BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS043F08

Length=608
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009797154.1|  PREDICTED: uncharacterized protein LOC104243632  52.8    6e-05   Nicotiana sylvestris
ref|XP_004245835.1|  PREDICTED: uncharacterized protein LOC101251207  51.6    1e-04   Solanum lycopersicum
ref|XP_009600967.1|  PREDICTED: uncharacterized protein LOC104096313  49.7    6e-04   Nicotiana tomentosiformis



>ref|XP_009797154.1| PREDICTED: uncharacterized protein LOC104243632 [Nicotiana sylvestris]
Length=500

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 5/51 (10%)
 Frame = +2

Query  326  RPDLEIEIPSCSDSGTHHHHQIHFKNEPFCPPIQSPTQTLVSTPHKRPVMA  478
            + +L+I+IPS  DS T+   QIHF NEPFC   QSP +TL+STPHKRP+M+
Sbjct  30   KINLQIKIPS-PDSSTN---QIHFINEPFCQN-QSPNKTLLSTPHKRPIMS  75



>ref|XP_004245835.1| PREDICTED: uncharacterized protein LOC101251207 [Solanum lycopersicum]
Length=523

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (58%), Gaps = 11/99 (11%)
 Frame = +2

Query  194  MIQKKVEVVITKGIPDISPAI----TPRHPRPPSISSQILDTTGLTRPRPDLEIEIPSCS  361
            M QK +EV I +   D+S         ++  P  I +Q   T      + +L+I+IPS  
Sbjct  1    MHQKNIEVQIGQEHSDLSSNFISSNQKQYQNPIFIPNQ--STPSENFCKINLQIKIPS-P  57

Query  362  DSGTHHHHQIHFKNEPFCPPIQSPTQTLVSTPHKRPVMA  478
            DS T+   QIHF++EP C   QSP +TL+STPHKRP+M+
Sbjct  58   DSSTN---QIHFRDEPICQN-QSPGKTLLSTPHKRPIMS  92



>ref|XP_009600967.1| PREDICTED: uncharacterized protein LOC104096313 [Nicotiana tomentosiformis]
Length=504

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 5/51 (10%)
 Frame = +2

Query  326  RPDLEIEIPSCSDSGTHHHHQIHFKNEPFCPPIQSPTQTLVSTPHKRPVMA  478
            + +L+I+IPS  DS T+   QIH  NEPFC   QSP +TL+STPHKRP+M+
Sbjct  34   KINLQIKIPS-PDSSTN---QIHIINEPFCQN-QSPNKTLLSTPHKRPIMS  79



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800