gb|EFJ49788.1| hypothetical protein VOLCADRAFT_80567 [Volvox carteri f. nagariensis]
Length=696

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 88/129 (68%), Gaps = 4/129 (3%)
 Frame = +2

Query  206  LPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRH  385
             PY    PY SAWG W HYRG SK+D +PVSIF +S ++ ND  L   RNGVKRL+ +RH
Sbjct  15   FPYVIEEPYDSAWGQWTHYRGKSKEDNSPVSIFKISATDPNDRKLVCARNGVKRLKMLRH  74

Query  386  PNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRIT  565
            PNIL+F  S+E  T  G+T    I +VTEPV PL + LKEL L G  RDEY+A G+  IT
Sbjct  75   PNILAFKDSSET-TEKGAT---AIMLVTEPVKPLKDVLKELELEGQHRDEYFAMGMLHIT  130

Query  566  KAVSFLNND  592
             AVSFLNND
Sbjct  131  NAVSFLNND  139



>ref|XP_001693766.1| protein kinase [Chlamydomonas reinhardtii]
 gb|EDP09020.1| protein kinase [Chlamydomonas reinhardtii]
Length=816

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 86/129 (67%), Gaps = 4/129 (3%)
 Frame = +2

Query  206  LPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRH  385
             PY     Y S+WG W H+RG SKDD +PVSIF +S ++ ND  L   RNGVKRL+ +RH
Sbjct  15   FPYTLEEAYESSWGQWTHHRGKSKDDNSPVSIFRISATDPNDRKLVCARNGVKRLKMLRH  74

Query  386  PNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRIT  565
            PN+L++  STE+    G+T    I +VTEPV PL E LKEL L G  RDEYY+ G+  + 
Sbjct  75   PNLLAYKDSTEMNE-KGAT---VIMLVTEPVKPLKEVLKELDLQGQHRDEYYSMGMLHMA  130

Query  566  KAVSFLNND  592
             AVSFLNND
Sbjct  131  NAVSFLNND  139



>ref|XP_005649821.1| ARM repeat-containing protein, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25277.1| ARM repeat-containing protein, partial [Coccomyxa subellipsoidea 
C-169]
Length=529

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 86/130 (66%), Gaps = 5/130 (4%)
 Frame = +2

Query  206  LPYXXXXPYSSAWG-SWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVR  382
             PY     Y  AWG SW HY GT+++DG+ VSIF +S +NAND  L A RNGVKRL+ VR
Sbjct  15   FPYNLGKAYGVAWGASWTHYEGTTREDGSAVSIFKVSSTNANDRTLQAARNGVKRLKMVR  74

Query  383  HPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRI  562
            HPN+L+   + EVE   G T   +IYI+TEPV PL + L+EL + G  R E+ A GL  I
Sbjct  75   HPNVLALRDTLEVEE-KGCT---SIYIITEPVTPLIDVLEELDVAGPARCEFVAMGLFHI  130

Query  563  TKAVSFLNND  592
             KAV FLNND
Sbjct  131  AKAVGFLNND  140



>gb|KIZ00224.1| putative inactive serine/threonine-protein kinase scy1 [Monoraphidium 
neglectum]
Length=141

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = +2

Query  227  PYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFL  406
            PYS AWG W HY  TSK+DG+P S+F L  ++ ND  LAA RNGVKRLR +RHPN+LSF 
Sbjct  26   PYSQAWGCWTHYPATSKEDGSPASVFKLIAADPNDRKLAAARNGVKRLRMLRHPNVLSFK  85

Query  407  HSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQR  529
             S E +   G+     IY+VTEPV PL   L+EL L GT R
Sbjct  86   DSLEAQEKGGT----AIYLVTEPVKPLAMVLRELDLSGTHR  122



>ref|XP_002506852.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO68110.1| predicted protein, partial [Micromonas sp. RCC299]
Length=560

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 80/134 (60%), Gaps = 12/134 (9%)
 Frame = +2

Query  206  LPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGH-----LAAGRNGVKRL  370
            L Y     Y  A G W HYR TSK+DG+P S+F       ND H     +   RNG KRL
Sbjct  23   LNYDLGEAYPRAAGGWTHYRATSKEDGSPASVFKFV---CNDVHKERVRVEVARNGAKRL  79

Query  371  RTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWG  550
            +T RHPNIL    S EVE  D    K+TIY+VTE VMPL E LK+L    +QRDEYYA G
Sbjct  80   KTTRHPNILMLKDSLEVEEGD----KLTIYVVTESVMPLEEHLKDLPTSTSQRDEYYALG  135

Query  551  LHRITKAVSFLNND  592
            + ++  AVSFL ND
Sbjct  136  IRQVATAVSFLAND  149



>ref|XP_011397583.1| putative inactive serine/threonine-protein kinase scy1 [Auxenochlorella 
protothecoides]
 gb|KFM24695.1| putative inactive serine/threonine-protein kinase scy1 [Auxenochlorella 
protothecoides]
Length=969

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 77/129 (60%), Gaps = 4/129 (3%)
 Frame = +2

Query  206  LPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRH  385
            LP       S  WGSW H  G  K DG+ VS+F ++ SN +D  LAA RNG KRLRT+RH
Sbjct  15   LPLEVTGEPSLIWGSWTHTSGKWKADGSAVSVFRVASSNPSDPKLAAARNGTKRLRTLRH  74

Query  386  PNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRIT  565
            PN+L F  + E+E       +  IY++TEP++PL E L+   L GT R EY   G H + 
Sbjct  75   PNVLIFKETLELE----EKGEQVIYLITEPIVPLAEFLESTTLTGTDRQEYLTMGFHALV  130

Query  566  KAVSFLNND  592
             AVSFLN D
Sbjct  131  AAVSFLNID  139



>ref|XP_003058843.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH57298.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=580

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 80/131 (61%), Gaps = 6/131 (5%)
 Frame = +2

Query  206  LPYXXXXPY-SSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDG-HLAAGRNGVKRLRTV  379
            L Y    PY + A+G W HYRG SK+DG+ VS+F   G+   D   +A  RNG KRL+ +
Sbjct  21   LNYDLGEPYRAGAFGPWTHYRGVSKEDGSAVSVFKFVGNVDQDRVRIATARNGAKRLKLI  80

Query  380  RHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHR  559
            RHP +L    S EVE    +  ++TIY+VTE V PL E L++L     Q  +Y+A GL +
Sbjct  81   RHPCVLLVKDSLEVE----NGPELTIYVVTEAVTPLTEHLRDLPTSTDQAHDYFALGLRQ  136

Query  560  ITKAVSFLNND  592
            I  AVSFL+ND
Sbjct  137  IATAVSFLSND  147



>ref|XP_005843618.1| hypothetical protein CHLNCDRAFT_140213 [Chlorella variabilis]
 gb|EFN51516.1| hypothetical protein CHLNCDRAFT_140213 [Chlorella variabilis]
Length=702

 Score =   106 bits (264),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 56/122 (46%), Positives = 75/122 (61%), Gaps = 6/122 (5%)
 Frame = +2

Query  227  PYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFL  406
            P SS++ +W H+RGT+K DG+PVS+F L+G +  D  L AGRN  KRLRT+RHP +L F 
Sbjct  24   PSSSSFCNWQHFRGTTKADGSPVSVFRLAGPSKGDQRLEAGRNAAKRLRTLRHPAVLVFK  83

Query  407  HSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLN  586
               EVE       +  +Y+VTE V PL   L ++ L  T R +Y + GL     A+SFL 
Sbjct  84   ELVEVE----ERGEAVVYLVTEAVTPLSLVLSDMDL--TTRQQYLSMGLGATVGALSFLA  137

Query  587  ND  592
            ND
Sbjct  138  ND  139



>gb|ENN70165.1| hypothetical protein YQE_00024, partial [Dendroctonus ponderosae]
Length=200

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 69/114 (61%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            W  ++G  K  G  VS+F     + +D  L   +  VKRL+T+RHP++L+FL S E E +
Sbjct  30   WTLHKGKKKGSGEEVSVFVYDLKSGSDAQLEVAKGAVKRLKTLRHPSVLTFLDSLESEKL  89

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
                    +Y+VTE V PLC  L++L L   Q+D Y AWG+ +IT+ +SFLNND
Sbjct  90   --------LYLVTERVEPLCTHLEKLPLEEPQKDLYVAWGIFQITRGLSFLNND  135



>ref|XP_007310874.1| ARM repeat-containing protein [Stereum hirsutum FP-91666 SS1]
 gb|EIM79915.1| ARM repeat-containing protein [Stereum hirsutum FP-91666 SS1]
Length=722

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 72/115 (63%), Gaps = 10/115 (9%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGH-LAAGRNGVKRLRTVRHPNILSFLHSTEVET  427
            W  Y GT +DDG+PVSIF   GS  N  + L   +N +++LR +RHP++L F+ + E ET
Sbjct  40   WTLYDGTKRDDGSPVSIFEFDGSQPNKRNVLPLAKNTLRKLRVMRHPDVLKFMDAVETET  99

Query  428  VDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQ-RDEYYAWGLHRITKAVSFLNN  589
                    TIYI+TEPV PL  +L+ +     Q + ++  WGLHRIT A++F+N+
Sbjct  100  --------TIYIMTEPVRPLAAELQSMSGKSVQDKQDWLLWGLHRITTALAFVND  146



>gb|EFA75473.1| N-terminal kinase-like protein [Polysphondylium pallidum PN500]
Length=286

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 73/131 (56%), Gaps = 15/131 (11%)
 Frame = +2

Query  206  LPYXXXXPYSSAWGS--WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTV  379
             PY    P +S  G   W    GT KDDG+ VSIF       N   L   +NG KR +T+
Sbjct  11   FPYQIGTPITSYQGKSIWTLSNGTKKDDGSAVSIFTFD-VKKNPTKLEVAKNGFKRAKTI  69

Query  380  RHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHR  559
            RHPN L++L        DG  T   IYIVTEPV PL E ++++     + +   +WG+++
Sbjct  70   RHPNFLTYL--------DGLETDTNIYIVTEPVTPLDESIEDI----RKYENAISWGVYQ  117

Query  560  ITKAVSFLNND  592
            ITKA+SF+NND
Sbjct  118  ITKALSFINND  128



>gb|ERL88617.1| hypothetical protein D910_06002 [Dendroctonus ponderosae]
Length=721

