BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS041E08

Length=629
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006366962.1|  PREDICTED: calcium-transporting ATPase 8, pl...    325   2e-100   
ref|XP_010323145.1|  PREDICTED: auto-inhibited Ca2 -transporting ...    325   3e-100   Solanum lycopersicum
ref|NP_001234817.1|  auto-inhibited Ca2 -transporting ATPase 10         322   2e-99    Solanum lycopersicum
emb|CDP12667.1|  unnamed protein product                                315   5e-98    Coffea canephora [robusta coffee]
ref|XP_009601429.1|  PREDICTED: calcium-transporting ATPase 8, pl...    318   9e-98    
ref|XP_009757245.1|  PREDICTED: calcium-transporting ATPase 10, p...    316   6e-97    Nicotiana sylvestris
ref|XP_011094128.1|  PREDICTED: calcium-transporting ATPase 10, p...    312   2e-95    Sesamum indicum [beniseed]
ref|XP_011094123.1|  PREDICTED: calcium-transporting ATPase 10, p...    312   2e-95    
ref|XP_002518263.1|  cation-transporting atpase plant, putative         310   7e-95    
gb|KDP30671.1|  hypothetical protein JCGZ_16227                         306   2e-93    Jatropha curcas
gb|KDO61969.1|  hypothetical protein CISIN_1g0433051mg                  297   4e-93    Citrus sinensis [apfelsine]
ref|XP_002309001.2|  hypothetical protein POPTR_0006s07240g             303   2e-92    
gb|EYU18198.1|  hypothetical protein MIMGU_mgv1a000743mg                300   1e-91    Erythranthe guttata [common monkey flower]
ref|XP_007154697.1|  hypothetical protein PHAVU_003G140200g             301   2e-91    Phaseolus vulgaris [French bean]
gb|KCW78631.1|  hypothetical protein EUGRSUZ_C00095                     290   6e-91    Eucalyptus grandis [rose gum]
ref|XP_007227032.1|  hypothetical protein PRUPE_ppa000670mg             297   3e-90    
ref|XP_007227033.1|  hypothetical protein PRUPE_ppa000670mg             296   5e-90    
ref|XP_011467548.1|  PREDICTED: calcium-transporting ATPase 9, pl...    296   8e-90    Fragaria vesca subsp. vesca
gb|EPS66449.1|  hypothetical protein M569_08327                         288   1e-89    Genlisea aurea
ref|XP_010687434.1|  PREDICTED: calcium-transporting ATPase 10, p...    295   2e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011020086.1|  PREDICTED: calcium-transporting ATPase 10, p...    295   2e-89    Populus euphratica
ref|XP_011020078.1|  PREDICTED: calcium-transporting ATPase 10, p...    295   2e-89    Populus euphratica
ref|XP_010687432.1|  PREDICTED: calcium-transporting ATPase 10, p...    295   3e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006453219.1|  hypothetical protein CICLE_v10007305mg             295   3e-89    Citrus clementina [clementine]
ref|XP_010094240.1|  Calcium-transporting ATPase 10, plasma membr...    295   5e-89    
ref|XP_008360507.1|  PREDICTED: calcium-transporting ATPase 8, pl...    291   7e-89    
ref|XP_008223854.1|  PREDICTED: calcium-transporting ATPase 10, p...    293   1e-88    Prunus mume [ume]
ref|XP_008391559.1|  PREDICTED: calcium-transporting ATPase 10, p...    291   3e-88    
ref|XP_010046911.1|  PREDICTED: calcium-transporting ATPase 8, pl...    291   5e-88    
gb|KJB21987.1|  hypothetical protein B456_004G024800                    290   6e-88    Gossypium raimondii
ref|XP_007014494.1|  Autoinhibited Ca(2+)-ATPase 10 isoform 1           291   6e-88    
ref|XP_003533744.1|  PREDICTED: calcium-transporting ATPase 8, pl...    291   7e-88    Glycine max [soybeans]
gb|KCW80852.1|  hypothetical protein EUGRSUZ_C02215                     290   8e-88    Eucalyptus grandis [rose gum]
ref|XP_010048572.1|  PREDICTED: calcium-transporting ATPase 10, p...    290   1e-87    
gb|KJB21991.1|  hypothetical protein B456_004G024800                    290   1e-87    Gossypium raimondii
ref|XP_009343847.1|  PREDICTED: calcium-transporting ATPase 10, p...    290   1e-87    Pyrus x bretschneideri [bai li]
ref|XP_010696088.1|  PREDICTED: calcium-transporting ATPase 9, pl...    290   2e-87    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB21986.1|  hypothetical protein B456_004G024800                    290   2e-87    Gossypium raimondii
gb|KJB21985.1|  hypothetical protein B456_004G024800                    290   2e-87    Gossypium raimondii
gb|KJB21990.1|  hypothetical protein B456_004G024800                    290   2e-87    Gossypium raimondii
ref|XP_006372180.1|  hypothetical protein POPTR_0018s13650g             288   2e-87    
ref|XP_010048570.1|  PREDICTED: calcium-transporting ATPase 10, p...    290   2e-87    
ref|XP_006585663.1|  PREDICTED: calcium-transporting ATPase 9, pl...    290   2e-87    Glycine max [soybeans]
gb|KJB21993.1|  hypothetical protein B456_004G024800                    289   3e-87    Gossypium raimondii
ref|XP_006600472.1|  PREDICTED: calcium-transporting ATPase 8, pl...    286   5e-87    
ref|XP_006598389.1|  PREDICTED: calcium-transporting ATPase 8, pl...    288   6e-87    
ref|XP_006597086.1|  PREDICTED: calcium-transporting ATPase 9, pl...    288   6e-87    Glycine max [soybeans]
ref|XP_002325251.2|  Calcium-transporting ATPase 8 family protein       288   6e-87    
ref|XP_008227946.1|  PREDICTED: calcium-transporting ATPase 9, pl...    288   1e-86    Prunus mume [ume]
ref|XP_010046915.1|  PREDICTED: calcium-transporting ATPase 8, pl...    288   1e-86    Eucalyptus grandis [rose gum]
ref|XP_007023813.1|  Autoinhibited Ca(2+)-ATPase 9 isoform 4            287   1e-86    
gb|KJB21983.1|  hypothetical protein B456_004G024800                    287   1e-86    Gossypium raimondii
ref|XP_011017707.1|  PREDICTED: calcium-transporting ATPase 10, p...    287   1e-86    Populus euphratica
gb|KJB21984.1|  hypothetical protein B456_004G024800                    287   1e-86    Gossypium raimondii
gb|KHN22652.1|  Calcium-transporting ATPase 8, plasma membrane-type     287   1e-86    Glycine soja [wild soybean]
ref|XP_011017705.1|  PREDICTED: calcium-transporting ATPase 10, p...    287   2e-86    Populus euphratica
ref|XP_011017704.1|  PREDICTED: calcium-transporting ATPase 10, p...    287   2e-86    Populus euphratica
ref|XP_008227947.1|  PREDICTED: calcium-transporting ATPase 9, pl...    284   2e-86    
ref|XP_007023810.1|  Autoinhibited Ca(2+)-ATPase 9 isoform 1            286   3e-86    
ref|XP_004486584.1|  PREDICTED: calcium-transporting ATPase 9, pl...    286   3e-86    Cicer arietinum [garbanzo]
ref|XP_007023812.1|  Autoinhibited Ca(2+)-ATPase 9 isoform 3            286   3e-86    
ref|XP_008801513.1|  PREDICTED: calcium-transporting ATPase 8, pl...    284   3e-86    
gb|KJB56392.1|  hypothetical protein B456_009G118300                    278   4e-86    Gossypium raimondii
ref|XP_006427751.1|  hypothetical protein CICLE_v10024770mg             285   4e-86    
ref|XP_009349647.1|  PREDICTED: calcium-transporting ATPase 9, pl...    286   4e-86    Pyrus x bretschneideri [bai li]
ref|XP_004167733.1|  PREDICTED: calcium-transporting ATPase 8, pl...    284   4e-86    
ref|XP_006595201.1|  PREDICTED: calcium-transporting ATPase 9, pl...    286   4e-86    Glycine max [soybeans]
gb|KJB56393.1|  hypothetical protein B456_009G118300                    278   5e-86    Gossypium raimondii
ref|XP_003549287.1|  PREDICTED: calcium-transporting ATPase 8, pl...    286   5e-86    Glycine max [soybeans]
ref|XP_006600468.1|  PREDICTED: calcium-transporting ATPase 8, pl...    286   6e-86    Glycine max [soybeans]
ref|XP_007142130.1|  hypothetical protein PHAVU_008G255200g             286   6e-86    Phaseolus vulgaris [French bean]
ref|XP_008450934.1|  PREDICTED: calcium-transporting ATPase 10, p...    285   7e-86    Cucumis melo [Oriental melon]
gb|KHN17641.1|  Calcium-transporting ATPase 10, plasma membrane-type    285   8e-86    Glycine soja [wild soybean]
gb|KDO47130.1|  hypothetical protein CISIN_1g04209132mg                 272   8e-86    Citrus sinensis [apfelsine]
ref|XP_006427752.1|  hypothetical protein CICLE_v10024770mg             285   8e-86    Citrus clementina [clementine]
ref|XP_006593507.1|  PREDICTED: calcium-transporting ATPase 8, pl...    284   9e-86    Glycine max [soybeans]
ref|XP_010545613.1|  PREDICTED: calcium-transporting ATPase 9, pl...    285   1e-85    Tarenaya hassleriana [spider flower]
ref|XP_009340519.1|  PREDICTED: calcium-transporting ATPase 9, pl...    285   1e-85    Pyrus x bretschneideri [bai li]
ref|XP_003543731.1|  PREDICTED: calcium-transporting ATPase 8, pl...    284   2e-85    Glycine max [soybeans]
ref|XP_009333971.1|  PREDICTED: calcium-transporting ATPase 9, pl...    284   2e-85    Pyrus x bretschneideri [bai li]
ref|XP_008342501.1|  PREDICTED: calcium-transporting ATPase 9, pl...    283   2e-85    
ref|XP_006492040.1|  PREDICTED: calcium-transporting ATPase 9, pl...    284   2e-85    Citrus sinensis [apfelsine]
ref|XP_008227944.1|  PREDICTED: calcium-transporting ATPase 9, pl...    284   3e-85    Prunus mume [ume]
ref|XP_007217082.1|  hypothetical protein PRUPE_ppa000581mg             283   3e-85    
ref|XP_002315383.2|  an N-terminal calmodulin binding autoinhibit...    283   3e-85    
ref|XP_008801512.1|  PREDICTED: calcium-transporting ATPase 8, pl...    283   3e-85    Phoenix dactylifera
ref|XP_010655160.1|  PREDICTED: calcium-transporting ATPase 9, pl...    283   4e-85    Vitis vinifera
ref|XP_010655162.1|  PREDICTED: calcium-transporting ATPase 9, pl...    283   4e-85    Vitis vinifera
ref|XP_004150387.1|  PREDICTED: calcium-transporting ATPase 10, p...    283   4e-85    Cucumis sativus [cucumbers]
ref|XP_011033032.1|  PREDICTED: calcium-transporting ATPase 9, pl...    283   5e-85    Populus euphratica
ref|XP_002275074.2|  PREDICTED: calcium-transporting ATPase 9, pl...    283   5e-85    Vitis vinifera
ref|XP_009349648.1|  PREDICTED: calcium-transporting ATPase 9, pl...    283   5e-85    
ref|XP_010929325.1|  PREDICTED: calcium-transporting ATPase 8, pl...    281   6e-85    
ref|XP_011033031.1|  PREDICTED: calcium-transporting ATPase 9, pl...    283   7e-85    Populus euphratica
ref|XP_010063652.1|  PREDICTED: calcium-transporting ATPase 9, pl...    281   7e-85    
ref|XP_010536881.1|  PREDICTED: calcium-transporting ATPase 8, pl...    282   8e-85    Tarenaya hassleriana [spider flower]
gb|KCW70887.1|  hypothetical protein EUGRSUZ_F04017                     281   1e-84    Eucalyptus grandis [rose gum]
ref|XP_010063650.1|  PREDICTED: calcium-transporting ATPase 9, pl...    281   2e-84    Eucalyptus grandis [rose gum]
ref|XP_010063651.1|  PREDICTED: calcium-transporting ATPase 9, pl...    281   2e-84    Eucalyptus grandis [rose gum]
ref|XP_009340518.1|  PREDICTED: calcium-transporting ATPase 9, pl...    281   2e-84    Pyrus x bretschneideri [bai li]
ref|XP_006401243.1|  hypothetical protein EUTSA_v10012523mg             280   2e-84    
ref|XP_010048692.1|  PREDICTED: calcium-transporting ATPase 8, pl...    281   2e-84    Eucalyptus grandis [rose gum]
ref|XP_008380287.1|  PREDICTED: calcium-transporting ATPase 9, pl...    281   3e-84    Malus domestica [apple tree]
gb|KJB56395.1|  hypothetical protein B456_009G118300                    279   3e-84    Gossypium raimondii
ref|XP_010276717.1|  PREDICTED: calcium-transporting ATPase 10, p...    281   3e-84    Nelumbo nucifera [Indian lotus]
gb|KJB56394.1|  hypothetical protein B456_009G118300                    278   3e-84    Gossypium raimondii
ref|XP_009333970.1|  PREDICTED: calcium-transporting ATPase 9, pl...    281   3e-84    Pyrus x bretschneideri [bai li]
ref|XP_006401244.1|  hypothetical protein EUTSA_v10012523mg             281   3e-84    Eutrema salsugineum [saltwater cress]
gb|KJB56396.1|  hypothetical protein B456_009G118300                    278   6e-84    Gossypium raimondii
gb|KJB70755.1|  hypothetical protein B456_011G090300                    274   8e-84    Gossypium raimondii
ref|XP_006582993.1|  PREDICTED: calcium-transporting ATPase 9, pl...    280   9e-84    Glycine max [soybeans]
emb|CDY20693.1|  BnaA02g08330D                                          279   1e-83    Brassica napus [oilseed rape]
ref|XP_006281735.1|  hypothetical protein CARUB_v10027891mg             279   1e-83    
ref|NP_851200.1|  calcium-transporting ATPase 8                         279   1e-83    Arabidopsis thaliana [mouse-ear cress]
gb|KCW44504.1|  hypothetical protein EUGRSUZ_L019901                    266   1e-83    Eucalyptus grandis [rose gum]