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 69/114 (61%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            W  ++G  K  G  VS+F     + +D  L   +  VKRL+T+RHP++L+FL S E E +
Sbjct  30   WTLHKGKKKGSGEEVSVFVYDLKSGSDAQLEVAKGAVKRLKTLRHPSVLTFLDSLESEKL  89

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
                    +Y+VTE V PLC  L++L L   Q+D Y AWG+ +IT+ +SFLNND
Sbjct  90   --------LYLVTERVEPLCTHLEKLPLEEPQKDLYVAWGIFQITRGLSFLNND  135



>ref|XP_003437215.1| AGAP001091-PB [Anopheles gambiae str. PEST]
 gb|EGK97330.1| AGAP001091-PB [Anopheles gambiae str. PEST]
Length=904

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 70/132 (53%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYXXXXPYS--SAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D PY    P    +    W  +RG  K     VS+F     N +D  L   R  +KRL+T
Sbjct  12   DFPYEIGDPVQQFNTKSIWSLFRGKRKGSNDEVSVFTYDIKNGSDIKLELARAALKRLKT  71

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHP+IL FL S E + V        +Y+ TEPV PL   +  L   G QRD Y AWG+ 
Sbjct  72   LRHPSILQFLDSLESDKV--------LYVATEPVEPLGTHIGNLAAQGPQRDLYLAWGIF  123

Query  557  RITKAVSFLNND  592
            +IT+A+SFLNND
Sbjct  124  QITRALSFLNND  135



>ref|XP_318327.5| AGAP001091-PA [Anopheles gambiae str. PEST]
 gb|EAA13516.5| AGAP001091-PA [Anopheles gambiae str. PEST]
Length=889

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 70/132 (53%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYXXXXPYS--SAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D PY    P    +    W  +RG  K     VS+F     N +D  L   R  +KRL+T
Sbjct  12   DFPYEIGDPVQQFNTKSIWSLFRGKRKGSNDEVSVFTYDIKNGSDIKLELARAALKRLKT  71

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHP+IL FL S E + V        +Y+ TEPV PL   +  L   G QRD Y AWG+ 
Sbjct  72   LRHPSILQFLDSLESDKV--------LYVATEPVEPLGTHIGNLAAQGPQRDLYLAWGIF  123

Query  557  RITKAVSFLNND  592
            +IT+A+SFLNND
Sbjct  124  QITRALSFLNND  135



>dbj|GAM20001.1| hypothetical protein SAMD00019534_031760 [Acytostelium subglobosum 
LB1]
Length=794

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 54/131 (41%), Positives = 75/131 (57%), Gaps = 15/131 (11%)
 Frame = +2

Query  206  LPYXXXXPYSSAWGS--WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTV  379
             PY    P +S  G   W  + GT KDDG+PVSIF+      +   +   +NG KR +T+
Sbjct  11   FPYVIGTPITSYQGKSIWTLHTGTKKDDGSPVSIFSFD-IKKSPAKIDVAKNGFKRAKTI  69

Query  380  RHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHR  559
            RHPN L++L   E+ET         IYIVTEPV PL E + ++     + D   +WG+++
Sbjct  70   RHPNFLTYLDGIELET--------NIYIVTEPVTPLDELIDDI----RKYDNAISWGVYQ  117

Query  560  ITKAVSFLNND  592
            ITKA+SF NND
Sbjct  118  ITKALSFANND  128



>gb|KFB40085.1| AGAP001091-PB-like protein [Anopheles sinensis]
Length=711

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 69/132 (52%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYXXXXPYSS--AWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D PY    P         W  +RG  K+    VS+F     +  D      +  VKRL+T
Sbjct  12   DFPYEIGDPVQQFDTKSIWSLHRGKRKNTNDEVSVFTYDIKSGTDIKFELAKAAVKRLKT  71

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHP+IL FL S E + V        +Y+ TEPV PL   + +L   G QRD Y AWG+ 
Sbjct  72   LRHPSILQFLDSLETDKV--------LYVATEPVEPLGTHINKLATSGPQRDLYLAWGIF  123

Query  557  RITKAVSFLNND  592
            +IT+A+SFLNND
Sbjct  124  QITRALSFLNND  135



>gb|KDD72431.1| hypothetical protein H632_c3357p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=213

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 70/117 (60%), Gaps = 6/117 (5%)
 Frame = +2

Query  242  WGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEV  421
            WG W H+ GT + D +PVS+F  + ++  D  LAA RNG+KRLR +RHP+IL+F  + E 
Sbjct  27   WGIWTHHHGTWRADQSPVSVFRTASTSKLDAKLAAARNGIKRLRMLRHPDILAFKDTAEA  86

Query  422  ETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            E       +  +Y+VTE +  L   L+  G    +R+ + + GL R+  A+SFLN D
Sbjct  87   E----EKGETVLYLVTERMTLLPVFLE--GADAAEREAWVSLGLQRVLSALSFLNRD  137



>gb|KDR10579.1| N-terminal kinase-like protein [Zootermopsis nevadensis]
Length=796

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 71/132 (54%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYXXXXPYSSAWGS--WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D PY    P         W  ++G  K  G  VSIF     N ++     G+  VKRL+T
Sbjct  12   DFPYDIGEPVPGLEDKSVWSLHKGKKKGSGEEVSIFVFDIKNGSETQFDVGKTAVKRLKT  71

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHP+IL++L S E E +        +Y+ TE V PL   + +L   G QR+ Y AWG+ 
Sbjct  72   LRHPSILTYLDSFESEKI--------LYLATEYVEPLETHITQLSKEGHQRELYLAWGIF  123

Query  557  RITKAVSFLNND  592
            +IT+A+SFLNND
Sbjct  124  QITRALSFLNND  135



>ref|XP_003082766.1| putative kinase-like protein splice variant 1 (ISS) [Ostreococcus 
tauri]
 emb|CAL56623.1| Protein kinase-like domain [Ostreococcus tauri]
Length=834

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 71/123 (58%), Gaps = 7/123 (6%)
 Frame = +2

Query  233  SSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGH-LAAGRNGVKRLRTVRHPNILSFLH  409
            + + G W H  GTS++ G  VS+F   G    D   L   RNGV+RL+T+RHPN+L    
Sbjct  29   ARSLGRWTHAGGTSRESGERVSVFTFRGDAQRDARALEIARNGVRRLKTMRHPNVLLVKE  88

Query  410  STEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVG--TQRDEYYAWGLHRITKAVSFL  583
            + EVET     +++ +++VTEP  PL   L+E+   G  +Q  EY   G+  I  AV+FL
Sbjct  89   TLEVET----GSEIALHVVTEPTTPLETHLREIARGGSDSQGGEYLLLGIREIATAVAFL  144

Query  584  NND  592
            NND
Sbjct  145  NND  147



>gb|ETN64322.1| hypothetical protein AND_003938 [Anopheles darlingi]
Length=922

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 69/132 (52%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYXXXXPYSS--AWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D PY    P +   A   W  +RG  K     VS+F        +  L   +  VKRL+T
Sbjct  12   DFPYEIGEPVAQFDAKSIWALHRGKRKGTNDEVSVFTYDIRAGTEIKLELAKVAVKRLKT  71

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHP+IL FL S E + +        +Y+ TEPV PL   +  L   G QRD Y AWG+ 
Sbjct  72   LRHPSILQFLDSLETDKM--------LYVATEPVEPLGTHITRLASEGPQRDLYLAWGIF  123

Query  557  RITKAVSFLNND  592
            +IT+A+SFLNND
Sbjct  124  QITRALSFLNND  135



>emb|CAG09756.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=804

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 65/116 (56%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K +G PVS+F    +   D      +   KR++T+RHPNIL++       
Sbjct  26   GIWTLHRGKRKTNGEPVSVFVYEVAQGTDQQTQLAKAAFKRMKTLRHPNILAY-------  78

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             VDG  T+ ++Y+VTE V PL   LK     G   D  ++WGLH+I KA+SFL ND
Sbjct  79   -VDGLETEKSLYLVTEQVTPLAAHLKAQAEKGGAADLEFSWGLHQIVKALSFLVND  133



>ref|XP_001653616.1| AAEL008954-PA [Aedes aegypti]
 gb|EAT39222.1| AAEL008954-PA [Aedes aegypti]
Length=861

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 70/133 (53%), Gaps = 11/133 (8%)
 Frame = +2

Query  203  DLPYXXXXPYSS--AWGSWVHYRGTSK-DDGAPVSIFALSGSNANDGHLAAGRNGVKRLR  373
            D PY    P     +   W  +RG  K  +G  VS+F     N  D  L   R  VKRL+
Sbjct  12   DFPYEIGEPVPQFDSRSIWSLHRGKRKGTNGEEVSVFVYDIKNGTDVKLELARAAVKRLK  71

Query  374  TVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGL  553
            T+RHP+IL FL S E + V        +Y+ TE V PL    ++    G QRD Y AWG+
Sbjct  72   TLRHPSILQFLDSLETDKV--------LYVATEQVEPLGTHFEKQAGEGPQRDLYLAWGI  123

Query  554  HRITKAVSFLNND  592
             +IT+A+SFLNND
Sbjct  124  FQITRALSFLNND  136



>gb|EFA06008.1| hypothetical protein TcasGA2_TC008834 [Tribolium castaneum]
Length=716

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 67/114 (59%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            W  ++G  K     VS+F       ++  L   +  VKRL+T+RHP+IL++L S E + V
Sbjct  30   WTLHKGKRKGTNEEVSVFVFDIKGGSETQLEIAKAAVKRLKTLRHPSILTYLDSYESDKV  89

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
                    +Y+ TE V PL   L++L + G Q+D Y AWGL +IT+A+SFLNND
Sbjct  90   --------LYLATEHVEPLASHLEKLTIEGAQKDLYIAWGLFQITRALSFLNND  135



>ref|XP_975488.1| PREDICTED: N-terminal kinase-like protein [Tribolium castaneum]
Length=746

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 67/114 (59%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            W  ++G  K     VS+F       ++  L   +  VKRL+T+RHP+IL++L S E + V
Sbjct  30   WTLHKGKRKGTNEEVSVFVFDIKGGSETQLEIAKAAVKRLKTLRHPSILTYLDSYESDKV  89