ref|XP_010451807.1|  PREDICTED: calcium-transporting ATPase 8, pl...    279   1e-83    Camelina sativa [gold-of-pleasure]
ref|XP_009126900.1|  PREDICTED: calcium-transporting ATPase 8, pl...    279   1e-83    Brassica rapa
gb|KJB56391.1|  hypothetical protein B456_009G118300                    278   2e-83    Gossypium raimondii
ref|XP_010443383.1|  PREDICTED: calcium-transporting ATPase 8, pl...    278   2e-83    Camelina sativa [gold-of-pleasure]
ref|XP_004507012.1|  PREDICTED: calcium-transporting ATPase 9, pl...    278   3e-83    
gb|KEH28612.1|  calcium-transporting ATPase 8, plasma membrane-ty...    278   3e-83    Medicago truncatula
gb|KEH28611.1|  calcium-transporting ATPase 8, plasma membrane-ty...    278   4e-83    Medicago truncatula
gb|KDP34443.1|  hypothetical protein JCGZ_11914                         277   5e-83    Jatropha curcas
gb|KCW44503.1|  hypothetical protein EUGRSUZ_L019901                    266   6e-83    Eucalyptus grandis [rose gum]
ref|XP_009359960.1|  PREDICTED: calcium-transporting ATPase 10, p...    277   6e-83    
ref|XP_002310944.2|  an N-terminal calmodulin binding autoinhibit...    277   7e-83    
emb|CDY32902.1|  BnaC02g11860D                                          277   7e-83    Brassica napus [oilseed rape]
emb|CBI25301.3|  unnamed protein product                                277   8e-83    Vitis vinifera
ref|XP_009359959.1|  PREDICTED: calcium-transporting ATPase 10, p...    277   1e-82    
ref|XP_010927267.1|  PREDICTED: calcium-transporting ATPase 8, pl...    276   1e-82    
gb|KJB70754.1|  hypothetical protein B456_011G090300                    275   1e-82    Gossypium raimondii
gb|KCW44502.1|  hypothetical protein EUGRSUZ_L019901                    267   1e-82    Eucalyptus grandis [rose gum]
dbj|BAH20100.1|  AT5G57110                                              276   1e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010927266.1|  PREDICTED: calcium-transporting ATPase 8, pl...    276   2e-82    
ref|XP_006845776.1|  hypothetical protein AMTR_s00019p00251600          276   2e-82    
emb|CDY38264.1|  BnaA10g11120D                                          276   2e-82    Brassica napus [oilseed rape]
ref|XP_010928700.1|  PREDICTED: calcium-transporting ATPase 8, pl...    275   2e-82    
ref|XP_009120228.1|  PREDICTED: calcium-transporting ATPase 8, pl...    275   2e-82    Brassica rapa
ref|XP_010109302.1|  Calcium-transporting ATPase 9, plasma membra...    276   3e-82    
ref|XP_008781797.1|  PREDICTED: calcium-transporting ATPase 8, pl...    275   3e-82    Phoenix dactylifera
ref|XP_010913722.1|  PREDICTED: calcium-transporting ATPase 8, pl...    275   3e-82    
ref|XP_009128366.1|  PREDICTED: calcium-transporting ATPase 10, p...    275   3e-82    Brassica rapa
ref|XP_010913719.1|  PREDICTED: calcium-transporting ATPase 8, pl...    275   3e-82    
ref|XP_008799456.1|  PREDICTED: calcium-transporting ATPase 8, pl...    274   4e-82    
ref|XP_009386789.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-tran...    272   4e-82    
emb|CDY53981.1|  BnaC09g53480D                                          275   4e-82    Brassica napus [oilseed rape]
emb|CDX68595.1|  BnaC01g08580D                                          275   5e-82    
ref|XP_009128358.1|  PREDICTED: calcium-transporting ATPase 10, p...    275   5e-82    
ref|XP_009128346.1|  PREDICTED: calcium-transporting ATPase 10, p...    275   5e-82    Brassica rapa
ref|XP_002866184.1|  predicted protein                                  274   8e-82    
ref|XP_004299792.1|  PREDICTED: calcium-transporting ATPase 8, pl...    274   9e-82    Fragaria vesca subsp. vesca
ref|XP_008799453.1|  PREDICTED: calcium-transporting ATPase 8, pl...    273   1e-81    Phoenix dactylifera
gb|KJB70750.1|  hypothetical protein B456_011G090300                    273   1e-81    Gossypium raimondii
gb|KEH39694.1|  calcium-transporting ATPase 9, plasma membrane-ty...    271   1e-81    Medicago truncatula
ref|XP_004976722.1|  PREDICTED: calcium-transporting ATPase 8, pl...    273   2e-81    Setaria italica
emb|CDY43534.1|  BnaA01g07100D                                          272   3e-81    Brassica napus [oilseed rape]
gb|KCW77157.1|  hypothetical protein EUGRSUZ_D01503                     272   4e-81    Eucalyptus grandis [rose gum]
dbj|BAA97361.1|  Ca2+-transporting ATPase-like protein                  272   5e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433051.1|  PREDICTED: calcium-transporting ATPase 10, p...    271   7e-81    
gb|KGN45423.1|  Autoinhibited calcium ATPase                            271   8e-81    
ref|XP_004159010.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-tran...    271   8e-81    
ref|XP_004141743.1|  PREDICTED: calcium-transporting ATPase 9, pl...    271   9e-81    
ref|XP_009414910.1|  PREDICTED: calcium-transporting ATPase 8, pl...    271   1e-80    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002867382.1|  autoinhibited Ca2+-ATPase 10                       270   1e-80    
ref|XP_007138755.1|  hypothetical protein PHAVU_009G234600g             270   2e-80    Phaseolus vulgaris [French bean]
ref|XP_009385903.1|  PREDICTED: calcium-transporting ATPase 10, p...    270   2e-80    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY46716.1|  BnaC07g42210D                                          270   2e-80    Brassica napus [oilseed rape]
ref|XP_010034879.1|  PREDICTED: calcium-transporting ATPase 9, pl...    270   3e-80    
ref|XP_010483208.1|  PREDICTED: calcium-transporting ATPase 8, pl...    270   3e-80    Camelina sativa [gold-of-pleasure]
ref|XP_004976721.1|  PREDICTED: calcium-transporting ATPase 8, pl...    270   3e-80    
ref|NP_194719.1|  calcium-transporting ATPase 10                        270   3e-80    Arabidopsis thaliana [mouse-ear cress]
gb|KHG22770.1|  Calcium-transporting ATPase 9, plasma membrane-type     270   4e-80    Gossypium arboreum [tree cotton]
ref|XP_010041252.1|  PREDICTED: calcium-transporting ATPase 9, pl...    266   4e-80    
tpg|DAA48121.1|  TPA: hypothetical protein ZEAMMB73_416489              270   4e-80    
ref|XP_010541090.1|  PREDICTED: calcium-transporting ATPase 10, p...    269   5e-80    Tarenaya hassleriana [spider flower]
gb|KHG22771.1|  Calcium-transporting ATPase 9, plasma membrane-type     269   5e-80    Gossypium arboreum [tree cotton]
ref|XP_002514375.1|  cation-transporting atpase plant, putative         268   6e-80    
tpg|DAA36133.1|  TPA: hypothetical protein ZEAMMB73_748084              268   6e-80    
ref|XP_006285159.1|  hypothetical protein CARUB_v10006503mg             269   6e-80    
gb|EPS66913.1|  hypothetical protein M569_07863                         268   7e-80    Genlisea aurea
ref|XP_010447798.1|  PREDICTED: calcium-transporting ATPase 10, p...    268   7e-80    Camelina sativa [gold-of-pleasure]
emb|CDY30184.1|  BnaA03g49860D                                          268   8e-80    Brassica napus [oilseed rape]
tpg|DAA36132.1|  TPA: hypothetical protein ZEAMMB73_748084              268   8e-80    
ref|XP_008462221.1|  PREDICTED: calcium-transporting ATPase 9, pl...    268   9e-80    
gb|AFW59361.1|  hypothetical protein ZEAMMB73_703991                    266   1e-79    
ref|XP_009137874.1|  PREDICTED: calcium-transporting ATPase 10, p...    268   1e-79    Brassica rapa
ref|XP_008462219.1|  PREDICTED: calcium-transporting ATPase 9, pl...    268   1e-79    Cucumis melo [Oriental melon]
ref|XP_010447795.1|  PREDICTED: calcium-transporting ATPase 10, p...    268   2e-79    Camelina sativa [gold-of-pleasure]
ref|XP_010447799.1|  PREDICTED: calcium-transporting ATPase 10, p...    267   2e-79    Camelina sativa [gold-of-pleasure]
gb|AES65356.2|  calcium-transporting ATPase 8, plasma membrane-ty...    267   2e-79    Medicago truncatula
ref|XP_008668924.1|  PREDICTED: calcium-transporting ATPase 8, pl...    267   2e-79    Zea mays [maize]
ref|XP_002445842.1|  hypothetical protein SORBIDRAFT_07g026810          267   2e-79    Sorghum bicolor [broomcorn]
ref|XP_009385965.1|  PREDICTED: calcium-transporting ATPase 10, p...    267   2e-79    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385964.1|  PREDICTED: calcium-transporting ATPase 10, p...    267   2e-79    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU21222.1|  hypothetical protein MIMGU_mgv1a000501mg                266   4e-79    Erythranthe guttata [common monkey flower]
gb|AES65357.2|  calcium-transporting ATPase 8, plasma membrane-ty...    266   5e-79    Medicago truncatula
emb|CBI17890.3|  unnamed protein product                                266   6e-79    Vitis vinifera
ref|XP_002262829.2|  PREDICTED: calcium-transporting ATPase 10, p...    266   7e-79    Vitis vinifera
ref|XP_009395465.1|  PREDICTED: calcium-transporting ATPase 8, pl...    266   7e-79    Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC83883.1|  hypothetical protein OsI_29887                          266   7e-79    Oryza sativa Indica Group [Indian rice]
gb|EEE68995.1|  hypothetical protein OsJ_27935                          265   9e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004488018.1|  PREDICTED: calcium-transporting ATPase 8, pl...    266   9e-79    Cicer arietinum [garbanzo]
ref|XP_008789606.1|  PREDICTED: calcium-transporting ATPase 8, pl...    265   1e-78    Phoenix dactylifera
ref|XP_004973946.1|  PREDICTED: calcium-transporting ATPase 9, pl...    265   1e-78    
ref|XP_008663568.1|  PREDICTED: calcium-transporting ATPase 8, pl...    265   2e-78    Zea mays [maize]
emb|CDY19575.1|  BnaA05g19830D                                          265   2e-78    Brassica napus [oilseed rape]
emb|CDY50072.1|  BnaC05g30810D                                          264   2e-78    Brassica napus [oilseed rape]
ref|XP_002448481.1|  hypothetical protein SORBIDRAFT_06g027770          264   3e-78    Sorghum bicolor [broomcorn]
ref|XP_006660796.1|  PREDICTED: calcium-transporting ATPase 9, pl...    260   3e-78    
emb|CDY37311.1|  BnaA01g25310D                                          264   3e-78    Brassica napus [oilseed rape]
ref|XP_009145511.1|  PREDICTED: calcium-transporting ATPase 9, pl...    264   4e-78    Brassica rapa
ref|XP_006659616.1|  PREDICTED: calcium-transporting ATPase 8, pl...    264   4e-78    Oryza brachyantha
ref|XP_010034881.1|  PREDICTED: calcium-transporting ATPase 9, pl...    257   5e-78    
ref|XP_008652882.1|  PREDICTED: calcium-transporting ATPase 9, pl...    261   6e-78    
ref|XP_006660797.1|  PREDICTED: calcium-transporting ATPase 9, pl...    259   7e-78    
ref|XP_003580413.1|  PREDICTED: calcium-transporting ATPase 8, pl...    263   8e-78    Brachypodium distachyon [annual false brome]
ref|XP_009786114.1|  PREDICTED: calcium-transporting ATPase 9, pl...    263   9e-78    Nicotiana sylvestris
ref|XP_006406305.1|  hypothetical protein EUTSA_v10019954mg             263   1e-77    Eutrema salsugineum [saltwater cress]
ref|XP_009594203.1|  PREDICTED: calcium-transporting ATPase 9, pl...    262   2e-77    
ref|XP_006412793.1|  hypothetical protein EUTSA_v10024281mg             261   2e-77    
ref|XP_006652779.1|  PREDICTED: calcium-transporting ATPase 8, pl...    262   2e-77    Oryza brachyantha
ref|XP_010235324.1|  PREDICTED: calcium-transporting ATPase 8, pl...    262   2e-77    Brachypodium distachyon [annual false brome]
ref|XP_006412795.1|  hypothetical protein EUTSA_v10024281mg             261   2e-77    Eutrema salsugineum [saltwater cress]
ref|XP_002883291.1|  Ca2+-transporting ATPase                           261   2e-77    
gb|KCW53959.1|  hypothetical protein EUGRSUZ_J03164                     257   2e-77    Eucalyptus grandis [rose gum]
tpg|DAA62117.1|  TPA: hypothetical protein ZEAMMB73_938570              261   2e-77    
ref|NP_001053795.1|  Os04g0605500                                       261   2e-77    
ref|XP_009109767.1|  PREDICTED: calcium-transporting ATPase 9, pl...    261   2e-77    Brassica rapa
emb|CAB43665.1|  Ca2+-transporting ATPase-like protein                  261   2e-77    Arabidopsis thaliana [mouse-ear cress]
gb|AGW24530.1|  type IIB Ca2+ATPase                                     261   3e-77    Oryza sativa [red rice]
ref|XP_008652881.1|  PREDICTED: calcium-transporting ATPase 9, pl...    261   3e-77    
ref|XP_002460472.1|  hypothetical protein SORBIDRAFT_02g028935          261   3e-77    
ref|NP_188755.2|  calcium-transporting ATPase 9                         261   3e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008663567.1|  PREDICTED: calcium-transporting ATPase 8, pl...    261   3e-77    Zea mays [maize]
ref|XP_006296870.1|  hypothetical protein CARUB_v10012867mg             261   3e-77    Capsella rubella
dbj|BAB01709.1|  Ca2+-transporting ATPase                               261   4e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006342864.1|  PREDICTED: calcium-transporting ATPase 9, pl...    260   6e-77    Solanum tuberosum [potatoes]
emb|CDY32412.1|  BnaC03g41960D                                          260   9e-77    Brassica napus [oilseed rape]
emb|CDX82212.1|  BnaA03g36090D                                          259   1e-76    
dbj|BAD09972.1|  putative calcium-transporting ATPase 8, plasma m...    259   2e-76    Oryza sativa Japonica Group [Japonica rice]
emb|CDY27537.1|  BnaC01g32200D                                          259   2e-76    Brassica napus [oilseed rape]
ref|XP_009135736.1|  PREDICTED: calcium-transporting ATPase 9, pl...    259   2e-76    Brassica rapa
ref|XP_010488101.1|  PREDICTED: calcium-transporting ATPase 9, pl...    259   2e-76    
ref|XP_009135735.1|  PREDICTED: calcium-transporting ATPase 9, pl...    258   3e-76    Brassica rapa
ref|XP_010466338.1|  PREDICTED: calcium-transporting ATPase 9, pl...    258   3e-76    Camelina sativa [gold-of-pleasure]
ref|XP_010509827.1|  PREDICTED: calcium-transporting ATPase 9, pl...    258   3e-76    Camelina sativa [gold-of-pleasure]
gb|KFK39423.1|  hypothetical protein AALP_AA3G243100                    258   4e-76    Arabis alpina [alpine rockcress]
ref|XP_010318441.1|  PREDICTED: calcium-transporting ATPase 9, pl...    256   1e-75    
ref|XP_010318439.1|  PREDICTED: calcium-transporting ATPase 9, pl...    256   2e-75    Solanum lycopersicum
ref|XP_004235507.1|  PREDICTED: calcium-transporting ATPase 9, pl...    256   2e-75    Solanum lycopersicum
gb|EMT10847.1|  Calcium-transporting ATPase 8, plasma membrane-type     255   5e-75    
emb|CDO97752.1|  unnamed protein product                                255   5e-75    Coffea canephora [robusta coffee]
ref|XP_002453386.1|  hypothetical protein SORBIDRAFT_04g005130          248   1e-73    
ref|NP_001046064.2|  Os02g0176700                                       250   2e-73    
gb|EEE56425.1|  hypothetical protein OsJ_05593                          249   3e-73    Oryza sativa Japonica Group [Japonica rice]
dbj|BAD27978.1|  putative calcium-transporting ATPase                   249   4e-73    Oryza sativa Japonica Group [Japonica rice]
gb|EEC72600.1|  hypothetical protein OsI_06071                          249   5e-73    Oryza sativa Indica Group [Indian rice]
ref|XP_011072737.1|  PREDICTED: calcium-transporting ATPase 9, pl...    249   6e-73    Sesamum indicum [beniseed]
ref|NP_001169407.1|  uncharacterized protein LOC100383276               243   3e-72    
gb|AFW70362.1|  hypothetical protein ZEAMMB73_750559                    237   4e-72    
gb|KCW53956.1|  hypothetical protein EUGRSUZ_J031612                    243   5e-72    Eucalyptus grandis [rose gum]
ref|XP_004951726.1|  PREDICTED: calcium-transporting ATPase 8, pl...    246   1e-71    Setaria italica
ref|XP_008645304.1|  PREDICTED: calcium-transporting ATPase 9, pl...    244   3e-71    Zea mays [maize]
ref|XP_008645303.1|  PREDICTED: calcium-transporting ATPase 8, pl...    244   3e-71    Zea mays [maize]
ref|XP_006648366.1|  PREDICTED: calcium-transporting ATPase 8, pl...    242   2e-70    Oryza brachyantha
gb|EYU26420.1|  hypothetical protein MIMGU_mgv1a024499mg                236   3e-70    Erythranthe guttata [common monkey flower]
ref|XP_010445063.1|  PREDICTED: calcium-transporting ATPase 10, p...    231   4e-69    
ref|XP_002325252.2|  hypothetical protein POPTR_0018s13660g             236   3e-68    
dbj|BAK02901.1|  predicted protein                                      236   3e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN24634.1|  Calcium-transporting ATPase 8, plasma membrane-type     235   5e-68    Glycine soja [wild soybean]
gb|EYU35256.1|  hypothetical protein MIMGU_mgv1a018656mg                228   1e-67    Erythranthe guttata [common monkey flower]
ref|XP_010233900.1|  PREDICTED: calcium-transporting ATPase 8, pl...    230   2e-66    
ref|XP_010233899.1|  PREDICTED: calcium-transporting ATPase 8, pl...    230   5e-66    Brachypodium distachyon [annual false brome]
ref|XP_006595202.1|  PREDICTED: calcium-transporting ATPase 9, pl...    229   6e-66    Glycine max [soybeans]
ref|XP_003595106.1|  Plasma membrane calcium-transporting ATPase        230   8e-66    
ref|XP_003595105.1|  Plasma membrane calcium-transporting ATPase        230   9e-66    
gb|EYU26961.1|  hypothetical protein MIMGU_mgv1a020650mg                223   2e-65    Erythranthe guttata [common monkey flower]
gb|KHN22385.1|  Calcium-transporting ATPase 9, plasma membrane-type     226   7e-64    Glycine soja [wild soybean]
gb|KHN31858.1|  Calcium-transporting ATPase 9, plasma membrane-type     222   3e-63    Glycine soja [wild soybean]
gb|EYU30580.1|  hypothetical protein MIMGU_mgv1a025977mg                214   1e-62    
gb|KHN38078.1|  Calcium-transporting ATPase 9, plasma membrane-type     217   2e-61    
gb|EMT28209.1|  Calcium-transporting ATPase 9, plasma membrane-type     211   2e-59    
gb|EMS62084.1|  Calcium-transporting ATPase 9, plasma membrane-type     211   1e-58    
ref|XP_008231999.1|  PREDICTED: putative calcium-transporting ATP...    209   1e-58    
gb|AAP92715.1|  calcium-transporting ATPase 1                           209   1e-58    
dbj|BAF00961.1|  Ca2+-transporting ATPase like protein                  205   2e-58    
gb|KCW61616.1|  hypothetical protein EUGRSUZ_H04353                     207   4e-58    
ref|XP_007220166.1|  hypothetical protein PRUPE_ppa017146mg             207   4e-58    
gb|KCW61615.1|  hypothetical protein EUGRSUZ_H04352                     206   5e-58    
ref|XP_010025026.1|  PREDICTED: calcium-transporting ATPase 12, p...    207   6e-58    
ref|XP_006375913.1|  hypothetical protein POPTR_0013s05960g             206   6e-58    
gb|KHN39354.1|  Calcium-transporting ATPase 9, plasma membrane-type     207   7e-58    
gb|KCW61610.1|  hypothetical protein EUGRSUZ_H04346                     206   7e-58    
gb|KCW61614.1|  hypothetical protein EUGRSUZ_H04351                     206   7e-58    
ref|XP_011004262.1|  PREDICTED: calcium-transporting ATPase 12, p...    206   9e-58    
ref|XP_010027199.1|  PREDICTED: calcium-transporting ATPase 12, p...    206   9e-58    
ref|XP_010025025.1|  PREDICTED: calcium-transporting ATPase 12, p...    206   1e-57    
ref|XP_010027201.1|  PREDICTED: calcium-transporting ATPase 12, p...    206   2e-57    
ref|XP_010659882.1|  PREDICTED: calcium-transporting ATPase 12, p...    206   2e-57    
gb|AFW70361.1|  hypothetical protein ZEAMMB73_750559                    198   3e-57    
gb|KCW61608.1|  hypothetical protein EUGRSUZ_H04342                     205   4e-57    
ref|XP_002976723.1|  hypothetical protein SELMODRAFT_451372             205   4e-57    
gb|KCW61621.1|  hypothetical protein EUGRSUZ_H04359                     204   4e-57    
ref|XP_010027204.1|  PREDICTED: calcium-transporting ATPase 12, p...    204   9e-57    
ref|XP_010025023.1|  PREDICTED: calcium-transporting ATPase 12, p...    204   9e-57    
ref|XP_006375832.1|  hypothetical protein POPTR_0013s03760g             202   3e-56    
gb|KCW61612.1|  hypothetical protein EUGRSUZ_H04349                     202   3e-56    
ref|XP_010025024.1|  PREDICTED: calcium-transporting ATPase 12, p...    202   3e-56    
ref|XP_011462472.1|  PREDICTED: putative calcium-transporting ATP...    201   4e-56    
gb|KCW61622.1|  hypothetical protein EUGRSUZ_H04360                     200   6e-56    
gb|KCW61620.1|  hypothetical protein EUGRSUZ_H04358                     201   6e-56    
ref|XP_010027202.1|  PREDICTED: calcium-transporting ATPase 12, p...    201   6e-56    
gb|KDP21394.1|  hypothetical protein JCGZ_21865                         201   8e-56    
ref|XP_006347758.1|  PREDICTED: calcium-transporting ATPase 12, p...    201   1e-55    
ref|XP_008355820.1|  PREDICTED: calcium-transporting ATPase 12, p...    200   1e-55    
ref|XP_002973134.1|  hypothetical protein SELMODRAFT_451600             201   2e-55    
gb|KJB22597.1|  hypothetical protein B456_004G056600                    200   3e-55    
gb|EMS49508.1|  Calcium-transporting ATPase 8, plasma membrane-type     199   5e-55    
ref|XP_006382786.1|  hypothetical protein POPTR_0005s05420g             198   5e-55    
ref|XP_004231233.2|  PREDICTED: putative calcium-transporting ATP...    199   5e-55    
ref|XP_010102299.1|  Calcium-transporting ATPase 12, plasma membr...    198   6e-55    
ref|XP_009613944.1|  PREDICTED: putative calcium-transporting ATP...    198   7e-55    
ref|XP_009396673.1|  PREDICTED: calcium-transporting ATPase 12, p...    198   8e-55    
gb|EMT00880.1|  Calcium-transporting ATPase 9, plasma membrane-type     198   1e-54    
ref|XP_010278086.1|  PREDICTED: putative calcium-transporting ATP...    197   2e-54    
ref|XP_008808021.1|  PREDICTED: putative calcium-transporting ATP...    196   2e-54    
gb|EYU30572.1|  hypothetical protein MIMGU_mgv1a024821mg                191   4e-54    
gb|KDO48938.1|  hypothetical protein CISIN_1g047874mg                   196   5e-54    
ref|XP_010279284.1|  PREDICTED: calcium-transporting ATPase 12, p...    196   5e-54    
ref|XP_008808020.1|  PREDICTED: putative calcium-transporting ATP...    196   6e-54    
ref|XP_011079983.1|  PREDICTED: calcium-transporting ATPase 12, p...    196   8e-54    
gb|KCW61609.1|  hypothetical protein EUGRSUZ_H04343                     194   1e-53    
ref|XP_009792933.1|  PREDICTED: calcium-transporting ATPase 12, p...    195   1e-53    
ref|XP_007160386.1|  hypothetical protein PHAVU_002G317400g             194   1e-53    
ref|XP_006432653.1|  hypothetical protein CICLE_v10000132mg             194   2e-53    
ref|XP_002307612.2|  hypothetical protein POPTR_0005s23710g             194   2e-53    
ref|XP_011032414.1|  PREDICTED: calcium-transporting ATPase 12, p...    194   2e-53    
ref|XP_006604467.1|  PREDICTED: calcium-transporting ATPase 12, p...    194   2e-53    
ref|XP_010917644.1|  PREDICTED: putative calcium-transporting ATP...    193   2e-53    
ref|XP_010674825.1|  PREDICTED: putative calcium-transporting ATP...    194   2e-53    
gb|KHN02549.1|  Calcium-transporting ATPase 12, plasma membrane-type    194   2e-53    
ref|XP_004493726.1|  PREDICTED: calcium-transporting ATPase 12, p...    194   3e-53    
ref|XP_011458602.1|  PREDICTED: calcium-transporting ATPase 12, p...    194   3e-53    
ref|XP_002512213.1|  cation-transporting atpase plant, putative         193   4e-53    
ref|XP_002279443.2|  PREDICTED: putative calcium-transporting ATP...    193   5e-53    
gb|EMT05411.1|  Calcium-transporting ATPase 8, plasma membrane-type     194   5e-53    
gb|KJB44881.1|  hypothetical protein B456_007G277600                    193   6e-53    
gb|KJB44880.1|  hypothetical protein B456_007G277500                    193   7e-53    
ref|XP_010259206.1|  PREDICTED: calcium-transporting ATPase 12, p...    193   7e-53    
ref|XP_006471663.1|  PREDICTED: calcium-transporting ATPase 12, p...    192   8e-53    
ref|XP_010087108.1|  Calcium-transporting ATPase 12, plasma membr...    193   8e-53    
ref|XP_002279818.1|  PREDICTED: putative calcium-transporting ATP...    192   8e-53    
ref|XP_007030586.1|  Autoinhibited calcium ATPase                       192   1e-52    
ref|XP_010259161.1|  PREDICTED: LOW QUALITY PROTEIN: putative cal...    192   1e-52    
ref|XP_011032627.1|  PREDICTED: calcium-transporting ATPase 12, p...    192   1e-52    
gb|EMS63749.1|  Calcium-transporting ATPase 8, plasma membrane-type     192   1e-52    
ref|XP_002300816.2|  hypothetical protein POPTR_0002s04840g             192   2e-52    
ref|XP_006432948.1|  hypothetical protein CICLE_v10000126mg             192   2e-52    
gb|AAL17950.1|  type IIB calcium ATPase                                 192   2e-52    
ref|XP_006471461.1|  PREDICTED: calcium-transporting ATPase 12, p...    192   2e-52    