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
                    +Y+ TE V PL   L++L + G Q+D Y AWGL +IT+A+SFLNND
Sbjct  90   --------LYLATEHVEPLASHLEKLTIEGAQKDLYIAWGLFQITRALSFLNND  135



>ref|XP_001332508.1| PREDICTED: N-terminal kinase-like protein [Danio rerio]
Length=855

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 62/116 (53%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W   RG  K  G PVS+F    S   +      +   KR +T+RHPNILS+       
Sbjct  26   GIWTLSRGKRKSTGEPVSVFVYEVSQGTEEQTQLAKAAFKRTKTLRHPNILSY-------  78

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             VDG  T+ ++YIVTEPV PL   LK     G   D   +WGLH+I KA+SFL ND
Sbjct  79   -VDGLETEKSLYIVTEPVTPLAAHLKLQAEKGGASDLEVSWGLHQIVKALSFLVND  133



>emb|CCL98356.1| predicted protein [Fibroporia radiculosa]
Length=891

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 70/115 (61%), Gaps = 10/115 (9%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSN-ANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVET  427
            W  Y G+ +DDG+P+SIF    +  A    L   +N +++LRTVRHP++L F+ + E +T
Sbjct  40   WALYEGSKRDDGSPISIFEFDANTPAKKNILPLAKNALRKLRTVRHPDVLRFMDAVETDT  99

Query  428  VDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQ-RDEYYAWGLHRITKAVSFLNN  589
                    TIYI+TE + PL   + +    G Q ++++  WGLHRI+ A++F+N+
Sbjct  100  --------TIYIMTERIQPLASAVSQWSSKGAQEKEDWLIWGLHRISVALAFVND  146



>ref|XP_007883863.1| PREDICTED: N-terminal kinase-like protein [Callorhinchus milii]
Length=875

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 67/116 (58%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G+W  ++G  K  G PVSIF       ++    A +  +KRL+T+RHPN+LSF       
Sbjct  28   GAWGLHQGKKKGTGEPVSIFIYEVKPNSEEQTQAAKTALKRLKTLRHPNVLSF-------  80

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             +DG  T+  +YIVTEPV+PL   LK     G   ++  +WGLH+I KA+ FL ND
Sbjct  81   -IDGLETEKCLYIVTEPVVPLAAYLKLKLRNGQLNEQEVSWGLHQIVKALCFLVND  135



>gb|EMD37771.1| hypothetical protein CERSUDRAFT_114433 [Ceriporiopsis subvermispora 
B]
Length=861

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 71/116 (61%), Gaps = 10/116 (9%)
 Frame = +2

Query  248  SWVHYRGTSKDDGAPVSIFAL-SGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            SW  Y  T +DDG+ VS+F   + ++A   +L   +N +++LRTVRHP++L F+ + E +
Sbjct  38   SWTLYDATKRDDGSLVSVFEFDANTSAKKNYLPLAKNALRKLRTVRHPDVLRFMDTVETD  97

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQ-RDEYYAWGLHRITKAVSFLNN  589
            T        TI+I+TE V PL   +      G Q R+EY  WGLHR++ A++F+N+
Sbjct  98   T--------TIHIMTERVRPLASAISAWSSKGAQEREEYLVWGLHRVSVALTFVND  145



>gb|KIP02972.1| hypothetical protein PHLGIDRAFT_78335 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=585

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 76/133 (57%), Gaps = 12/133 (9%)
 Frame = +2

Query  206  LPYXXXXPYSSAWGS--WVHYRGTSKDDGAPVSIFALSGSN-ANDGHLAAGRNGVKRLRT  376
            LP+      +S  G+  W  Y GT +DDG+ +S+F    S      +L   +N +++LRT
Sbjct  23   LPFSLGSKVASYEGNSIWTLYEGTKRDDGSQISVFEFDASQPGKRTYLPLAKNALRKLRT  82

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQ-RDEYYAWGL  553
            VRHP+IL FL + E +T        T+YI+TE V PL   ++E      Q ++++  WG+
Sbjct  83   VRHPDILKFLDAVETDT--------TVYIMTERVRPLAPAIQERASKSAQEKEDWLLWGI  134

Query  554  HRITKAVSFLNND  592
            HRI+ A++F+N +
Sbjct  135  HRISIALAFINEN  147



>ref|XP_004887795.1| PREDICTED: N-terminal kinase-like protein isoform X4 [Heterocephalus 
glaber]
Length=689

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  ++IVTE V PL   LK  G  G  +++  +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHIVTEAVTPLGMYLKARGEAGGLKEQELSWGLHQIVKALSFLVND  134



>ref|XP_004852456.1| PREDICTED: N-terminal kinase-like protein isoform X4 [Heterocephalus 
glaber]
Length=689

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  ++IVTE V PL   LK  G  G  +++  +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHIVTEAVTPLGMYLKARGEAGGLKEQELSWGLHQIVKALSFLVND  134



>gb|KIO04525.1| hypothetical protein M404DRAFT_143205 [Pisolithus tinctorius 
Marx 270]
Length=597

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 75/131 (57%), Gaps = 10/131 (8%)
 Frame = +2

Query  203  DLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNA-NDGHLAAGRNGVKRLRTV  379
            +LP+      SS    W  Y  T +DDG+PVS+F     +  N   +   RN +++LRT+
Sbjct  22   NLPFILGSKVSSCETFWTLYDATKRDDGSPVSVFEYDLIHPLNKSTIPLARNALRKLRTI  81

Query  380  RHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQ-RDEYYAWGLH  556
            RHP+IL F+   E ++         I+I+TE V PL   L+ +   G+Q R+E+  WGLH
Sbjct  82   RHPDILKFMDVVESDS--------AIFIMTERVKPLQTALQTMPPRGSQEREEWLLWGLH  133

Query  557  RITKAVSFLNN  589
            R++ A++F+N+
Sbjct  134  RVSVALAFIND  144



>ref|XP_007766334.1| ARM repeat-containing protein [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW82556.1| ARM repeat-containing protein [Coniophora puteana RWD-64-598 
SS2]
Length=634

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 73/130 (56%), Gaps = 10/130 (8%)
 Frame = +2

Query  203  DLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSN-ANDGHLAAGRNGVKRLRTV  379
            +LP+      +S    W  Y  T +DDG+PVS+F    +N AN   +   RN +++LRT 
Sbjct  22   NLPFSLGQKVASCGTLWTLYDATKRDDGSPVSVFEYDFTNPANKNTIPLARNALRKLRTT  81

Query  380  RHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGT-QRDEYYAWGLH  556
            RHP++L F+ + E ++         IYI+TE V PL   L      G  +R+++  WGLH
Sbjct  82   RHPDVLKFMDAVEADS--------GIYIMTERVKPLSVTLPLWASKGAKEREDWLLWGLH  133

Query  557  RITKAVSFLN  586
            RI+ A++F+N
Sbjct  134  RISVALAFIN  143



>ref|XP_009547092.1| hypothetical protein HETIRDRAFT_319485 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW80329.1| hypothetical protein HETIRDRAFT_319485 [Heterobasidion irregulare 
TC 32-1]
Length=710

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 67/115 (58%), Gaps = 11/115 (10%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  Y  T +DDGAPVS+F    +    G L   +N +++LR  RHP++L F+ + E +
Sbjct  35   GIWALYDATRRDDGAPVSVFEFDTT--LKGLLPLAKNALRKLRVTRHPDVLKFMDAVETD  92

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQ-RDEYYAWGLHRITKAVSFLN  586
            T        T+YI+TE V PL  +L+ L     Q + ++  WGLHRIT A++F+N
Sbjct  93   T--------TVYIMTERVRPLQSELQNLSTKNVQDKQDWLLWGLHRITTALAFVN  139



>ref|XP_004808231.1| PREDICTED: N-terminal kinase-like protein isoform X1 [Mustela 
putorius furo]
Length=807

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 64/114 (56%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        D      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGADEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  +++VTE V PL   LKE    G  ++   +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHVVTEAVTPLKMYLKERAEAGGLKELELSWGLHQIVKALSFLVND  134



>ref|XP_004770100.1| PREDICTED: N-terminal kinase-like protein isoform X2 [Mustela 
putorius furo]
 ref|XP_004808233.1| PREDICTED: N-terminal kinase-like protein isoform X3 [Mustela 
putorius furo]
Length=793

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 64/114 (56%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        D      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGADEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  +++VTE V PL   LKE    G  ++   +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHVVTEAVTPLKMYLKERAEAGGLKELELSWGLHQIVKALSFLVND  134



>ref|XP_004770099.1| PREDICTED: N-terminal kinase-like protein isoform X1 [Mustela 
putorius furo]
 ref|XP_004808232.1| PREDICTED: N-terminal kinase-like protein isoform X2 [Mustela 
putorius furo]
Length=810

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 64/114 (56%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        D      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGADEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  +++VTE V PL   LKE    G  ++   +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHVVTEAVTPLKMYLKERAEAGGLKELELSWGLHQIVKALSFLVND  134



>ref|XP_003288328.1| hypothetical protein DICPUDRAFT_55347 [Dictyostelium purpureum]
 gb|EGC35135.1| hypothetical protein DICPUDRAFT_55347 [Dictyostelium purpureum]
Length=749

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 45/114 (39%), Positives = 67/114 (59%), Gaps = 13/114 (11%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            W  ++GT KDDG+ VSIF       N   L   +NG KR +T+RHPN + +L        
Sbjct  34   WTLHQGTKKDDGSAVSIFNFD-VKKNPSKLEVAKNGFKRAKTIRHPNFIKYL--------  84

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG   +  IYIVTEPV PL E+++++       +   +WG++++TK ++FLNND
Sbjct  85   DGMENESNIYIVTEPVQPLDEQIEDI----RSFENAISWGIYQVTKGLAFLNND  134



>ref|XP_004852453.1| PREDICTED: N-terminal kinase-like protein isoform X1 [Heterocephalus 
glaber]
Length=807

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  ++IVTE V PL   LK  G  G  +++  +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHIVTEAVTPLGMYLKARGEAGGLKEQELSWGLHQIVKALSFLVND  134



>ref|XP_004887792.1| PREDICTED: N-terminal kinase-like protein isoform X1 [Heterocephalus 
glaber]
 gb|EHB04883.1| kinase-like protein [Heterocephalus glaber]
Length=807