emb|CAN63793.1|  hypothetical protein VITISV_002789                     192   2e-52    
gb|KHN10695.1|  Calcium-transporting ATPase 12, plasma membrane-type    191   2e-52    
ref|XP_006471464.1|  PREDICTED: calcium-transporting ATPase 12, p...    192   2e-52    
ref|XP_006432655.1|  hypothetical protein CICLE_v10003326mg             192   2e-52    
gb|EMS48814.1|  Calcium-transporting ATPase 8, plasma membrane-type     192   2e-52    
gb|EYU46530.1|  hypothetical protein MIMGU_mgv1a020656mg                191   2e-52    
ref|XP_003521262.1|  PREDICTED: calcium-transporting ATPase 12, p...    191   3e-52    
ref|XP_006471543.1|  PREDICTED: calcium-transporting ATPase 12, p...    192   3e-52    
ref|XP_010923516.1|  PREDICTED: putative calcium-transporting ATP...    191   3e-52    
ref|XP_002279567.2|  PREDICTED: putative calcium-transporting ATP...    191   4e-52    
emb|CDP11311.1|  unnamed protein product                                191   4e-52    
ref|XP_010279282.1|  PREDICTED: calcium-transporting ATPase 12, p...    191   5e-52    
ref|XP_006584878.1|  PREDICTED: putative calcium-transporting ATP...    190   5e-52    
ref|XP_008224449.1|  PREDICTED: putative calcium-transporting ATP...    190   5e-52    
ref|XP_002983625.1|  hypothetical protein SELMODRAFT_118764             189   7e-52    
ref|XP_006432652.1|  hypothetical protein CICLE_v10000129mg             190   8e-52    
ref|XP_010679135.1|  PREDICTED: calcium-transporting ATPase 12, p...    190   8e-52    
ref|XP_007226660.1|  hypothetical protein PRUPE_ppa021744mg             190   8e-52    
ref|XP_002274001.1|  PREDICTED: calcium-transporting ATPase 12, p...    190   9e-52    
ref|XP_011026092.1|  PREDICTED: calcium-transporting ATPase 12, p...    190   9e-52    
ref|XP_007030588.1|  ATPase E1-E2 type family protein / haloacid ...    189   9e-52    
ref|XP_010474072.1|  PREDICTED: calcium-transporting ATPase 8, pl...    189   1e-51    
ref|XP_010107728.1|  Putative calcium-transporting ATPase 13, pla...    189   1e-51    
ref|XP_010446073.1|  PREDICTED: calcium-transporting ATPase 8, pl...    189   2e-51    
ref|XP_002279864.1|  PREDICTED: putative calcium-transporting ATP...    189   2e-51    
gb|KCW57769.1|  hypothetical protein EUGRSUZ_H00527                     187   2e-51    
ref|XP_011090652.1|  PREDICTED: putative calcium-transporting ATP...    188   3e-51    
ref|XP_009139813.1|  PREDICTED: calcium-transporting ATPase 8, pl...    188   3e-51    
ref|XP_004146962.1|  PREDICTED: calcium-transporting ATPase 12, p...    188   3e-51    
ref|XP_002274787.1|  PREDICTED: calcium-transporting ATPase 12, p...    189   3e-51    
gb|KCW61618.1|  hypothetical protein EUGRSUZ_H043551                    186   3e-51    
ref|XP_008388676.1|  PREDICTED: calcium-transporting ATPase 12, p...    188   4e-51    
ref|XP_010649968.1|  PREDICTED: putative calcium-transporting ATP...    187   6e-51    
ref|XP_008451291.1|  PREDICTED: calcium-transporting ATPase 12, p...    187   7e-51    
ref|XP_002279498.1|  PREDICTED: putative calcium-transporting ATP...    187   8e-51    
ref|XP_002279593.1|  PREDICTED: putative calcium-transporting ATP...    187   8e-51    
ref|XP_002990585.1|  hypothetical protein SELMODRAFT_451597             187   8e-51    
ref|XP_002980822.1|  hypothetical protein SELMODRAFT_154134             186   1e-50    
ref|XP_009139820.1|  PREDICTED: calcium-transporting ATPase 8, pl...    186   1e-50    
ref|XP_002279629.1|  PREDICTED: putative calcium-transporting ATP...    186   1e-50    
ref|XP_010069416.1|  PREDICTED: putative calcium-transporting ATP...    186   2e-50    
ref|XP_007050467.1|  ATPase E1-E2 type family protein / haloacid ...    186   2e-50    
ref|XP_008235351.1|  PREDICTED: calcium-transporting ATPase 12, p...    186   2e-50    
ref|XP_008235352.1|  PREDICTED: calcium-transporting ATPase 12, p...    186   3e-50    
ref|XP_009359439.1|  PREDICTED: putative calcium-transporting ATP...    186   3e-50    
ref|XP_007199695.1|  hypothetical protein PRUPE_ppa000727mg             186   3e-50    
ref|XP_009410981.1|  PREDICTED: putative calcium-transporting ATP...    186   3e-50    
ref|XP_002512214.1|  cation-transporting atpase plant, putative         185   4e-50    
ref|XP_009364513.1|  PREDICTED: calcium-transporting ATPase 12, p...    185   4e-50    
ref|XP_008341023.1|  PREDICTED: putative calcium-transporting ATP...    185   5e-50    
emb|CDY40822.1|  BnaC01g31340D                                          185   5e-50    
ref|XP_002961828.1|  hypothetical protein SELMODRAFT_266601             185   6e-50    
ref|XP_008353291.1|  PREDICTED: putative calcium-transporting ATP...    185   6e-50    
emb|CDX94389.1|  BnaC01g17950D                                          184   8e-50    
gb|AAD29712.1|AF140499_1  chloroplast envelope calcium ATPase pre...    170   9e-50    
ref|XP_004162190.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-tran...    184   1e-49    
ref|XP_009139804.1|  PREDICTED: calcium-transporting ATPase 8, pl...    184   1e-49    
ref|XP_011091164.1|  PREDICTED: calcium-transporting ATPase 12, p...    181   1e-49    
ref|XP_001780927.1|  predicted protein                                  184   1e-49    
ref|XP_009139793.1|  PREDICTED: calcium-transporting ATPase 8, pl...    184   1e-49    
ref|XP_009344390.1|  PREDICTED: putative calcium-transporting ATP...    183   1e-49    
ref|XP_006420055.1|  hypothetical protein CICLE_v10006602mg             182   1e-49    
emb|CDY34219.1|  BnaA01g24360D                                          184   1e-49    
ref|XP_009139779.1|  PREDICTED: calcium-transporting ATPase 8, pl...    184   1e-49    
ref|XP_009344391.1|  PREDICTED: putative calcium-transporting ATP...    183   2e-49    
emb|CAD67615.1|  putative P-type II calcium ATPase                      183   3e-49    
gb|EMT05203.1|  Putative calcium-transporting ATPase 13, plasma m...    182   3e-49    
ref|XP_009363656.1|  PREDICTED: putative calcium-transporting ATP...    183   3e-49    
dbj|BAJ96750.1|  predicted protein                                      181   3e-49    
ref|XP_009108561.1|  PREDICTED: putative calcium-transporting ATP...    182   4e-49    
ref|XP_002274129.1|  PREDICTED: putative calcium-transporting ATP...    182   4e-49    
ref|XP_002885529.1|  hypothetical protein ARALYDRAFT_898774             182   4e-49    
ref|XP_002283579.1|  PREDICTED: putative calcium-transporting ATP...    182   4e-49    
ref|XP_008352909.1|  PREDICTED: putative calcium-transporting ATP...    182   5e-49    
ref|XP_004296593.1|  PREDICTED: putative calcium-transporting ATP...    182   6e-49    
ref|XP_010532587.1|  PREDICTED: putative calcium-transporting ATP...    182   6e-49    
ref|XP_010650037.1|  PREDICTED: putative calcium-transporting ATP...    182   6e-49    
ref|XP_006489476.1|  PREDICTED: putative calcium-transporting ATP...    182   7e-49    
ref|XP_004296594.1|  PREDICTED: putative calcium-transporting ATP...    182   7e-49    
emb|CAN81891.1|  hypothetical protein VITISV_023611                     181   8e-49    
ref|XP_007030589.1|  ATPase E1-E2 type family protein / haloacid ...    181   9e-49    
ref|XP_002279888.1|  PREDICTED: putative calcium-transporting ATP...    181   9e-49    
gb|KFK39573.1|  hypothetical protein AALP_AA3G261900                    181   1e-48    
gb|EPS71825.1|  hypothetical protein M569_02931                         182   1e-48    
ref|XP_009370751.1|  PREDICTED: calcium-transporting ATPase 12, p...    182   1e-48    
ref|XP_010279281.1|  PREDICTED: calcium-transporting ATPase 12, p...    182   1e-48    
gb|KHN32276.1|  Calcium-transporting ATPase 12, plasma membrane-type    181   1e-48    
ref|XP_003537780.1|  PREDICTED: putative calcium-transporting ATP...    181   1e-48    
ref|XP_001767354.1|  predicted protein                                  181   1e-48    
emb|CAN60428.1|  hypothetical protein VITISV_021532                     181   2e-48    
ref|XP_007225393.1|  hypothetical protein PRUPE_ppa000704mg             180   2e-48    
ref|XP_007225391.1|  hypothetical protein PRUPE_ppa000700mg             180   2e-48    
gb|KCW57762.1|  hypothetical protein EUGRSUZ_H00512                     180   2e-48    
ref|XP_010025937.1|  PREDICTED: putative calcium-transporting ATP...    179   3e-48    
ref|XP_006363455.1|  PREDICTED: putative calcium-transporting ATP...    180   3e-48    
ref|XP_008368699.1|  PREDICTED: calcium-transporting ATPase 12, p...    180   3e-48    
gb|KCW57761.1|  hypothetical protein EUGRSUZ_H00511                     179   3e-48    
ref|XP_008386410.1|  PREDICTED: calcium-transporting ATPase 12, p...    180   3e-48    
gb|KHN30766.1|  Putative calcium-transporting ATPase 13, plasma m...    179   4e-48    
ref|XP_008224221.1|  PREDICTED: putative calcium-transporting ATP...    179   4e-48    
gb|EYU40005.1|  hypothetical protein MIMGU_mgv1a023995mg                176   5e-48    
ref|XP_007225392.1|  hypothetical protein PRUPE_ppa000702mg             179   5e-48    
gb|KFK35492.1|  hypothetical protein AALP_AA5G291700                    179   7e-48    
ref|XP_002517055.1|  cation-transporting atpase plant, putative         179   7e-48    
ref|XP_001753347.1|  predicted protein                                  179   1e-47    
ref|XP_010468854.1|  PREDICTED: calcium-transporting ATPase 12, p...    178   1e-47    
ref|XP_002989401.1|  hypothetical protein SELMODRAFT_129812             179   1e-47    
ref|XP_006362197.1|  PREDICTED: putative calcium-transporting ATP...    176   1e-47    
emb|CDX93910.1|  BnaC04g20690D                                          178   1e-47    
emb|CDX94386.1|  BnaC01g17980D                                          178   1e-47    
ref|XP_008339516.1|  PREDICTED: putative calcium-transporting ATP...    178   2e-47    
ref|XP_010488324.1|  PREDICTED: putative calcium-transporting ATP...    178   2e-47    
ref|XP_003554951.1|  PREDICTED: putative calcium-transporting ATP...    178   2e-47    
ref|XP_010038673.1|  PREDICTED: calcium-transporting ATPase 12, p...    178   2e-47    
gb|KCW57759.1|  hypothetical protein EUGRSUZ_H00509                     177   2e-47    
ref|XP_009337268.1|  PREDICTED: putative calcium-transporting ATP...    177   2e-47    
ref|XP_003573930.1|  PREDICTED: putative calcium-transporting ATP...    177   3e-47    
ref|XP_010512754.1|  PREDICTED: calcium-transporting ATPase 12, p...    176   3e-47    
ref|XP_007034902.1|  Autoinhibited calcium ATPase                       177   3e-47    
ref|XP_010025935.1|  PREDICTED: putative calcium-transporting ATP...    177   3e-47    
ref|XP_006661779.1|  PREDICTED: putative calcium-transporting ATP...    177   4e-47    
ref|XP_010413156.1|  PREDICTED: calcium-transporting ATPase 12, p...    177   4e-47    
ref|XP_004156490.1|  PREDICTED: putative calcium-transporting ATP...    176   4e-47    
ref|XP_008455890.1|  PREDICTED: putative calcium-transporting ATP...    177   4e-47    
gb|KGN60816.1|  hypothetical protein Csa_2G011490                       177   4e-47    
ref|XP_010545103.1|  PREDICTED: calcium-transporting ATPase 12, p...    177   4e-47    
ref|XP_004139378.1|  PREDICTED: putative calcium-transporting ATP...    176   4e-47    
ref|XP_010025938.1|  PREDICTED: putative calcium-transporting ATP...    177   5e-47    
ref|XP_010511883.1|  PREDICTED: putative calcium-transporting ATP...    176   5e-47    
ref|XP_010466584.1|  PREDICTED: LOW QUALITY PROTEIN: putative cal...    176   5e-47    
emb|CDX89375.1|  BnaA01g15180D                                          176   6e-47    
ref|XP_002962451.1|  hypothetical protein SELMODRAFT_78287              176   6e-47    
emb|CAN83242.1|  hypothetical protein VITISV_000815                     176   7e-47    
ref|XP_002878514.1|  hypothetical protein ARALYDRAFT_486846             176   7e-47    
emb|CDY10319.1|  BnaC05g29600D                                          176   8e-47    
gb|EEC66952.1|  hypothetical protein OsI_33593                          174   8e-47    
ref|NP_188931.1|  putative calcium-transporting ATPase 13               176   9e-47    
ref|XP_002464616.1|  hypothetical protein SORBIDRAFT_01g021870          176   9e-47    
emb|CDY10680.1|  BnaA05g16820D                                          176   1e-46    
ref|XP_009145252.1|  PREDICTED: putative calcium-transporting ATP...    175   1e-46    