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  ++IVTE V PL   LK  G  G  +++  +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHIVTEAVTPLGMYLKARGEAGGLKEQELSWGLHQIVKALSFLVND  134



>emb|CDQ83630.1| unnamed protein product [Oncorhynchus mykiss]
Length=634

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 63/116 (54%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K  G PVS+F    S   +      +   KR++T+RHPNIL++       
Sbjct  26   GIWTLHRGKRKTGGEPVSVFVYDVSTGTEEQTQLAKAAFKRMKTLRHPNILAY-------  78

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             VDG  T+ ++Y+VTE V PL   LK     G   D   +WGLH+I KA+SFL ND
Sbjct  79   -VDGLETEKSLYLVTEQVTPLAAHLKAQSDRGGSGDLEMSWGLHQIVKALSFLVND  133



>ref|XP_005631807.1| PREDICTED: N-terminal kinase-like protein [Canis lupus familiaris]
Length=770

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        D      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGADEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T   +++VTE V PL   LKE    G  ++   +WGLH+I KA+SFL ND
Sbjct  81   DGLETDKCLHVVTEAVTPLGMYLKERAEAGGLKELELSWGLHQIVKALSFLVND  134



>ref|XP_004852455.1| PREDICTED: N-terminal kinase-like protein isoform X3 [Heterocephalus 
glaber]
Length=794

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  ++IVTE V PL   LK  G  G  +++  +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHIVTEAVTPLGMYLKARGEAGGLKEQELSWGLHQIVKALSFLVND  134



>ref|XP_004887794.1| PREDICTED: N-terminal kinase-like protein isoform X3 [Heterocephalus 
glaber]
Length=794

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  ++IVTE V PL   LK  G  G  +++  +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHIVTEAVTPLGMYLKARGEAGGLKEQELSWGLHQIVKALSFLVND  134



>ref|XP_004852454.1| PREDICTED: N-terminal kinase-like protein isoform X2 [Heterocephalus 
glaber]
Length=810

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  ++IVTE V PL   LK  G  G  +++  +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHIVTEAVTPLGMYLKARGEAGGLKEQELSWGLHQIVKALSFLVND  134



>ref|XP_004887793.1| PREDICTED: N-terminal kinase-like protein isoform X2 [Heterocephalus 
glaber]
Length=810

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  ++IVTE V PL   LK  G  G  +++  +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHIVTEAVTPLGMYLKARGEAGGLKEQELSWGLHQIVKALSFLVND  134



>ref|XP_001421161.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 ref|XP_001422794.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99454.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP01153.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=613

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 47/122 (39%), Positives = 71/122 (58%), Gaps = 8/122 (7%)
 Frame = +2

Query  239  AWGSWVHYRGTSKDDGAPVSIFALSGS-NANDGHLAAGRNGVKRLRTVRHPNILSFLHST  415
            A+G W H RGT ++ G   SIF      N +   +   +NG +R++T+RHPN+L      
Sbjct  27   AFGVWTHRRGTCQETGEEHSIFTFHADVNRDQQRVRLAKNGARRMKTLRHPNVLLVKDVI  86

Query  416  EVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVG---TQRDEYYAWGLHRITKAVSFLN  586
            E+E    S  ++TI++VTE V PL   L+E  + G    QRD+Y++ G+  I  AV+FL+
Sbjct  87   EIE----SGNELTIHVVTEAVTPLEAHLREAPIGGGGNGQRDDYFSLGVREIATAVAFLS  142

Query  587  ND  592
            ND
Sbjct  143  ND  144



>ref|XP_004264405.1| PREDICTED: N-terminal kinase-like protein isoform 2 [Orcinus 
orca]
Length=792

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 67/132 (51%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYXXX--XPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D P+      P     G WV +RG  K  G+PVSIF        +      +   KRL+T
Sbjct  11   DFPFELSPELPEGGPPGPWVLHRGRKKATGSPVSIFVYDVKPGVEEQTQVAKAAFKRLKT  70

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHPNIL++        +DG  T   ++IVTE V PL   LK     G  R+   +WGLH
Sbjct  71   LRHPNILAY--------IDGLETDRCLHIVTEAVTPLGAYLKARAEAGDLRELELSWGLH  122

Query  557  RITKAVSFLNND  592
            +I KA+SFL ND
Sbjct  123  QIVKALSFLVND  134



>ref|XP_004328663.1| PREDICTED: N-terminal kinase-like protein isoform 2 [Tursiops 
truncatus]
Length=793

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 67/132 (51%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYXXX--XPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D P+      P     G WV +RG  K  G+PVSIF        +      +   KRL+T
Sbjct  11   DFPFELSPELPEGGPPGPWVLHRGRKKATGSPVSIFVYDVKPGVEEQTQVAKAAFKRLKT  70

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHPNIL++        +DG  T   ++IVTE V PL   LK     G  R+   +WGLH
Sbjct  71   LRHPNILAY--------IDGLETDRCLHIVTEAVTPLGAYLKARAEAGDLRELELSWGLH  122

Query  557  RITKAVSFLNND  592
            +I KA+SFL ND
Sbjct  123  QIVKALSFLVND  134



>ref|XP_004328662.1| PREDICTED: N-terminal kinase-like protein isoform 1 [Tursiops 
truncatus]
Length=810

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 67/132 (51%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYXXX--XPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D P+      P     G WV +RG  K  G+PVSIF        +      +   KRL+T
Sbjct  11   DFPFELSPELPEGGPPGPWVLHRGRKKATGSPVSIFVYDVKPGVEEQTQVAKAAFKRLKT  70

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHPNIL++        +DG  T   ++IVTE V PL   LK     G  R+   +WGLH
Sbjct  71   LRHPNILAY--------IDGLETDRCLHIVTEAVTPLGAYLKARAEAGDLRELELSWGLH  122

Query  557  RITKAVSFLNND  592
            +I KA+SFL ND
Sbjct  123  QIVKALSFLVND  134



>ref|XP_006937568.1| PREDICTED: N-terminal kinase-like protein isoform X1 [Felis catus]
Length=806

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T   +++VTE V PL   LKE    G  +D   +WGLH+I KA+SFL ND
Sbjct  81   DGLETDKCLHVVTEAVTPLGMYLKERAEAGGLKDLELSWGLHQIVKALSFLVND  134



>ref|XP_004394003.1| PREDICTED: N-terminal kinase-like protein isoform 2 [Odobenus 
rosmarus divergens]
Length=793

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        D      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGADEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T   +++VTE V PL   LKE    G  ++   +WGLH+I KA+SFL ND
Sbjct  81   DGLETDRCLHVVTEAVTPLKMYLKERAEAGGLKELELSWGLHQIVKALSFLVND  134



>ref|XP_006937569.1| PREDICTED: N-terminal kinase-like protein isoform X2 [Felis catus]
Length=805

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T   +++VTE V PL   LKE    G  +D   +WGLH+I KA+SFL ND
Sbjct  81   DGLETDKCLHVVTEAVTPLGMYLKERAEAGGLKDLELSWGLHQIVKALSFLVND  134



>ref|XP_004264404.1| PREDICTED: N-terminal kinase-like protein isoform 1 [Orcinus 
orca]
Length=809

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 67/132 (51%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYXXX--XPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D P+      P     G WV +RG  K  G+PVSIF        +      +   KRL+T
Sbjct  11   DFPFELSPELPEGGPPGPWVLHRGRKKATGSPVSIFVYDVKPGVEEQTQVAKAAFKRLKT  70

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHPNIL++        +DG  T   ++IVTE V PL   LK     G  R+   +WGLH
Sbjct  71   LRHPNILAY--------IDGLETDRCLHIVTEAVTPLGAYLKARAEAGDLRELELSWGLH  122

Query  557  RITKAVSFLNND  592
            +I KA+SFL ND
Sbjct  123  QIVKALSFLVND  134



>ref|XP_006737191.1| PREDICTED: N-terminal kinase-like protein isoform X2 [Leptonychotes 
weddellii]
Length=793

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        D      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGADEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T   +++VTE V PL   LKE    G  ++   +WGLH+I KA+SFL ND
Sbjct  81   DGLETDKCLHVVTEAVTPLKMYLKERAEAGGLKELELSWGLHQIVKALSFLVND  134



>ref|XP_007462063.1| PREDICTED: N-terminal kinase-like protein isoform X1 [Lipotes 
vexillifer]
Length=810

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 67/132 (51%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYXXX--XPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D P+      P     G WV +RG  K  G+PVSIF        +      +   KRL+T
Sbjct  11   DFPFELSPELPEGGPPGPWVLHRGRKKATGSPVSIFVYDVKPGVEEQTQVAKAAFKRLKT  70

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHPNIL++        +DG  T   ++IVTE V PL   LK     G  R+   +WGLH
Sbjct  71   LRHPNILAY--------IDGLETDRCLHIVTEAVTPLGAYLKARAEAGDLRELELSWGLH  122

Query  557  RITKAVSFLNND  592
            +I KA+SFL ND
Sbjct  123  QIVKALSFLVND  134



>ref|XP_006737190.1| PREDICTED: N-terminal kinase-like protein isoform X1 [Leptonychotes 
weddellii]
Length=810

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        D      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGADEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T   +++VTE V PL   LKE    G  ++   +WGLH+I KA+SFL ND
Sbjct  81   DGLETDKCLHVVTEAVTPLKMYLKERAEAGGLKELELSWGLHQIVKALSFLVND  134



>ref|XP_007462064.1| PREDICTED: N-terminal kinase-like protein isoform X2 [Lipotes 
vexillifer]
Length=793

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 67/132 (51%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYXXX--XPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D P+      P     G WV +RG  K  G+PVSIF        +      +   KRL+T
Sbjct  11   DFPFELSPELPEGGPPGPWVLHRGRKKATGSPVSIFVYDVKPGVEEQTQVAKAAFKRLKT  70

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHPNIL++        +DG  T   ++IVTE V PL   LK     G  R+   +WGLH
Sbjct  71   LRHPNILAY--------IDGLETDRCLHIVTEAVTPLGAYLKARAEAGDLRELELSWGLH  122

Query  557  RITKAVSFLNND  592
            +I KA+SFL ND
Sbjct  123  QIVKALSFLVND  134



>ref|XP_004394002.1| PREDICTED: N-terminal kinase-like protein isoform 1 [Odobenus 
rosmarus divergens]
Length=810

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        D      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGADEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T   +++VTE V PL   LKE    G  ++   +WGLH+I KA+SFL ND
Sbjct  81   DGLETDRCLHVVTEAVTPLKMYLKERAEAGGLKELELSWGLHQIVKALSFLVND  134



>ref|XP_003970280.1| PREDICTED: N-terminal kinase-like protein-like [Takifugu rubripes]
Length=855

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 64/116 (55%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K +G PVS+F    +   +      +   KR++T+RHPNIL++       
Sbjct  26   GIWTLHRGKRKTNGEPVSVFVYEVAQGTEQQTQLAKAAFKRMKTLRHPNILAY-------  78

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             VDG  T+ ++Y+VTE V PL   LK     G   D   +WGLH+I KA+SFL ND
Sbjct  79   -VDGLETEKSLYLVTEQVTPLAVHLKAQAEKGGAGDLEVSWGLHQIVKALSFLVND  133



>ref|XP_001744062.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90765.1| predicted protein, partial [Monosiga brevicollis MX1]
Length=589

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 66/111 (59%), Gaps = 11/111 (10%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            W  + G  + DG+PV+IF L    A++  L AG N VKR RT+RHPN+L FL ST+ ET+
Sbjct  1    WRLHHGKQRSDGSPVTIFCLDKKEASEEELKAGLNAVKRSRTLRHPNVLKFLGSTDSETM  60

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFL  583
                    + + TE VMPL + L + G +    D   AWG+ ++TKA+ FL
Sbjct  61   --------LAMATEEVMPLQQLLDDAGAIN---DLGIAWGILQVTKALEFL  100



>ref|XP_010781282.1| PREDICTED: N-terminal kinase-like protein [Notothenia coriiceps]
Length=868

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 67/130 (52%), Gaps = 8/130 (6%)
 Frame = +2

Query  203  DLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVR  382
            D  Y     +    G W  +RG  K +G PVS+F    +   +      +   KR++T+R
Sbjct  12   DFAYEILPDFQEKSGIWSLHRGKRKTNGEPVSVFLYEVAQGTEQQTQLAKAAFKRMKTLR  71

Query  383  HPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRI  562
            HPNIL++        VDG  T+ ++Y+VTE V PL   LK     G   +   +WGLH+I
Sbjct  72   HPNILAY--------VDGLETEKSLYLVTEQVTPLAVHLKAQAEKGGSGELEVSWGLHQI  123

Query  563  TKAVSFLNND  592
             KA+SFL ND
Sbjct  124  VKALSFLVND  133



>ref|XP_007246440.1| PREDICTED: N-terminal kinase-like protein-like [Astyanax mexicanus]
Length=871

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 62/116 (53%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K  G PVSIF    +   +      +   KR++T+RHPNILS+       
Sbjct  26   GIWTLHRGKRKTTGEPVSIFLYEVAQGTEEQTQLAKAAFKRMKTLRHPNILSY-------  78

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             VDG  T  ++Y+VTEPV PL   LK     G   +   +WGLH+  KA+SFL ND
Sbjct  79   -VDGLETDKSLYLVTEPVTPLAAHLKARSESGGSGELEISWGLHQTVKALSFLVND  133



>ref|XP_007171007.1| PREDICTED: N-terminal kinase-like protein isoform X2 [Balaenoptera 
acutorostrata scammoni]
Length=783

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 67/132 (51%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYXXXX--PYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D P+      P     G WV +RG  K  G+PVSIF        +      +   KRL+T
Sbjct  11   DFPFELSPELPEGGPPGPWVLHRGRKKATGSPVSIFVYDVKPGVEEQTQVAKAAFKRLKT  70

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHPNIL++        +DG  T   ++IVTE V PL   LK     G  ++   +WGLH
Sbjct  71   LRHPNILAY--------IDGLETDKCLHIVTEAVTPLGAYLKARAEAGDLKELELSWGLH  122

Query  557  RITKAVSFLNND  592
            +I KA+SFL ND
Sbjct  123  QIVKALSFLVND  134



>ref|XP_007171006.1| PREDICTED: N-terminal kinase-like protein isoform X1 [Balaenoptera 
acutorostrata scammoni]
Length=807

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 67/132 (51%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYXXXX--PYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D P+      P     G WV +RG  K  G+PVSIF        +      +   KRL+T
Sbjct  11   DFPFELSPELPEGGPPGPWVLHRGRKKATGSPVSIFVYDVKPGVEEQTQVAKAAFKRLKT  70

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHPNIL++        +DG  T   ++IVTE V PL   LK     G  ++   +WGLH
Sbjct  71   LRHPNILAY--------IDGLETDKCLHIVTEAVTPLGAYLKARAEAGDLKELELSWGLH  122

Query  557  RITKAVSFLNND  592
            +I KA+SFL ND
Sbjct  123  QIVKALSFLVND  134



>ref|XP_005105749.1| PREDICTED: N-terminal kinase-like protein-like [Aplysia californica]
Length=909

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 46/114 (40%), Positives = 65/114 (57%), Gaps = 9/114 (8%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            W  ++G  K  G PVSIFA     A+D  +   ++ +KR++T+RHPNIL+FL        
Sbjct  30   WTLHQGKKKSTGDPVSIFAFDVKGASDTQVQTAKSSLKRIKTLRHPNILTFL--------  81

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T   IY  TEPV+PL   L++    G   +   +WGLH++ K +SFL ND
Sbjct  82   DGVETDKVIYFATEPVIPLETYLRDHDSEG-HNEVAISWGLHQVVKGLSFLVND  134



>ref|XP_011305760.1| PREDICTED: N-terminal kinase-like protein [Fopius arisanus]
Length=777

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 70/118 (59%), Gaps = 12/118 (10%)
 Frame = +2

Query  251  WVHYRGTSKDD--GAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            W  YR   K    G  VS+F      A +  L   RN VKRL+T+RHP+IL+F+ S E +
Sbjct  30   WTLYRAKKKSTSGGEDVSVFVYDIKAAGESQLEIARNAVKRLKTLRHPSILTFIDSLETD  89

Query  425  TVDGSTTKVTIYIVTEPVMPLCEK-LKELGL-VGTQRDEYYAWGLHRITKAVSFLNND  592
             V        IY+ TE V PL  + LK++ +  G +++ Y+AWG+ +IT+A+SFLNND
Sbjct  90   KV--------IYLATERVEPLHTRLLKKIDIGEGVKKELYFAWGIFQITRALSFLNND  139



>ref|XP_004596738.1| PREDICTED: N-terminal kinase-like protein isoform X2 [Ochotona 
princeps]
Length=788

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGQEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  +++VTE V PL   LK     G  ++   +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHVVTETVTPLGAYLKARSEAGGPKEPELSWGLHQIVKALSFLVND  134



>ref|XP_004596737.1| PREDICTED: N-terminal kinase-like protein isoform X1 [Ochotona 
princeps]
Length=805

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGQEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  +++VTE V PL   LK     G  ++   +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHVVTETVTPLGAYLKARSEAGGPKEPELSWGLHQIVKALSFLVND  134



>ref|XP_008325073.1| PREDICTED: N-terminal kinase-like protein [Cynoglossus semilaevis]
Length=869

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 65/130 (50%), Gaps = 8/130 (6%)
 Frame = +2

Query  203  DLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVR  382
            D  Y          G W  +RG  K  G PVS+F    +   +      +   KR++T+R
Sbjct  12   DFAYEILPDTQEKSGIWSLHRGKRKTSGEPVSVFVYEVTQGTEQQTQLAKAAFKRMKTLR  71

Query  383  HPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRI  562
            HPNIL+F        VDG  T+ ++Y+VTE V PL   LK     G+  +   +WGLH+I
Sbjct  72   HPNILAF--------VDGLETEKSLYLVTEQVTPLAVHLKAQSEKGSGGELEISWGLHQI  123

Query  563  TKAVSFLNND  592
             KA SFL ND
Sbjct  124  VKAQSFLVND  133



>ref|XP_010896649.1| PREDICTED: N-terminal kinase-like protein [Esox lucius]
Length=866

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 63/116 (54%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K  G PVS+F    S   +      +   KR++T+RHPNIL++       
Sbjct  26   GIWTLHRGKRKTGGEPVSVFVYEMSAGTEEQTQLAKAAFKRMKTLRHPNILAY-------  78

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             VDG  T+ ++Y+VTE V PL   LK     G   +   +WGLH+I KA+SFL ND
Sbjct  79   -VDGLETEKSLYLVTEQVTPLATHLKAQSERGGSGELEVSWGLHQIVKALSFLVND  133



>ref|XP_004019945.1| PREDICTED: N-terminal kinase-like protein [Ovis aries]
Length=1080

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 65/122 (53%), Gaps = 8/122 (7%)
 Frame = +2

Query  227  PYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFL  406
            P +   G WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++ 
Sbjct  294  PKARQPGPWVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY-  352

Query  407  HSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLN  586
                   +DG  T   +++VTE V PL   LK     G  ++   +WGLH+I KA+SFL 
Sbjct  353  -------IDGLETDKCLHVVTEAVTPLGVYLKARAEAGGLKELELSWGLHQIVKALSFLV  405

Query  587  ND  592
            ND
Sbjct  406  ND  407



>gb|EGN99569.1| hypothetical protein SERLA73DRAFT_53136 [Serpula lacrymans var. 
lacrymans S7.3]
Length=604

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 73/130 (56%), Gaps = 10/130 (8%)
 Frame = +2

Query  203  DLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNA-NDGHLAAGRNGVKRLRTV  379
            +LP+      +S    W  Y  T +DDG+PVS+F    ++  N   +   RN +++LRT+
Sbjct  22   NLPFSLGQKVTSFETFWNLYDATKRDDGSPVSVFEYDFNHPLNKPTIPLARNALRKLRTI  81

Query  380  RHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGL-VGTQRDEYYAWGLH  556
            RHP++L F+   E +TV        IYI+TE V PL   LK        +R+++  WGLH
Sbjct  82   RHPDVLKFMDVVETDTV--------IYIMTERVRPLPLALKSWSTKSAEEREDWLLWGLH  133

Query  557  RITKAVSFLN  586
            RI+ A++F+N
Sbjct  134  RISVALAFVN  143



>ref|XP_005660762.1| PREDICTED: N-terminal kinase-like protein isoform X4 [Sus scrofa]
Length=794