>ref|XP_006366962.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006366963.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006366964.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X3 [Solanum tuberosum]
Length=1081

 Score =   325 bits (833),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 191/210 (91%), Gaps = 5/210 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL+VLMIRFFTGHT +P     F AGKTKVG A+DGAIKIFTIAVTIVVVAVPEGLPLA
Sbjct  394  LVLIVLMIRFFTGHTYNPDGSPQFTAGKTKVGKAVDGAIKIFTIAVTIVVVAVPEGLPLA  453

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AYI GK+I+
Sbjct  454  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYISGKKID  513

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFD  525
            PPDD+S++P  V+ LL EG+  NTTGSVFVP+GG   E+SGSPTEKAILQ+G+ LG+NFD
Sbjct  514  PPDDRSEVPPTVLSLLHEGVGLNTTGSVFVPQGGAAVEISGSPTEKAILQWGLNLGMNFD  573

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSE  615
            A+RSE+SIIHAFPFNSEKKRGGVAVKLDSE
Sbjct  574  AVRSEASIIHAFPFNSEKKRGGVAVKLDSE  603



>ref|XP_010323145.1| PREDICTED: auto-inhibited Ca2 -transporting ATPase 10 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010323146.1| PREDICTED: auto-inhibited Ca2 -transporting ATPase 10 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010323147.1| PREDICTED: auto-inhibited Ca2 -transporting ATPase 10 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010323148.1| PREDICTED: auto-inhibited Ca2 -transporting ATPase 10 isoform 
X1 [Solanum lycopersicum]
Length=1081

 Score =   325 bits (832),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 191/210 (91%), Gaps = 5/210 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL+VLMIRFFTGHT +P     FKAGKTKVG A+DGAIKIFTIAVTIVVVAVPEGLPLA
Sbjct  394  LVLIVLMIRFFTGHTYNPDGSPQFKAGKTKVGKAVDGAIKIFTIAVTIVVVAVPEGLPLA  453

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ YI GK+I+
Sbjct  454  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEVYISGKKID  513

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFD  525
            PPDD+S++P  V+ LL EG+  NTTGSVFVP+ GG  E+SGSPTEKAILQ+G+ LG+NFD
Sbjct  514  PPDDRSEVPPTVLSLLHEGVGLNTTGSVFVPQGGGAVEISGSPTEKAILQWGLNLGMNFD  573

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSE  615
            A+RSE+SIIHAFPFNSEKKRGGVAVKLDSE
Sbjct  574  AVRSEASIIHAFPFNSEKKRGGVAVKLDSE  603



>ref|NP_001234817.1| auto-inhibited Ca2 -transporting ATPase 10 [Solanum lycopersicum]
 gb|AEO12147.1| auto-inhibited Ca2+-transporting ATPase 10 [Solanum lycopersicum]
Length=1081

 Score =   322 bits (826),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 190/210 (90%), Gaps = 5/210 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL+V MIRFFTGHT +P     FKAGKTKVG A+DGAIKIFTIAVTIVVVAVPEGLPLA
Sbjct  394  LVLIVXMIRFFTGHTYNPDGSPQFKAGKTKVGKAVDGAIKIFTIAVTIVVVAVPEGLPLA  453

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ YI GK+I+
Sbjct  454  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEVYISGKKID  513

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFD  525
            PPDD+S++P  V+ LL EG+  NTTGSVFVP+ GG  E+SGSPTEKAILQ+G+ LG+NFD
Sbjct  514  PPDDRSEVPPTVLSLLHEGVGLNTTGSVFVPQGGGAVEISGSPTEKAILQWGLNLGMNFD  573

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSE  615
            A+RSE+SIIHAFPFNSEKKRGGVAVKLDSE
Sbjct  574  AVRSEASIIHAFPFNSEKKRGGVAVKLDSE  603



>emb|CDP12667.1| unnamed protein product [Coffea canephora]
Length=864

 Score =   315 bits (806),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 187/214 (87%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL+VL IRFFTGHT +      FKAG+TK   AIDGAIKIFT+AVTIVVVAVPEGLPLA
Sbjct  160  IVLIVLFIRFFTGHTYNADGSRQFKAGRTKASTAIDGAIKIFTVAVTIVVVAVPEGLPLA  219

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+GGK+++
Sbjct  220  VTLTLAYSMRKMMRDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGGKKVD  279

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFD  525
            PPDDKS LP K+  LL EGIAQN+TGSVF+PE GG  EVSGSPTEKAILQ+G+ LG+NFD
Sbjct  280  PPDDKSLLPPKLTSLLTEGIAQNSTGSVFLPEGGGDAEVSGSPTEKAILQWGLNLGMNFD  339

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             IRS SSIIHAFPFNSEKKRGGVAVKL    I++
Sbjct  340  VIRSSSSIIHAFPFNSEKKRGGVAVKLPDSDIHV  373



>ref|XP_009601429.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Nicotiana tomentosiformis]
 ref|XP_009601430.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Nicotiana tomentosiformis]
 ref|XP_009601431.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Nicotiana tomentosiformis]
 ref|XP_009601433.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Nicotiana tomentosiformis]
Length=1087

 Score =   318 bits (815),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 190/210 (90%), Gaps = 6/210 (3%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VLMIRFFTGHT +P     FKAGKT+VG A+DGAIKIFT+AVTIVVVAVPEGLPLAV
Sbjct  400  VLIVLMIRFFTGHTYNPDGTVQFKAGKTRVGKAVDGAIKIFTVAVTIVVVAVPEGLPLAV  459

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+ GK+I+P
Sbjct  460  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVCGKKIDP  519

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQFGVKLGLNFDA  528
            PDD+S +P  V+ LL EG+  NTTGS+FVP+GG   E+SGSPTEKAILQ+GV LG+NFDA
Sbjct  520  PDDRSAVPPTVLSLLHEGVGLNTTGSIFVPQGGAAAEISGSPTEKAILQWGVNLGMNFDA  579

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKL-DSE  615
            +RS++SIIHAFPFNSEKKRGGVAVKL DSE
Sbjct  580  VRSKASIIHAFPFNSEKKRGGVAVKLHDSE  609



>ref|XP_009757245.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Nicotiana sylvestris]
 ref|XP_009757246.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Nicotiana sylvestris]
 ref|XP_009757247.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Nicotiana sylvestris]
 ref|XP_009757248.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Nicotiana sylvestris]
 ref|XP_009757249.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Nicotiana sylvestris]
 ref|XP_009757250.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Nicotiana sylvestris]
 ref|XP_009757251.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Nicotiana sylvestris]
Length=1087

 Score =   316 bits (809),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 189/210 (90%), Gaps = 6/210 (3%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VLMIRFFTGHT +P     FKAGKT+VG A+DGAIKIFT+AVTIVVVAVPEGLPLAV
Sbjct  400  VLIVLMIRFFTGHTYNPDGTVQFKAGKTRVGKAVDGAIKIFTVAVTIVVVAVPEGLPLAV  459

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+ GK+I+P
Sbjct  460  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVCGKKIDP  519

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PDD+S +P  V+ LL EG+  NTTGS+FVP+ GG  E+SGSPTEKAILQ+ V LG+NFDA
Sbjct  520  PDDRSAVPPTVLSLLHEGVGLNTTGSIFVPQGGGAAEISGSPTEKAILQWAVNLGMNFDA  579

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKL-DSE  615
            ++SE+SIIHAFPFNSEKKRGGVAVKL DSE
Sbjct  580  VQSEASIIHAFPFNSEKKRGGVAVKLHDSE  609



>ref|XP_011094128.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
isoform X2 [Sesamum indicum]
Length=1093

 Score =   312 bits (799),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 186/210 (89%), Gaps = 6/210 (3%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L+ RFFTGHTK+P     F AGKTKVGDAIDG IKIFT+AVTIVVVAVPEGLPLAV
Sbjct  395  VLIILVARFFTGHTKNPDGTVQFTAGKTKVGDAIDGFIKIFTVAVTIVVVAVPEGLPLAV  454

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY  GK+I+P
Sbjct  455  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYACGKKIDP  514

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PD+KS LP  VI LL+EG+AQNTTGSVFVPE GG  EVSGSPTEKAILQ+G+ LG++F  
Sbjct  515  PDNKSLLPPSVISLLVEGVAQNTTGSVFVPEGGGALEVSGSPTEKAILQWGLNLGMDFSG  574

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKL-DSE  615
             RSES IIHAFPFNSEKKRGGVAVK  DSE
Sbjct  575  ARSESEIIHAFPFNSEKKRGGVAVKRSDSE  604



>ref|XP_011094123.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
isoform X1 [Sesamum indicum]
 ref|XP_011094124.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
isoform X1 [Sesamum indicum]
 ref|XP_011094125.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
isoform X1 [Sesamum indicum]
 ref|XP_011094126.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
isoform X1 [Sesamum indicum]
 ref|XP_011094127.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
isoform X1 [Sesamum indicum]
Length=1095

 Score =   312 bits (799),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 186/210 (89%), Gaps = 6/210 (3%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L+ RFFTGHTK+P     F AGKTKVGDAIDG IKIFT+AVTIVVVAVPEGLPLAV
Sbjct  397  VLIILVARFFTGHTKNPDGTVQFTAGKTKVGDAIDGFIKIFTVAVTIVVVAVPEGLPLAV  456

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY  GK+I+P
Sbjct  457  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYACGKKIDP  516

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PD+KS LP  VI LL+EG+AQNTTGSVFVPE GG  EVSGSPTEKAILQ+G+ LG++F  
Sbjct  517  PDNKSLLPPSVISLLVEGVAQNTTGSVFVPEGGGALEVSGSPTEKAILQWGLNLGMDFSG  576

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKL-DSE  615
             RSES IIHAFPFNSEKKRGGVAVK  DSE
Sbjct  577  ARSESEIIHAFPFNSEKKRGGVAVKRSDSE  606



>ref|XP_002518263.1| cation-transporting atpase plant, putative [Ricinus communis]
 gb|EEF44149.1| cation-transporting atpase plant, putative [Ricinus communis]
Length=1075

 Score =   310 bits (794),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 188/211 (89%), Gaps = 6/211 (3%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL+VL++RFFTGHTK+      F AGKT VGDA+DGAIKI T+AVTIVVVAVPEGLPLA
Sbjct  386  LVLIVLIVRFFTGHTKNADGSRQFTAGKTSVGDAVDGAIKILTVAVTIVVVAVPEGLPLA  445

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRL+ACETMGSATTICSDKTGTLTLNQMTVVDAY+GGK+I+
Sbjct  446  VTLTLAYSMRKMMADKALVRRLAACETMGSATTICSDKTGTLTLNQMTVVDAYVGGKKID  505

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFD  525
            PPD+KSQL   +  LL+EG++QNT GSVF+PE GG  EVSGSPTEKAIL +GVKLG+NF 
Sbjct  506  PPDNKSQLSPNLFSLLIEGVSQNTNGSVFIPEDGGETEVSGSPTEKAILVWGVKLGMNFQ  565

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKL-DSE  615
            A RSES+IIH FPFNS+KKRGGVA++L DSE
Sbjct  566  AARSESTIIHVFPFNSQKKRGGVALQLPDSE  596



>gb|KDP30671.1| hypothetical protein JCGZ_16227 [Jatropha curcas]
Length=1089

 Score =   306 bits (784),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 188/211 (89%), Gaps = 6/211 (3%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +V +VL++RFFTGH+K+P+    F AGKT +GDA+DG IKI T+AVTIVVVAVPEGLPLA
Sbjct  388  IVFIVLLVRFFTGHSKNPNGSRQFTAGKTSIGDAVDGVIKILTVAVTIVVVAVPEGLPLA  447

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+GGK+I+
Sbjct  448  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGGKKID  507

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFD  525
             P+ KS+L  K+  LL+EGIAQNT GSVF+PE GG  EVSGSPTEKAIL +GVKLG+NFD
Sbjct  508  SPESKSELSPKLSSLLIEGIAQNTNGSVFIPENGGDLEVSGSPTEKAILVWGVKLGMNFD  567

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKL-DSE  615
            A+RSES+IIH FPFNS+KKRGGVAV+  DSE
Sbjct  568  AVRSESAIIHVFPFNSQKKRGGVAVQRPDSE  598



>gb|KDO61969.1| hypothetical protein CISIN_1g0433051mg, partial [Citrus sinensis]
Length=657

 Score =   297 bits (761),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 180/205 (88%), Gaps = 5/205 (2%)
 Frame = +1