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 62/114 (54%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            W  +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  +++VTE V PL   LK     G  R+   +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHVVTEAVTPLAAYLKARTETGDLREMELSWGLHQIVKALSFLVND  134



>ref|XP_008292578.1| PREDICTED: N-terminal kinase-like protein [Stegastes partitus]
Length=869

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 63/116 (54%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K +G PVS+F    +   +      +   KR++T+RHPNIL++       
Sbjct  26   GIWTLHRGKRKANGEPVSVFVYEVAQGTEQQTQLAKAAFKRMKTLRHPNILAY-------  78

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             VDG  T  ++Y+VTE V PL   LK     G   +   +WGLH+I KA+SFL ND
Sbjct  79   -VDGLETDKSLYLVTEQVTPLAVHLKAQAEKGGAGELEVSWGLHQIVKALSFLVND  133



>ref|XP_004627298.1| PREDICTED: N-terminal kinase-like protein isoform X2 [Octodon 
degus]
Length=794

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 45/114 (39%), Positives = 64/114 (56%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  ++IVTE V PL   LK     G  +++  +WGLH++ KA+SFL ND
Sbjct  81   DGLETEKCLHIVTEAVTPLGMYLKARAEAGGLKEQELSWGLHQVVKALSFLVND  134



>ref|XP_005660761.1| PREDICTED: N-terminal kinase-like protein isoform X3 [Sus scrofa]
Length=806

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 62/114 (54%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            W  +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  +++VTE V PL   LK     G  R+   +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHVVTEAVTPLAAYLKARTETGDLREMELSWGLHQIVKALSFLVND  134



>ref|XP_007396695.1| hypothetical protein PHACADRAFT_96310 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM53988.1| hypothetical protein PHACADRAFT_96310 [Phanerochaete carnosa 
HHB-10118-sp]
Length=580

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 74/131 (56%), Gaps = 12/131 (9%)
 Frame = +2

Query  206  LPYXXXXPYSSAWGS--WVHYRGTSKDDGAPVSIFALSGSN-ANDGHLAAGRNGVKRLRT  376
            LP+      +S  G   W  Y GT +DDG+ +S+F    +      +L   +N +++LRT
Sbjct  23   LPFSLGPKVTSYEGKSIWTLYEGTKRDDGSAISVFEFDANQPGKRTYLPLAKNSLRKLRT  82

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQ-RDEYYAWGL  553
            VRHP++L FL + E +T        T+YI+TE V PL   ++E      Q ++++  WG+
Sbjct  83   VRHPDVLKFLDAVETDT--------TVYIMTERVRPLAPAIQERASKSAQEKEDWLLWGI  134

Query  554  HRITKAVSFLN  586
            HRI+ +++F+N
Sbjct  135  HRISVSLAFVN  145



>ref|XP_005913411.1| PREDICTED: N-terminal kinase-like protein-like [Haplochromis 
burtoni]
Length=865

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 63/116 (54%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K  G PVS+F    +   +      +   KR++T+RHPNIL++       
Sbjct  26   GIWALHRGKRKTTGEPVSVFVYEVAQGTEQQTQLAKAAFKRMKTLRHPNILAY-------  78

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             VDG  T+ ++Y+VTE V PL   LK     G   +   +WGLH+I KA+SFL ND
Sbjct  79   -VDGLETEKSLYLVTEQVTPLAAHLKARAEKGGVGELEISWGLHQIVKALSFLIND  133



>ref|XP_003798704.1| PREDICTED: N-terminal kinase-like protein isoform 4 [Otolemur 
garnettii]
Length=714

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 70/132 (53%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYXX-XXPYS-SAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D P+     P+  S  G WV +RG  K  G+PVSIF        +      +   KRL+T
Sbjct  11   DFPFELIPEPFEGSPPGPWVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKT  70

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHPNIL++        +DG  T+  +++VTE V PL   LK     G  ++   +WGLH
Sbjct  71   LRHPNILAY--------IDGLETEKCLHVVTEAVTPLGMYLKARVEAGGLKELEISWGLH  122

Query  557  RITKAVSFLNND  592
            +I KA+SFL ND
Sbjct  123  QIVKALSFLVND  134



>ref|XP_004545618.1| PREDICTED: N-terminal kinase-like protein-like [Maylandia zebra]
Length=865

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 63/116 (54%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K  G PVS+F    +   +      +   KR++T+RHPNIL++       
Sbjct  26   GIWTLHRGKRKTTGEPVSVFVYEVAQGTEQQTQLAKAAFKRMKTLRHPNILAY-------  78

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             VDG  T+ ++Y+VTE V PL   LK     G   +   +WGLH+I KA+SFL ND
Sbjct  79   -VDGLETEKSLYLVTEQVTPLAAHLKARAEKGGVGELEISWGLHQIVKALSFLIND  133



>ref|XP_006101615.1| PREDICTED: N-terminal kinase-like protein isoform X2 [Myotis 
lucifugus]
Length=792

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 62/116 (53%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL+F       
Sbjct  27   GPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAF-------  79

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             +DG  T   +++VTE V PL   L+     G  ++   +WGLH+I KA+SFL ND
Sbjct  80   -IDGLETDKCVHVVTEAVTPLGVHLRTRAEAGGPKELELSWGLHQIVKALSFLVND  134



>ref|XP_010836153.1| PREDICTED: N-terminal kinase-like protein [Bison bison bison]
Length=792

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 63/116 (54%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++       
Sbjct  12   GPWVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY-------  64

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             +DG  T   +++VTE V PL   LK     G  ++   +WGLH+I KA+SFL ND
Sbjct  65   -IDGLETDKCLHVVTEAVTPLGVYLKARAEAGGLKELELSWGLHQIVKALSFLVND  119



>ref|XP_004627297.1| PREDICTED: N-terminal kinase-like protein isoform X1 [Octodon 
degus]
Length=810

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/114 (39%), Positives = 64/114 (56%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  ++IVTE V PL   LK     G  +++  +WGLH++ KA+SFL ND
Sbjct  81   DGLETEKCLHIVTEAVTPLGMYLKARAEAGGLKEQELSWGLHQVVKALSFLVND  134



>ref|XP_005723139.1| PREDICTED: N-terminal kinase-like protein-like [Pundamilia nyererei]
Length=866

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 63/116 (54%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K  G PVS+F    +   +      +   KR++T+RHPNIL++       
Sbjct  26   GIWTLHRGKRKTTGEPVSVFVYEVAQGTEQQTQLAKAAFKRMKTLRHPNILAY-------  78

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             VDG  T+ ++Y+VTE V PL   LK     G   +   +WGLH+I KA+SFL ND
Sbjct  79   -VDGLETEKSLYLVTEQVTPLAAHLKARAEKGGVGELEISWGLHQIVKALSFLIND  133



>ref|XP_002126730.2| PREDICTED: N-terminal kinase-like protein [Ciona intestinalis]
Length=869

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/113 (40%), Positives = 63/113 (56%), Gaps = 8/113 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            W  + G  K +G PVS+F    +++N+      +   KRL+T+RHPN+L+F+ S E    
Sbjct  31   WALHHGKQKSNGQPVSVFMFDVTSSNETVKQTAQASAKRLKTLRHPNVLTFIDSLE----  86

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNN  589
                T   IY+VTEP+ PL   LKE    G   +   +WGLH+I K VSFL N
Sbjct  87   ----TDKCIYVVTEPIKPLELHLKEASQNGNINELAISWGLHQIVKGVSFLLN  135



>ref|XP_006101614.1| PREDICTED: N-terminal kinase-like protein isoform X1 [Myotis 
lucifugus]
Length=809

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 62/116 (53%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL+F       
Sbjct  27   GPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAF-------  79

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             +DG  T   +++VTE V PL   L+     G  ++   +WGLH+I KA+SFL ND
Sbjct  80   -IDGLETDKCVHVVTEAVTPLGVHLRTRAEAGGPKELELSWGLHQIVKALSFLVND  134



>ref|XP_006893391.1| PREDICTED: N-terminal kinase-like protein isoform X1 [Elephantulus 
edwardii]
Length=804

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 67/132 (51%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYXX--XXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D P+      P  S  G W  +RG  K  G+PVSIF        +      +   KRL+T
Sbjct  11   DFPFELIPEPPEDSPPGPWALHRGRKKATGSPVSIFVYDVKAGAEEQTQVAKAAFKRLKT  70

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHPNIL++        +DG  T   I++VTE V PL   LK     G  ++   +WGLH
Sbjct  71   LRHPNILAY--------IDGLETDKCIHVVTEAVTPLGTYLKTGLEAGGLKELELSWGLH  122

Query  557  RITKAVSFLNND  592
            +I KA+SFL ND
Sbjct  123  QIVKALSFLVND  134



>gb|KIM45100.1| hypothetical protein M413DRAFT_441766 [Hebeloma cylindrosporum 
h7]
Length=879

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 71/131 (54%), Gaps = 10/131 (8%)
 Frame = +2

Query  203  DLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALS-GSNANDGHLAAGRNGVKRLRTV  379
            +LP+      +     +  Y  T +DDG+PVS+F    G  +        +N +++LRT 
Sbjct  22   NLPFSLGSKLAQVEAHFTLYDATKRDDGSPVSVFEYEFGDTSRRATKLFAQNSLRKLRTT  81

Query  380  RHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQ-RDEYYAWGLH  556
            RHP+IL F+ + E ET        TIYI+TE V PL   L +      Q R+++  WGLH
Sbjct  82   RHPDILKFMDAVESET--------TIYILTERVRPLSSVLPQYSSKNPQEREDWLLWGLH  133

Query  557  RITKAVSFLNN  589
            RI+ A++FLN+
Sbjct  134  RISVALTFLND  144



>ref|XP_003798701.1| PREDICTED: N-terminal kinase-like protein isoform 1 [Otolemur 
garnettii]
Length=804

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 64/116 (55%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++       
Sbjct  27   GPWVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY-------  79

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             +DG  T+  +++VTE V PL   LK     G  ++   +WGLH+I KA+SFL ND
Sbjct  80   -IDGLETEKCLHVVTEAVTPLGMYLKARVEAGGLKELEISWGLHQIVKALSFLVND  134



>ref|XP_006893392.1| PREDICTED: N-terminal kinase-like protein isoform X2 [Elephantulus 
edwardii]
Length=787

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 67/132 (51%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYXX--XXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D P+      P  S  G W  +RG  K  G+PVSIF        +      +   KRL+T
Sbjct  11   DFPFELIPEPPEDSPPGPWALHRGRKKATGSPVSIFVYDVKAGAEEQTQVAKAAFKRLKT  70

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHPNIL++        +DG  T   I++VTE V PL   LK     G  ++   +WGLH
Sbjct  71   LRHPNILAY--------IDGLETDKCIHVVTEAVTPLGTYLKTGLEAGGLKELELSWGLH  122

Query  557  RITKAVSFLNND  592
            +I KA+SFL ND
Sbjct  123  QIVKALSFLVND  134



>ref|XP_005384547.1| PREDICTED: N-terminal kinase-like protein isoform X3 [Chinchilla 
lanigera]
Length=794

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 44/114 (39%), Positives = 64/114 (56%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  +++VTE V PL   LK     G  +++  +WGLH++ KA+SFL ND
Sbjct  81   DGLETEKCLHVVTEAVTPLGMYLKARAEAGGLKEQELSWGLHQVVKALSFLVND  134



>ref|XP_007317261.1| hypothetical protein SERLADRAFT_436901 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO25139.1| hypothetical protein SERLADRAFT_436901 [Serpula lacrymans var. 
lacrymans S7.9]
Length=896

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 73/130 (56%), Gaps = 10/130 (8%)
 Frame = +2

Query  203  DLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNA-NDGHLAAGRNGVKRLRTV  379
            +LP+      +S    W  Y  T +DDG+PVS+F    ++  N   +   RN +++LRT+
Sbjct  22   NLPFSLGQKVTSFETFWNLYDATKRDDGSPVSVFEYDFNHPLNKPTIPLARNALRKLRTI  81

Query  380  RHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGL-VGTQRDEYYAWGLH  556
            RHP++L F+   E +TV        IYI+TE V PL   LK        +R+++  WGLH
Sbjct  82   RHPDVLKFMDVVETDTV--------IYIMTERVRPLPLALKSWSTKSAEEREDWLLWGLH  133

Query  557  RITKAVSFLN  586
            RI+ A++F+N
Sbjct  134  RISVALAFVN  143



>ref|XP_005384545.1| PREDICTED: N-terminal kinase-like protein isoform X1 [Chinchilla 
lanigera]
Length=806

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 44/114 (39%), Positives = 64/114 (56%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  +++VTE V PL   LK     G  +++  +WGLH++ KA+SFL ND
Sbjct  81   DGLETEKCLHVVTEAVTPLGMYLKARAEAGGLKEQELSWGLHQVVKALSFLVND  134



>ref|XP_005384546.1| PREDICTED: N-terminal kinase-like protein isoform X2 [Chinchilla 
lanigera]
Length=809

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 44/114 (39%), Positives = 64/114 (56%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  +++VTE V PL   LK     G  +++  +WGLH++ KA+SFL ND
Sbjct  81   DGLETEKCLHVVTEAVTPLGMYLKARAEAGGLKEQELSWGLHQVVKALSFLVND  134



>ref|XP_003798702.1| PREDICTED: N-terminal kinase-like protein isoform 2 [Otolemur 
garnettii]
Length=790

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 64/116 (55%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++       
Sbjct  27   GPWVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY-------  79

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             +DG  T+  +++VTE V PL   LK     G  ++   +WGLH+I KA+SFL ND
Sbjct  80   -IDGLETEKCLHVVTEAVTPLGMYLKARVEAGGLKELEISWGLHQIVKALSFLVND  134



>ref|XP_003798703.1| PREDICTED: N-terminal kinase-like protein isoform 3 [Otolemur 
garnettii]
Length=787

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 64/116 (55%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++       
Sbjct  27   GPWVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY-------  79

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             +DG  T+  +++VTE V PL   LK     G  ++   +WGLH+I KA+SFL ND
Sbjct  80   -IDGLETEKCLHVVTEAVTPLGMYLKARVEAGGLKELEISWGLHQIVKALSFLVND  134



>ref|XP_005333621.1| PREDICTED: N-terminal kinase-like protein [Ictidomys tridecemlineatus]
Length=808

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 69/132 (52%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYXXX--XPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D P+      P  S  G WV +RG  K  G+ VSIF        +      +   KRL+T
Sbjct  30   DFPFELSPEAPEGSPPGPWVLHRGRKKATGSLVSIFVYDVKPGAEEQTQVAKAAFKRLKT  89

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHPNIL++        +DG  T+  +++VTE V PL   LK     G  +++  +WGLH
Sbjct  90   LRHPNILAY--------IDGLETEKCLHVVTEAVTPLGMYLKARVDAGGLKEQELSWGLH  141

Query  557  RITKAVSFLNND  592
            +I KA+SFL ND
Sbjct  142  QIVKALSFLVND  153



>ref|XP_007267076.1| ARM repeat-containing protein [Fomitiporia mediterranea MF3/22]
 gb|EJD03365.1| ARM repeat-containing protein [Fomitiporia mediterranea MF3/22]
Length=584

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 67/115 (58%), Gaps = 10/115 (9%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFAL-SGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVET  427
            W  Y GT +DDG PVS+F   S        L   +N +++LRTVRHP++L F+ + E +T
Sbjct  40   WTLYDGTKRDDGTPVSVFIFDSNQPPRRNLLPLAKNALRKLRTVRHPDVLKFIDTAESDT  99

Query  428  VDGSTTKVTIYIVTEPVMPLCEKLKELGLVGT-QRDEYYAWGLHRITKAVSFLNN  589
            +        +YI+TE V PL + L+     G  +R+E+  WGL RI+  ++F+N+
Sbjct  100  I--------VYIMTERVKPLGQVLQSWSTKGAKEREEWNVWGLQRISVTLAFVND  146



>gb|EPS93604.1| hypothetical protein FOMPIDRAFT_1153884, partial [Fomitopsis 
pinicola FP-58527 SS1]
Length=361

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 67/115 (58%), Gaps = 10/115 (9%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHL-AAGRNGVKRLRTVRHPNILSFLHSTEVET  427
            W  Y GT +DDG+PVSIF    +     ++    +N +++L T+RHP++L F+   E ++
Sbjct  40   WTLYEGTKRDDGSPVSIFEFDANQPGKRNVFPLAKNALRKLPTIRHPDVLRFIDVVETDS  99

Query  428  VDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQ-RDEYYAWGLHRITKAVSFLNN  589
                    TI+IVTE V PL   + E      Q R+++  WGLHRI+ A++F+N+
Sbjct  100  --------TIHIVTERVRPLAPAITEYSHKAAQEREDWLLWGLHRISVALAFVND  146



>ref|XP_006782030.1| PREDICTED: N-terminal kinase-like protein-like [Neolamprologus 
brichardi]
Length=828

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 63/116 (54%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K  G PVS+F    +   +      +   KR++T+RHPNIL++       
Sbjct  26   GIWTLHRGKRKTTGEPVSVFVYEVAQGTEQQTQLAKAAFKRMKTLRHPNILAY-------  78

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             VDG  T+ ++Y+VTE V PL   LK     G   +   +WGLH+I KA+SFL ND
Sbjct  79   -VDGLETEKSLYLVTEQVTPLAVHLKARAEKGGVGELEISWGLHQIVKALSFLIND  133



>ref|XP_003444779.1| PREDICTED: N-terminal kinase-like protein-like isoform X1 [Oreochromis 
niloticus]
Length=865

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 63/116 (54%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K  G PVS+F    +   +      +   KR++T+RHPNIL++       
Sbjct  26   GIWTLHRGKRKTTGEPVSVFVYEVAQGTEQQTQLAKAAFKRMKTLRHPNILAY-------  78

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             VDG  T+ ++Y+VTE V PL   LK     G   +   +WGLH+I KA+SFL ND
Sbjct  79   -VDGLETEKSLYLVTEQVTPLAVHLKARAEKGGVGELEISWGLHQIVKALSFLIND  133



>ref|XP_008418645.1| PREDICTED: N-terminal kinase-like protein [Poecilia reticulata]
Length=862

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 62/116 (53%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K  G PVS+F    +   +      +   KR++T+RHPNIL++       
Sbjct  26   GIWTLHRGKRKTSGDPVSVFVYEVAQGTEQQTQLAKAAFKRMKTLRHPNILTY-------  78

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             VDG  T  ++Y+VTE V PL   LK     G   +   +WGLH+I KA+SFL ND
Sbjct  79   -VDGLETDKSLYVVTEQVTPLSVHLKAQAEKGGAGELEISWGLHQIVKALSFLVND  133



>ref|XP_005806600.1| PREDICTED: N-terminal kinase-like protein-like [Xiphophorus maculatus]
Length=865

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 62/116 (53%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K  G PVS+F    +   +      +   KR++T+RHPNIL++       
Sbjct  26   GIWTLHRGKRKTSGDPVSVFVYEVAQGTEQQTQLAKAAFKRMKTLRHPNILAY-------  78

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             VDG  T  ++Y+VTE V PL   LK     G   +   +WGLH+I KA+SFL ND
Sbjct  79   -VDGLETDKSLYVVTEQVTPLSVHLKAQAEKGGAGELEISWGLHQIVKALSFLVND  133



>ref|XP_005988943.1| PREDICTED: N-terminal kinase-like protein [Latimeria chalumnae]
Length=820

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 64/130 (49%), Gaps = 8/130 (6%)
 Frame = +2

Query  203  DLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVR  382
            D PY          G W  + G  K  G PVS+F      +++      +   KRL+T+R
Sbjct  12   DFPYEIGTECQEVPGIWELHGGKKKTTGDPVSVFVYEVKPSSEEQTQIAKAAFKRLKTLR  71

Query  383  HPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRI  562
            HPNILS+         DG  T   +YIVTEPV PL   LK     G   +   +WGLH+I
Sbjct  72   HPNILSY--------SDGLETDKCLYIVTEPVTPLEAFLKIRAESGGLSELEISWGLHQI  123