Query  28   FFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYSM  195
            FFTGHTK+ +    FKAGKTKV DA+DGAIKI T+AVTIVVVAVPEGLPLAVTLTLAYSM
Sbjct  1    FFTGHTKNAYGTIQFKAGKTKVSDAVDGAIKILTVAVTIVVVAVPEGLPLAVTLTLAYSM  60

Query  196  RKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQLP  375
            RKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+GG+++NP D  SQL 
Sbjct  61   RKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGGRKMNPTDSNSQLS  120

Query  376  QKVIPLLLEGIAQNTTGSVFV-PEGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSII  552
              V  LL+EGIAQNTTGSV++ P GG  EVSGSPTEKAILQ+G+KLG+NF+A+RSE S++
Sbjct  121  PMVTSLLVEGIAQNTTGSVYLPPNGGEAEVSGSPTEKAILQWGMKLGMNFEAVRSECSVL  180

Query  553  HAFPFNSEKKRGGVAVKLDSEFIYI  627
            H FPFNS KKRGGVAV+L +  ++I
Sbjct  181  HVFPFNSLKKRGGVAVQLPNSEVHI  205



>ref|XP_002309001.2| hypothetical protein POPTR_0006s07240g [Populus trichocarpa]
 gb|EEE92524.2| hypothetical protein POPTR_0006s07240g [Populus trichocarpa]
Length=1082

 Score =   303 bits (777),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 181/206 (88%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+    P FKAGKTK   A+DGAIKI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  401  RYFTGHTKNFDGSPQFKAGKTKASTAVDGAIKILTVAVTIVVVAVPEGLPLAVTLTLAYS  460

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMT+V+AY GG++I+PPD KSQL
Sbjct  461  MRKMMRDKALVRRLSACETMGSATTICSDKTGTLTLNQMTIVEAYSGGQKIDPPDSKSQL  520

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P  +  LL+EGIAQNTTGSVFVPE GG PE+SGSPTEKAIL + VKLG+NFDA+RSESSI
Sbjct  521  PPILSSLLMEGIAQNTTGSVFVPEGGGDPEISGSPTEKAILGWAVKLGMNFDAVRSESSI  580

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IH FPFNSEKK+GGVA++L    ++I
Sbjct  581  IHVFPFNSEKKKGGVALQLPDSQVHI  606



>gb|EYU18198.1| hypothetical protein MIMGU_mgv1a000743mg [Erythranthe guttata]
Length=997

 Score =   300 bits (768),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 186/213 (87%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L+IRFFTGHT DP+    F AGKTK GDAI+G IKIFT+AVTIVVVAVPEGLPLAV
Sbjct  303  VLIILVIRFFTGHTTDPNGRVQFTAGKTKFGDAINGFIKIFTVAVTIVVVAVPEGLPLAV  362

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y  G +++ 
Sbjct  363  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEVYACGNKMDS  422

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            P++KS +P +VI LL+EGIAQN+TGSVFVPE GG  E+SGSPTEKAILQ+ + LG++F +
Sbjct  423  PENKSLVPPRVISLLIEGIAQNSTGSVFVPEGGGALEISGSPTEKAILQWAINLGMDFGS  482

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             RS+S IIHAFPFNSEKKRGGVAVKL +  +++
Sbjct  483  ARSDSVIIHAFPFNSEKKRGGVAVKLSNSEVHV  515



>ref|XP_007154697.1| hypothetical protein PHAVU_003G140200g [Phaseolus vulgaris]
 ref|XP_007154698.1| hypothetical protein PHAVU_003G140200g [Phaseolus vulgaris]
 gb|ESW26691.1| hypothetical protein PHAVU_003G140200g [Phaseolus vulgaris]
 gb|ESW26692.1| hypothetical protein PHAVU_003G140200g [Phaseolus vulgaris]
Length=1082

 Score =   301 bits (770),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 183/214 (86%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL+VL+ R+F+GHT++P     F AGKTKVGDA DG IKIFTIAVTIVVVAVPEGLPLA
Sbjct  401  IVLIVLLARYFSGHTRNPDGSVQFIAGKTKVGDAFDGVIKIFTIAVTIVVVAVPEGLPLA  460

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLT+NQMTVV+A IGGK+I 
Sbjct  461  VTLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTMNQMTVVEACIGGKKII  520

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFD  525
            PPDD  Q    +  LL+EG+AQNT GSV+VPEGG   E+SGSPTEKAIL +G+KLG+ FD
Sbjct  521  PPDDSQQFSAMLRSLLIEGVAQNTNGSVYVPEGGNDVEISGSPTEKAILDWGIKLGMRFD  580

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            A RSESSIIH FPFNSEKKRGGVA+++    I+I
Sbjct  581  AARSESSIIHVFPFNSEKKRGGVAIQMPDSEIHI  614



>gb|KCW78631.1| hypothetical protein EUGRSUZ_C00095 [Eucalyptus grandis]
Length=602

 Score =   290 bits (742),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 175/199 (88%), Gaps = 5/199 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+      FKAGKT   DA+DGAIKI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  397  RYFTGHTKNSDGTVQFKAGKTSASDAVDGAIKIITVAVTIVVVAVPEGLPLAVTLTLAYS  456

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY  G++++PPD  SQL
Sbjct  457  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYACGRKVDPPDSNSQL  516

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               +I LL+EGIAQN+ GSV+VPE GG  EVSGSPTEKAILQ+G+KLG++F+A+RS+SSI
Sbjct  517  STSLISLLIEGIAQNSNGSVYVPEAGGDVEVSGSPTEKAILQWGIKLGMDFEAVRSKSSI  576

Query  550  IHAFPFNSEKKRGGVAVKL  606
            IH FPFNSEKKR GVAVKL
Sbjct  577  IHVFPFNSEKKRAGVAVKL  595



>ref|XP_007227032.1| hypothetical protein PRUPE_ppa000670mg [Prunus persica]
 gb|EMJ28231.1| hypothetical protein PRUPE_ppa000670mg [Prunus persica]
Length=1029

 Score =   297 bits (760),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 186/213 (87%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL++R+FTGHTK+    P F AGKTK GDAIDGAIKI TIAVTIVVVAVPEGLPLAV
Sbjct  339  VLVVLLVRYFTGHTKNANGTPQFMAGKTKFGDAIDGAIKIVTIAVTIVVVAVPEGLPLAV  398

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+A+ GGK+I+ 
Sbjct  399  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAFTGGKKIDV  458

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
             D+KS L   +  LL+EGIA NTTGSV+VPE GG  EVSGSPTEKAILQ+G+KLG+NF+A
Sbjct  459  SDNKSDLSPMLSALLIEGIALNTTGSVYVPETGGDIEVSGSPTEKAILQWGIKLGMNFEA  518

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            I+SES ++H FPFNSEKKRGG AVKL +  ++I
Sbjct  519  IKSESLVLHVFPFNSEKKRGGAAVKLPNSEVHI  551



>ref|XP_007227033.1| hypothetical protein PRUPE_ppa000670mg [Prunus persica]
 gb|EMJ28232.1| hypothetical protein PRUPE_ppa000670mg [Prunus persica]
Length=1041

 Score =   296 bits (758),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 186/213 (87%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL++R+FTGHTK+    P F AGKTK GDAIDGAIKI TIAVTIVVVAVPEGLPLAV
Sbjct  339  VLVVLLVRYFTGHTKNANGTPQFMAGKTKFGDAIDGAIKIVTIAVTIVVVAVPEGLPLAV  398

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+A+ GGK+I+ 
Sbjct  399  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAFTGGKKIDV  458

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
             D+KS L   +  LL+EGIA NTTGSV+VPE GG  EVSGSPTEKAILQ+G+KLG+NF+A
Sbjct  459  SDNKSDLSPMLSALLIEGIALNTTGSVYVPETGGDIEVSGSPTEKAILQWGIKLGMNFEA  518

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            I+SES ++H FPFNSEKKRGG AVKL +  ++I
Sbjct  519  IKSESLVLHVFPFNSEKKRGGAAVKLPNSEVHI  551



>ref|XP_011467548.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Fragaria vesca subsp. vesca]
Length=1104

 Score =   296 bits (759),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 158/213 (74%), Positives = 181/213 (85%), Gaps = 4/213 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VLLVL IR+F+G TKD      F++GKT +  A+DGA+KIFTIAVTIVVVAVPEGLPLA
Sbjct  412  LVLLVLWIRYFSGQTKDTDGKVEFESGKTSISKAVDGAVKIFTIAVTIVVVAVPEGLPLA  471

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G  +I+
Sbjct  472  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGRNKIH  531

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPDD SQL   V  LL EGIAQNT+G+VF PEGG  E+SGSPTEKAIL + +KLG+ F+A
Sbjct  532  PPDDSSQLHSLVSTLLSEGIAQNTSGNVFEPEGGEVEISGSPTEKAILSWALKLGMKFNA  591

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IRSES+I+H FPFNSEKKRGGVAVK     ++I
Sbjct  592  IRSESTILHVFPFNSEKKRGGVAVKGTDSKVHI  624



>gb|EPS66449.1| hypothetical protein M569_08327, partial [Genlisea aurea]
Length=645

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 176/208 (85%), Gaps = 5/208 (2%)
 Frame = +1

Query  19   MIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLA  186
            ++R FTGHTK+P     F AG TKVG AI+  IKIFT+AV IVVVAVPEGLPLAVTLTLA
Sbjct  351  IVRLFTGHTKNPDGSVQFVAGMTKVGAAINAFIKIFTVAVIIVVVAVPEGLPLAVTLTLA  410

Query  187  YSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKS  366
            YSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y  G+++  PDDK 
Sbjct  411  YSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYACGQKLLQPDDKF  470

Query  367  QLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSES  543
            QLP  V  LL+EGIAQNTTGSVFVPE GG  E+SGSPTEKAILQ+GV LG++F+A +SES
Sbjct  471  QLPSGVHSLLVEGIAQNTTGSVFVPECGGALEISGSPTEKAILQWGVNLGMDFNAAQSES  530

Query  544  SIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             IIHAFPFNSEKKRGGVA+KL +  + +
Sbjct  531  VIIHAFPFNSEKKRGGVALKLSNSEVRV  558



>ref|XP_010687434.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=1074

 Score =   295 bits (755),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 182/214 (85%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL+VL+ R+FTGHT++P     FKAGKT    AIDG IKIFT+AVTIVVVAVPEGLPLA
Sbjct  389  VVLVVLIARYFTGHTENPDGSPQFKAGKTSASHAIDGVIKIFTVAVTIVVVAVPEGLPLA  448

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY  GK+++
Sbjct  449  VTLTLAYSMRKMMKDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYANGKKVD  508

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFD  525
            PP+D S L   +  +L+EG+AQNTTG VF+PEGG   E+SGSPTEKAIL +GVKLG+NF+
Sbjct  509  PPNDGSLLSPMLSSVLIEGVAQNTTGCVFLPEGGGDVEISGSPTEKAILSWGVKLGMNFE  568

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            A RSES+IIHAFPFNSEKKRGGVAVK     ++I
Sbjct  569  AKRSESTIIHAFPFNSEKKRGGVAVKTHGSEVHI  602



>ref|XP_011020086.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X2 [Populus euphratica]
Length=1078

 Score =   295 bits (756),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 177/206 (86%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK     P FKAGKTK   AIDG IKI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  401  RYFTGHTKSFDGSPPFKAGKTKASTAIDGTIKILTVAVTIVVVAVPEGLPLAVTLTLAYS  460

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMT+V+AY GG++I+P D KSQL
Sbjct  461  MRKMMRDKALVRRLSACETMGSATTICSDKTGTLTLNQMTIVEAYSGGQKIDPADSKSQL  520

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P  +  LL+EGIAQNTTG VFVPE GG PE+SGSPTEKAIL + +KLG+NFDA+RSESSI
Sbjct  521  PSILSSLLMEGIAQNTTGCVFVPEGGGDPEISGSPTEKAILGWAIKLGMNFDAVRSESSI  580

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IH FPFNSEKK+GGVA++L    ++I
Sbjct  581  IHVFPFNSEKKKGGVALQLPDSQVHI  606



>ref|XP_011020078.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Populus euphratica]
 ref|XP_011020079.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Populus euphratica]
 ref|XP_011020080.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Populus euphratica]
 ref|XP_011020082.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Populus euphratica]
 ref|XP_011020083.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Populus euphratica]
 ref|XP_011020084.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Populus euphratica]
 ref|XP_011020085.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Populus euphratica]
Length=1082

 Score =   295 bits (756),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 177/206 (86%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK     P FKAGKTK   AIDG IKI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  401  RYFTGHTKSFDGSPPFKAGKTKASTAIDGTIKILTVAVTIVVVAVPEGLPLAVTLTLAYS  460

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMT+V+AY GG++I+P D KSQL
Sbjct  461  MRKMMRDKALVRRLSACETMGSATTICSDKTGTLTLNQMTIVEAYSGGQKIDPADSKSQL  520

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P  +  LL+EGIAQNTTG VFVPE GG PE+SGSPTEKAIL + +KLG+NFDA+RSESSI
Sbjct  521  PSILSSLLMEGIAQNTTGCVFVPEGGGDPEISGSPTEKAILGWAIKLGMNFDAVRSESSI  580

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IH FPFNSEKK+GGVA++L    ++I
Sbjct  581  IHVFPFNSEKKKGGVALQLPDSQVHI  606



>ref|XP_010687432.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1085

 Score =   295 bits (754),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 182/214 (85%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL+VL+ R+FTGHT++P     FKAGKT    AIDG IKIFT+AVTIVVVAVPEGLPLA
Sbjct  400  VVLVVLIARYFTGHTENPDGSPQFKAGKTSASHAIDGVIKIFTVAVTIVVVAVPEGLPLA  459

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY  GK+++
Sbjct  460  VTLTLAYSMRKMMKDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYANGKKVD  519

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFD  525
            PP+D S L   +  +L+EG+AQNTTG VF+PEGG   E+SGSPTEKAIL +GVKLG+NF+
Sbjct  520  PPNDGSLLSPMLSSVLIEGVAQNTTGCVFLPEGGGDVEISGSPTEKAILSWGVKLGMNFE  579

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            A RSES+IIHAFPFNSEKKRGGVAVK     ++I
Sbjct  580  AKRSESTIIHAFPFNSEKKRGGVAVKTHGSEVHI  613



>ref|XP_006453219.1| hypothetical protein CICLE_v10007305mg [Citrus clementina]
 ref|XP_006474293.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Citrus sinensis]
 ref|XP_006474294.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X2 [Citrus sinensis]
 ref|XP_006474295.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X3 [Citrus sinensis]
 ref|XP_006474296.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X4 [Citrus sinensis]
 ref|XP_006474297.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X5 [Citrus sinensis]
 ref|XP_006474298.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X6 [Citrus sinensis]
 gb|ESR66459.1| hypothetical protein CICLE_v10007305mg [Citrus clementina]
Length=1072

 Score =   295 bits (754),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 179/206 (87%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            RFFTGHTK+      F+AGKTKV  A+DGAIKI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  394  RFFTGHTKNADGSIQFRAGKTKVSHAVDGAIKILTVAVTIVVVAVPEGLPLAVTLTLAYS  453

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+GG++I+P D  SQL
Sbjct  454  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGGRKIDPTDSNSQL  513

Query  373  PQKVIPLLLEGIAQNTTGSVFV-PEGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               V  LL+EGIAQNTTGSV++ P GG  EVSGSPTEKAILQ+G+KLG+NF+A+RSE S+
Sbjct  514  SPMVTSLLVEGIAQNTTGSVYLPPNGGEAEVSGSPTEKAILQWGMKLGMNFEAVRSECSV  573

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNS KKRGGVAV+L +  ++I
Sbjct  574  LHVFPFNSLKKRGGVAVQLPNSEVHI  599



>ref|XP_010094240.1| Calcium-transporting ATPase 10, plasma membrane-type [Morus notabilis]
 gb|EXB55438.1| Calcium-transporting ATPase 10, plasma membrane-type [Morus notabilis]
Length=1124

 Score =   295 bits (754),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 158/213 (74%), Positives = 184/213 (86%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL++R+FTGH+K+      F AG TKVGDA+DGAIKI T+AVTIVVVAVPEGLPLAV
Sbjct  370  VLVVLLVRYFTGHSKNADGMRQFIAGTTKVGDAVDGAIKIVTVAVTIVVVAVPEGLPLAV  429

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSA TICSDKTGTLTLNQMTVV+AY GGK+++ 
Sbjct  430  TLTLAYSMRKMMADKALVRRLSACETMGSAETICSDKTGTLTLNQMTVVEAYAGGKKVDT  489

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PD+KS LP  V  LL+EGIAQNT G V+VPE GG  EVSGSPTEKAI+ +G+++G+NF+A
Sbjct  490  PDNKSGLPPLVSSLLIEGIAQNTNGGVYVPENGGEIEVSGSPTEKAIISWGIQIGMNFEA  549

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             RSESSI+H FPFNSEKKRGGVAVKL    +++
Sbjct  550  ARSESSILHVFPFNSEKKRGGVAVKLPDSQVHV  582



>ref|XP_008360507.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Malus domestica]
Length=923

 Score =   291 bits (746),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 182/214 (85%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL+VL++R+FTGHTKD    P F AGKTK GDAIDGAIKI TIAVTIVVVAVPEGLPLA
Sbjct  237  LVLIVLLVRYFTGHTKDTTGKPQFTAGKTKFGDAIDGAIKIVTIAVTIVVVAVPEGLPLA  296

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+A+ GG++I 
Sbjct  297  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAFTGGRKIV  356

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFD  525
               DK  L   +  LL+EGIA NT GSV++PE GG  EVSGSPTEKAILQ G+KLG+NFD
Sbjct  357  LSGDKPDLSPMLSSLLIEGIAFNTNGSVYMPETGGDIEVSGSPTEKAILQLGIKLGMNFD  416

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             IRSESS++H FPFNSEKKRGG AVKL +  ++I
Sbjct  417  VIRSESSLLHVFPFNSEKKRGGAAVKLPNSEVHI  450



>ref|XP_008223854.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Prunus mume]
 ref|XP_008223855.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Prunus mume]
 ref|XP_008223856.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Prunus mume]
 ref|XP_008223857.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Prunus mume]
Length=1080

 Score =   293 bits (749),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 181/206 (88%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+    P FKAGKTK GDAIDGAIKI TIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  397  RYFTGHTKNANGTPQFKAGKTKFGDAIDGAIKIVTIAVTIVVVAVPEGLPLAVTLTLAYS  456

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+A+ GGK+I+  D+KS L
Sbjct  457  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAFTGGKKIDISDNKSDL  516

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               +  LL+EGIA NTTGSV+VPE GG  EVSGSPTEKAILQ+G+KLG+NF+AI+SESS+
Sbjct  517  SPMLSALLVEGIALNTTGSVYVPETGGDIEVSGSPTEKAILQWGIKLGMNFEAIKSESSV  576

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGG AVKL +  ++I
Sbjct  577  LHVFPFNSEKKRGGAAVKLPNSEVHI  602



>ref|XP_008391559.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Malus domestica]
 ref|XP_008391560.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Malus domestica]
 ref|XP_008391561.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Malus domestica]
Length=1070

 Score =   291 bits (746),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 182/214 (85%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL+VL++R+FTGHTKD    P F AGKTK GDAIDGAIKI TIAVTIVVVAVPEGLPLA
Sbjct  384  LVLIVLLVRYFTGHTKDTTGKPQFTAGKTKFGDAIDGAIKIVTIAVTIVVVAVPEGLPLA  443

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+A+ GG++I 
Sbjct  444  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAFTGGRKIV  503

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFD  525
               DK  L   +  LL+EGIA NT GSV++PE GG  EVSGSPTEKAILQ G+KLG+NFD
Sbjct  504  LSGDKPDLSPMLSSLLIEGIAFNTNGSVYMPETGGDIEVSGSPTEKAILQLGIKLGMNFD  563

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             IRSESS++H FPFNSEKKRGG AVKL +  ++I
Sbjct  564  VIRSESSLLHVFPFNSEKKRGGAAVKLPNSEVHI  597



>ref|XP_010046911.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Eucalyptus grandis]
 ref|XP_010046912.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Eucalyptus grandis]
 ref|XP_010046913.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Eucalyptus grandis]
Length=1072

 Score =   291 bits (745),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 178/203 (88%), Gaps = 6/203 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+      FKAGKT   DA+DGAIKI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  397  RYFTGHTKNSDGTVQFKAGKTSASDAVDGAIKIITVAVTIVVVAVPEGLPLAVTLTLAYS  456

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY  G++++PPD  SQL
Sbjct  457  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYACGRKVDPPDSNSQL  516

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               +I LL+EGIAQN+ GSV+VPE GG  EVSGSPTEKAILQ+G+KLG++F+A+RS+SSI
Sbjct  517  STSLISLLIEGIAQNSNGSVYVPEAGGDVEVSGSPTEKAILQWGIKLGMDFEAVRSKSSI  576

Query  550  IHAFPFNSEKKRGGVAVKL-DSE  615
            IH FPFNSEKKR GVAVKL DSE
Sbjct  577  IHVFPFNSEKKRAGVAVKLPDSE  599



>gb|KJB21987.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
 gb|KJB21994.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
Length=997

 Score =   290 bits (742),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 184/213 (86%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL++R+FTGHT+D +    F AGKT VG+AIDGAIKI T+AVTIVVVAVPEGLPLAV
Sbjct  392  VLVVLLVRYFTGHTEDSNGRQQFVAGKTSVGNAIDGAIKIVTVAVTIVVVAVPEGLPLAV  451

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GG++ +P
Sbjct  452  TLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGGRKNDP  511

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            P+ +S+LP  ++ LL+EGIA N  GSVF  EGG   EVSGSPTEKAIL +G+KLG++FDA
Sbjct  512  PESRSELPDTLVSLLIEGIAVNANGSVFTSEGGGDVEVSGSPTEKAILIWGIKLGMDFDA  571

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RS SSI+H FPFNSEKKRGGVA++L    ++I
Sbjct  572  VRSGSSIVHVFPFNSEKKRGGVAIRLPDSKVHI  604



>ref|XP_007014494.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Theobroma cacao]
 ref|XP_007014495.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Theobroma cacao]
 ref|XP_007014496.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Theobroma cacao]
 gb|EOY32113.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Theobroma cacao]
 gb|EOY32114.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Theobroma cacao]
 gb|EOY32115.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Theobroma cacao]
Length=1082

 Score =   291 bits (745),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 181/213 (85%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL++R+FTGHTKD      F AGKT  GDA+DGAIKI T+AVTIVVVAVPEGLPLAV
Sbjct  392  VLVVLLVRYFTGHTKDESGKKQFVAGKTSGGDAVDGAIKIITVAVTIVVVAVPEGLPLAV  451

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+GG++I+P
Sbjct  452  TLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGGRKIDP  511

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            PD  S+LP  +  LL+E +A N  GSVF P+GG   EVSGSPTEKAIL + +KLG+NFDA
Sbjct  512  PDSSSELPDMLTLLLVEAVAVNANGSVFTPDGGGDVEVSGSPTEKAILNWAIKLGMNFDA  571

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RS SSI+H FPFNSEKKRGGVA++L    ++I
Sbjct  572  VRSGSSIVHVFPFNSEKKRGGVAIRLPDSKVHI  604



>ref|XP_003533744.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Glycine max]
 ref|XP_006587001.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X2 [Glycine max]
 ref|XP_006587002.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X3 [Glycine max]
 ref|XP_006587003.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X4 [Glycine max]
Length=1085

 Score =   291 bits (744),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 181/215 (84%), Gaps = 7/215 (3%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL+VL+ R+F+GHTK+P     F AGKTKVGDAIDGAIKI T+AVTIVVVAVPEGLPLA
Sbjct  396  IVLIVLLARYFSGHTKNPDGSVQFTAGKTKVGDAIDGAIKIITVAVTIVVVAVPEGLPLA  455

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLT+NQMTVV+AY GGK+I+
Sbjct  456  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTMNQMTVVEAYAGGKKID  515

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP--EVSGSPTEKAILQFGVKLGLNF  522
            PP      P  +  LL+EG+AQNT GSV+ PEG     EVSGSPTEKAILQ+G+++G+NF
Sbjct  516  PPHKLESYPM-LRSLLIEGVAQNTNGSVYAPEGAANDVEVSGSPTEKAILQWGIQIGMNF  574

Query  523  DAIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             A RSESSIIH FPFNSEKKRGGVA++     I+I
Sbjct  575  TAARSESSIIHVFPFNSEKKRGGVAIQTADSNIHI  609



>gb|KCW80852.1| hypothetical protein EUGRSUZ_C02215 [Eucalyptus grandis]
Length=1062

 Score =   290 bits (743),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 178/206 (86%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT +    P FKAGKT V  A+DGAIKIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  402  RYFTGHTNNSDGSPQFKAGKTSVSRAVDGAIKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  461

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTL+QMTVV+AY+GG +++ P   SQL
Sbjct  462  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLSQMTVVEAYVGGVKVDSPYSSSQL  521

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P  ++ LL+EGIAQNT GSVF PEGG   EVSGSPTEKAIL++G++LG+NF+A R E+SI
Sbjct  522  PMTMVSLLIEGIAQNTNGSVFTPEGGKDVEVSGSPTEKAILRWGLELGMNFEATRLEASI  581

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IH FPFNSEKKRGGVA+KL +  +++
Sbjct  582  IHVFPFNSEKKRGGVALKLTNSEVHV  607



>ref|XP_010048572.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW80851.1| hypothetical protein EUGRSUZ_C02215 [Eucalyptus grandis]
Length=1079

 Score =   290 bits (743),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 178/206 (86%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT +    P FKAGKT V  A+DGAIKIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  402  RYFTGHTNNSDGSPQFKAGKTSVSRAVDGAIKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  461

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTL+QMTVV+AY+GG +++ P   SQL
Sbjct  462  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLSQMTVVEAYVGGVKVDSPYSSSQL  521

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P  ++ LL+EGIAQNT GSVF PEGG   EVSGSPTEKAIL++G++LG+NF+A R E+SI
Sbjct  522  PMTMVSLLIEGIAQNTNGSVFTPEGGKDVEVSGSPTEKAILRWGLELGMNFEATRLEASI  581

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IH FPFNSEKKRGGVA+KL +  +++
Sbjct  582  IHVFPFNSEKKRGGVALKLTNSEVHV  607



>gb|KJB21991.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
Length=1017

 Score =   290 bits (741),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 184/213 (86%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL++R+FTGHT+D +    F AGKT VG+AIDGAIKI T+AVTIVVVAVPEGLPLAV
Sbjct  392  VLVVLLVRYFTGHTEDSNGRQQFVAGKTSVGNAIDGAIKIVTVAVTIVVVAVPEGLPLAV  451

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GG++ +P
Sbjct  452  TLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGGRKNDP  511

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            P+ +S+LP  ++ LL+EGIA N  GSVF  EGG   EVSGSPTEKAIL +G+KLG++FDA
Sbjct  512  PESRSELPDTLVSLLIEGIAVNANGSVFTSEGGGDVEVSGSPTEKAILIWGIKLGMDFDA  571

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RS SSI+H FPFNSEKKRGGVA++L    ++I
Sbjct  572  VRSGSSIVHVFPFNSEKKRGGVAIRLPDSKVHI  604



>ref|XP_009343847.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Pyrus x bretschneideri]
 ref|XP_009343848.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Pyrus x bretschneideri]
Length=1070