Query  563  TKAVSFLNND  592
             KA+SFL ND
Sbjct  124  VKALSFLVND  133



>gb|EDM12530.1| rCG47917, isoform CRA_b [Rattus norvegicus]
Length=750

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+ VSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSAVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  ++IVTE V PL   LK     G  +++  +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHIVTEAVTPLGTYLKARAEAGGLKEQELSWGLHQIVKALSFLVND  134



>ref|XP_003353824.1| PREDICTED: N-terminal kinase-like protein isoformX2 [Sus scrofa]
Length=790

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 45/114 (39%), Positives = 62/114 (54%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            W  +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  +++VTE V PL   LK     G  R+   +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHVVTEAVTPLAAYLKARTETGDLREMELSWGLHQIVKALSFLVND  134



>gb|KIJ19265.1| hypothetical protein PAXINDRAFT_70414 [Paxillus involutus ATCC 
200175]
Length=576

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 72/131 (55%), Gaps = 10/131 (8%)
 Frame = +2

Query  203  DLPYXXXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNA-NDGHLAAGRNGVKRLRTV  379
            +LP+      +S    W  Y  T +DDG+PVS+F     +  N   +   RN +++LRT+
Sbjct  22   NLPFTLGTKVASCETFWSLYDATKRDDGSPVSVFEYDLIHPLNKSTIPLARNALRKLRTI  81

Query  380  RHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQ-RDEYYAWGLH  556
            RHP++L F+   E ++         I I+TE V PL   L+     G Q R+++  WGLH
Sbjct  82   RHPDVLKFMDVVESDS--------AILIMTERVRPLSATLQAWASKGQQEREDWLLWGLH  133

Query  557  RITKAVSFLNN  589
            RI+ A++F+N+
Sbjct  134  RISVALAFIND  144



>ref|XP_003122606.2| PREDICTED: N-terminal kinase-like protein isoformX1 [Sus scrofa]
Length=807

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 45/114 (39%), Positives = 62/114 (54%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            W  +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  +++VTE V PL   LK     G  R+   +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHVVTEAVTPLAAYLKARTETGDLREMELSWGLHQIVKALSFLVND  134



>ref|XP_007550401.1| PREDICTED: N-terminal kinase-like protein isoform X2 [Poecilia 
formosa]
Length=862

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 62/116 (53%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K  G PVS+F    +   +      +   KR++T+RHPNIL++       
Sbjct  26   GIWTLHRGKRKTSGDPVSVFVYEVAQGTEQQTQLAKAAFKRMKTLRHPNILAY-------  78

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             VDG  T  ++Y+VTE V PL   LK     G   +   +WGLH+I KA+SFL ND
Sbjct  79   -VDGLETDKSLYLVTEQVTPLSVHLKAQAEKGGAGELEISWGLHQIVKALSFLVND  133



>ref|NP_001011938.1| N-terminal kinase-like protein [Rattus norvegicus]
 sp|Q5M9F8.1|NTKL_RAT RecName: Full=N-terminal kinase-like protein; AltName: Full=SCY1-like 
protein 1 [Rattus norvegicus]
 gb|AAH87141.1| SCY1-like 1 (S. cerevisiae) [Rattus norvegicus]
 gb|EDM12529.1| rCG47917, isoform CRA_a [Rattus norvegicus]
Length=807

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+ VSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSAVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  ++IVTE V PL   LK     G  +++  +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHIVTEAVTPLGTYLKARAEAGGLKEQELSWGLHQIVKALSFLVND  134



>ref|XP_002590882.1| hypothetical protein BRAFLDRAFT_101148 [Branchiostoma floridae]
 gb|EEN46893.1| hypothetical protein BRAFLDRAFT_101148 [Branchiostoma floridae]
Length=862

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 42/114 (37%), Positives = 65/114 (57%), Gaps = 12/114 (11%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            W  ++G  K +G PVS+F     + N+  +   R  +KRL+T+RHPN+++++ S E    
Sbjct  30   WTLHKGKRKANGEPVSVFVFDVKDYNETQMQTARTSLKRLKTLRHPNVVTYVDSLE----  85

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
                T  T+Y+VTEPV+PL   + E        +   +WGLH+I KA+SF  ND
Sbjct  86   ----TDKTVYVVTEPVVPLVTYIAE----QKPNELVISWGLHQIVKALSFFVND  131



>ref|XP_002916685.1| PREDICTED: N-terminal kinase-like protein [Ailuropoda melanoleuca]
 gb|EFB26213.1| hypothetical protein PANDA_004799 [Ailuropoda melanoleuca]
Length=807

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 62/114 (54%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T   +++VTE V PL   LKE    G  ++   +WGLH+  KA+SFL ND
Sbjct  81   DGLETDKCLHVVTEAVTPLKMYLKERAEAGGLKELELSWGLHQTVKALSFLVND  134



>ref|XP_006230811.2| PREDICTED: N-terminal kinase-like protein isoform X1 [Rattus 
norvegicus]
Length=806

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+ VSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSAVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  ++IVTE V PL   LK     G  +++  +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHIVTEAVTPLGTYLKARAEAGGLKEQELSWGLHQIVKALSFLVND  134



>ref|XP_010737506.1| PREDICTED: N-terminal kinase-like protein [Larimichthys crocea]
Length=867

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 63/116 (54%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K +  PVS+F    +   +      +   KR++T+RHPNIL++       
Sbjct  26   GIWTLHRGKRKTNAEPVSVFVYEVAQGTELQTQLAKAAFKRMKTLRHPNILAY-------  78

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             VDG  T+ ++Y+VTE V PL   LK     G   D   +WGLH+I KA+SFL ND
Sbjct  79   -VDGLETEKSLYLVTEQVTPLSVHLKAQADKGGAGDLEVSWGLHQIVKALSFLVND  133



>ref|XP_007550400.1| PREDICTED: N-terminal kinase-like protein isoform X1 [Poecilia 
formosa]
Length=873

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 62/116 (53%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K  G PVS+F    +   +      +   KR++T+RHPNIL++       
Sbjct  37   GIWTLHRGKRKTSGDPVSVFVYEVAQGTEQQTQLAKAAFKRMKTLRHPNILAY-------  89

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             VDG  T  ++Y+VTE V PL   LK     G   +   +WGLH+I KA+SFL ND
Sbjct  90   -VDGLETDKSLYLVTEQVTPLSVHLKAQAEKGGAGELEISWGLHQIVKALSFLVND  144



>ref|XP_008145181.1| PREDICTED: N-terminal kinase-like protein isoform X1 [Eptesicus 
fuscus]
Length=807

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 62/116 (53%), Gaps = 8/116 (7%)
 Frame = +2

Query  245  GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE  424
            G W  +RG  K  G+PVSIF        +      +   KRL+T+RHPNIL++       
Sbjct  27   GPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY-------  79

Query  425  TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
             +DG  T   +++VTE V PL   LK     G  ++   +WGLH+I KA+SFL ND
Sbjct  80   -IDGLETDKCLHVVTEAVTPLGVYLKTRAEAGGPKELELSWGLHQIVKALSFLVND  134



>ref|XP_006980716.1| PREDICTED: N-terminal kinase-like protein isoform X2 [Peromyscus 
maniculatus bairdii]
Length=803

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+ VSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WVLHRGRKKATGSAVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  ++IVTE V PL   LK     G  +++  +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHIVTEAVTPLGTYLKARAEAGGLKEQELSWGLHQIVKALSFLVND  134



>ref|XP_004656724.1| PREDICTED: N-terminal kinase-like protein isoform X1 [Jaculus 
jaculus]
Length=813

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+ VSIF        +      +   KRL+T+RHPNILS+        +
Sbjct  29   WVLHRGRKKATGSVVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILSY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  +++VTE V PL   LK     G  +++  +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHVVTEAVTPLGTYLKTRAEAGGPKEQELSWGLHQIVKALSFLVND  134



>ref|XP_004656725.1| PREDICTED: N-terminal kinase-like protein isoform X2 [Jaculus 
jaculus]
Length=797

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            WV +RG  K  G+ VSIF        +      +   KRL+T+RHPNILS+        +
Sbjct  29   WVLHRGRKKATGSVVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILSY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  +++VTE V PL   LK     G  +++  +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHVVTEAVTPLGTYLKTRAEAGGPKEQELSWGLHQIVKALSFLVND  134



>gb|AAF81422.1| teratoma-associated tyrosine kinase [Homo sapiens]
Length=283

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 66/132 (50%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYXX--XXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D P+      P     G W  +RG  K  G+PVSIF        +      +   KR +T
Sbjct  11   DFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKT  70

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHPNIL++        +DG  T+  +++VTE V PL   LK     G  ++   +WGLH
Sbjct  71   LRHPNILAY--------IDGLETEKCLHVVTEAVTPLGIYLKARVEAGGLKELEISWGLH  122

Query  557  RITKAVSFLNND  592
            +I KA+SFL ND
Sbjct  123  QIVKALSFLVND  134



>gb|EDL33172.1| SCY1-like 1 (S. cerevisiae), isoform CRA_a [Mus musculus]
 gb|ADT64113.1| SCY1-like 1 splice variant 15 [Mus musculus]
Length=749

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +2

Query  251  WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV  430
            W+ +RG  K  G+ VSIF        +      +   KRL+T+RHPNIL++        +
Sbjct  29   WILHRGRKKATGSAVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAY--------I  80

Query  431  DGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNND  592
            DG  T+  ++IVTE V PL   LK     G  +++  +WGLH+I KA+SFL ND
Sbjct  81   DGLETEKCLHIVTEAVTPLGTYLKARAEAGGLKEQELSWGLHQIVKALSFLVND  134



>ref|XP_010346899.1| PREDICTED: N-terminal kinase-like protein [Saimiri boliviensis 
boliviensis]
Length=801

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 67/132 (51%), Gaps = 10/132 (8%)
 Frame = +2

Query  203  DLPYX--XXXPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRT  376
            D P+      P     G W  +RG  K  G+PVSIF        +      +   KRL+T
Sbjct  11   DFPFELIPELPEGGPPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRLKT  70

Query  377  VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLH  556
            +RHPNIL++        +DG  T+  +++VTE V PL   LK     G  ++   +WGLH
Sbjct  71   LRHPNILAY--------IDGLETEKCLHVVTEAVTPLGMYLKARVEAGGLKELEISWGLH  122

Query  557  RITKAVSFLNND  592
            +I KA+SFL ND
Sbjct  123  QIVKALSFLVND  134



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 778590373395