 Score =   290 bits (742),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 181/214 (85%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL+VL++R+FTGHTKD    P F AGKTK GDA+DGAIKI TIAVTIVVVAVPEGLPLA
Sbjct  384  LVLIVLLVRYFTGHTKDTTGKPQFTAGKTKFGDALDGAIKIVTIAVTIVVVAVPEGLPLA  443

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQM VV+A+ GG++I 
Sbjct  444  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMAVVEAFTGGRKIV  503

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFD  525
              DDK  L   +  LL+EGIA NT GSV++PE G   EVSGSPTEKAILQ G+KLG+ FD
Sbjct  504  LSDDKPDLSPMLSSLLIEGIALNTNGSVYMPETGSDIEVSGSPTEKAILQLGIKLGMKFD  563

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            AIRSESS++H FPFNSEKKRGG AVKL +  ++I
Sbjct  564  AIRSESSLLHVFPFNSEKKRGGAAVKLPNSEVHI  597



>ref|XP_010696088.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Beta vulgaris subsp. vulgaris]
Length=1089

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 185/213 (87%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL +L+IRFFTGHTK+P+    F +GKT + +AIDG I+IFTIAVTIVVVAVPEGLPLAV
Sbjct  402  VLAILLIRFFTGHTKEPNGEVQFTSGKTSISEAIDGVIEIFTIAVTIVVVAVPEGLPLAV  461

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY G KR+NP
Sbjct  462  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGRKRLNP  521

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            P+D +Q+ ++   L++EG+A NTTGSVFVP +GG  EVSGSPTEKAIL +GV+LG+ F+A
Sbjct  522  PNDAAQMHKEQSTLVIEGVAVNTTGSVFVPKDGGDAEVSGSPTEKAILSWGVELGMKFEA  581

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RSE+ I+H  PFNSEKKRGGVA++L +  ++I
Sbjct  582  VRSEAIILHVCPFNSEKKRGGVALQLSNSDVHI  614



>gb|KJB21986.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
 gb|KJB21992.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
Length=1089

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 184/213 (86%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL++R+FTGHT+D +    F AGKT VG+AIDGAIKI T+AVTIVVVAVPEGLPLAV
Sbjct  392  VLVVLLVRYFTGHTEDSNGRQQFVAGKTSVGNAIDGAIKIVTVAVTIVVVAVPEGLPLAV  451

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GG++ +P
Sbjct  452  TLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGGRKNDP  511

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            P+ +S+LP  ++ LL+EGIA N  GSVF  EGG   EVSGSPTEKAIL +G+KLG++FDA
Sbjct  512  PESRSELPDTLVSLLIEGIAVNANGSVFTSEGGGDVEVSGSPTEKAILIWGIKLGMDFDA  571

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RS SSI+H FPFNSEKKRGGVA++L    ++I
Sbjct  572  VRSGSSIVHVFPFNSEKKRGGVAIRLPDSKVHI  604



>gb|KJB21985.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
 gb|KJB21989.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
Length=1092

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 184/213 (86%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL++R+FTGHT+D +    F AGKT VG+AIDGAIKI T+AVTIVVVAVPEGLPLAV
Sbjct  392  VLVVLLVRYFTGHTEDSNGRQQFVAGKTSVGNAIDGAIKIVTVAVTIVVVAVPEGLPLAV  451

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GG++ +P
Sbjct  452  TLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGGRKNDP  511

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            P+ +S+LP  ++ LL+EGIA N  GSVF  EGG   EVSGSPTEKAIL +G+KLG++FDA
Sbjct  512  PESRSELPDTLVSLLIEGIAVNANGSVFTSEGGGDVEVSGSPTEKAILIWGIKLGMDFDA  571

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RS SSI+H FPFNSEKKRGGVA++L    ++I
Sbjct  572  VRSGSSIVHVFPFNSEKKRGGVAIRLPDSKVHI  604



>gb|KJB21990.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
Length=1087

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 184/213 (86%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL++R+FTGHT+D +    F AGKT VG+AIDGAIKI T+AVTIVVVAVPEGLPLAV
Sbjct  390  VLVVLLVRYFTGHTEDSNGRQQFVAGKTSVGNAIDGAIKIVTVAVTIVVVAVPEGLPLAV  449

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GG++ +P
Sbjct  450  TLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGGRKNDP  509

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            P+ +S+LP  ++ LL+EGIA N  GSVF  EGG   EVSGSPTEKAIL +G+KLG++FDA
Sbjct  510  PESRSELPDTLVSLLIEGIAVNANGSVFTSEGGGDVEVSGSPTEKAILIWGIKLGMDFDA  569

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RS SSI+H FPFNSEKKRGGVA++L    ++I
Sbjct  570  VRSGSSIVHVFPFNSEKKRGGVAIRLPDSKVHI  602



>ref|XP_006372180.1| hypothetical protein POPTR_0018s13650g [Populus trichocarpa]
 gb|ERP49977.1| hypothetical protein POPTR_0018s13650g [Populus trichocarpa]
Length=972

 Score =   288 bits (738),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 180/206 (87%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+    P F AGKTKV  A+DGA+KI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  413  RYFTGHTKNFDGSPEFVAGKTKVSKAVDGAVKILTVAVTIVVVAVPEGLPLAVTLTLAYS  472

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+A+ GGK+++ P+ KSQL
Sbjct  473  MRKMMRDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAFSGGKKMDLPESKSQL  532

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P  +  LL+EGIAQNTTGSVFVPEGG   E+SGSPTEKAI+ + +KLG+NFDA+RSES++
Sbjct  533  PPILSSLLIEGIAQNTTGSVFVPEGGGDLEISGSPTEKAIMGWAIKLGMNFDAVRSESNV  592

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IH FPFNSEKK+GGVA++L +  ++I
Sbjct  593  IHVFPFNSEKKKGGVALQLPNSQVHI  618



>ref|XP_010048570.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010048571.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Eucalyptus grandis]
Length=1072

 Score =   290 bits (741),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 178/206 (86%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT +    P FKAGKT V  A+DGAIKIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  395  RYFTGHTNNSDGSPQFKAGKTSVSRAVDGAIKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  454

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTL+QMTVV+AY+GG +++ P   SQL
Sbjct  455  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLSQMTVVEAYVGGVKVDSPYSSSQL  514

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P  ++ LL+EGIAQNT GSVF PEGG   EVSGSPTEKAIL++G++LG+NF+A R E+SI
Sbjct  515  PMTMVSLLIEGIAQNTNGSVFTPEGGKDVEVSGSPTEKAILRWGLELGMNFEATRLEASI  574

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IH FPFNSEKKRGGVA+KL +  +++
Sbjct  575  IHVFPFNSEKKRGGVALKLTNSEVHV  600



>ref|XP_006585663.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X1 [Glycine max]
 ref|XP_006585664.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X2 [Glycine max]
Length=1092

 Score =   290 bits (741),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 176/206 (85%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+F+GHTKD      F AGKT + +A+DG IKIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  410  RYFSGHTKDLDGNVEFVAGKTSLSNAVDGVIKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  469

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G  ++NPPDD S+L
Sbjct  470  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGSTKVNPPDDSSKL  529

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K + L+ EGIAQNTTG+VFVP +GG  EVSGSPTEKAIL + VKLG+NFD IRS S++
Sbjct  530  HPKALSLINEGIAQNTTGNVFVPKDGGETEVSGSPTEKAILSWAVKLGMNFDVIRSNSTV  589

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVA+KL    I+I
Sbjct  590  LHVFPFNSEKKRGGVALKLGDSGIHI  615



>gb|KJB21993.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
Length=1083

 Score =   289 bits (740),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 184/213 (86%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL++R+FTGHT+D +    F AGKT VG+AIDGAIKI T+AVTIVVVAVPEGLPLAV
Sbjct  392  VLVVLLVRYFTGHTEDSNGRQQFVAGKTSVGNAIDGAIKIVTVAVTIVVVAVPEGLPLAV  451

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GG++ +P
Sbjct  452  TLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGGRKNDP  511

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            P+ +S+LP  ++ LL+EGIA N  GSVF  EGG   EVSGSPTEKAIL +G+KLG++FDA
Sbjct  512  PESRSELPDTLVSLLIEGIAVNANGSVFTSEGGGDVEVSGSPTEKAILIWGIKLGMDFDA  571

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RS SSI+H FPFNSEKKRGGVA++L    ++I
Sbjct  572  VRSGSSIVHVFPFNSEKKRGGVAIRLPDSKVHI  604



>ref|XP_006600472.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X6 [Glycine max]
Length=887

 Score =   286 bits (732),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 177/207 (86%), Gaps = 6/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+F+GHT++P     F AGKTKVGDAIDG IKIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  211  RYFSGHTRNPDGSVQFIAGKTKVGDAIDGVIKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  270

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYI-GGKRINPPDDKSQ  369
            M+KMMADKALVRRLSACETMGSATTICSDKTGTLT+NQMTVV+A+I GGK+I  P D SQ
Sbjct  271  MKKMMADKALVRRLSACETMGSATTICSDKTGTLTMNQMTVVEAWIGGGKKIADPHDVSQ  330

Query  370  LPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESS  546
              + +  LL+EG+AQNT GSV++PEGG   E+SGSPTEKAIL++GVKLG+NFD  RS+SS
Sbjct  331  FSRMLCSLLIEGVAQNTNGSVYIPEGGNDVEISGSPTEKAILEWGVKLGMNFDTARSKSS  390

Query  547  IIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IIH FPFNS+KKRGGVA  +    ++I
Sbjct  391  IIHVFPFNSDKKRGGVATWVSDSEVHI  417



>ref|XP_006598389.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Glycine max]
Length=1057

 Score =   288 bits (737),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 181/214 (85%), Gaps = 6/214 (3%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL+VL+ R+F+GHTK+P     F AGKTKVGDAIDGAIKI T+AVTIVVVAVPEGLPLA
Sbjct  393  IVLIVLLARYFSGHTKNPDGSVQFIAGKTKVGDAIDGAIKIITVAVTIVVVAVPEGLPLA  452

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLT+NQMTVV+AY GGK+I+
Sbjct  453  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTMNQMTVVEAYAGGKKID  512

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFD  525
            PP      P  +  LL+EG+AQNT GSV+ PEG    EVSGSPTEKAILQ+G+++G+NF 
Sbjct  513  PPHKLESYPM-LRSLLIEGVAQNTNGSVYAPEGANDVEVSGSPTEKAILQWGIQIGMNFM  571

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            A RSESSIIH FPFNSEKKRGGVA++     I+I
Sbjct  572  AARSESSIIHVFPFNSEKKRGGVAIQTADCNIHI  605



>ref|XP_006597086.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Glycine max]
Length=1091

 Score =   288 bits (738),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 182/213 (85%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+ R+F+GHTKD      F AG+T + +A+DG IKIFTIAVTIVVVAVPEGLPLAV
Sbjct  409  VLAVLLGRYFSGHTKDLDGRVQFVAGETSISEAVDGVIKIFTIAVTIVVVAVPEGLPLAV  468

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+A +G K++NP
Sbjct  469  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEACVGRKKLNP  528

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PDD ++L  +V+ L+ EGIAQNTTG+VFVP +GG  EVSGSPTEKAIL + VKLG+NFD 
Sbjct  529  PDDLTKLHPEVLSLINEGIAQNTTGNVFVPKDGGEVEVSGSPTEKAILSWAVKLGMNFDL  588

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IRS S+I+H FPFNSEKKRGG+A+KL    ++I
Sbjct  589  IRSNSTILHVFPFNSEKKRGGLALKLPDSAVHI  621



>ref|XP_002325251.2| Calcium-transporting ATPase 8 family protein [Populus trichocarpa]
 gb|EEF03816.2| Calcium-transporting ATPase 8 family protein [Populus trichocarpa]
Length=1107

 Score =   288 bits (738),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 180/206 (87%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+    P F AGKTKV  A+DGA+KI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  413  RYFTGHTKNFDGSPEFVAGKTKVSKAVDGAVKILTVAVTIVVVAVPEGLPLAVTLTLAYS  472

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+A+ GGK+++ P+ KSQL
Sbjct  473  MRKMMRDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAFSGGKKMDLPESKSQL  532

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P  +  LL+EGIAQNTTGSVFVPEGG   E+SGSPTEKAI+ + +KLG+NFDA+RSES++
Sbjct  533  PPILSSLLIEGIAQNTTGSVFVPEGGGDLEISGSPTEKAIMGWAIKLGMNFDAVRSESNV  592

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IH FPFNSEKK+GGVA++L +  ++I
Sbjct  593  IHVFPFNSEKKKGGVALQLPNSQVHI  618



>ref|XP_008227946.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X2 [Prunus mume]
Length=1098

 Score =   288 bits (736),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 179/213 (84%), Gaps = 4/213 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL VL  R+FTG+++D      F AG+T  G AIDGA+K+FTIAVTIVVVAVPEGLPLA
Sbjct  412  LVLAVLWGRYFTGNSRDADGTVQFIAGQTSTGKAIDGAVKVFTIAVTIVVVAVPEGLPLA  471

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+IN
Sbjct  472  VTLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGKKKIN  531

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
             PDD SQL  +V  LL EGIAQNTTG+VF P+GG  E+SGSPTEKAIL + VKLG+ FD 
Sbjct  532  LPDDSSQLHPQVSTLLSEGIAQNTTGNVFEPKGGEVEISGSPTEKAILSWAVKLGMKFDF  591

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IRSES+++H FPFNSEKKRGGVA+K     ++I
Sbjct  592  IRSESTVLHVFPFNSEKKRGGVALKQTDSKVHI  624



>ref|XP_010046915.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Eucalyptus grandis]
Length=1086

 Score =   288 bits (736),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 176/209 (84%), Gaps = 12/209 (6%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            RFFTGHTK+P     FKAGKT V DA+DGAIK+ T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  396  RFFTGHTKNPDGTVQFKAGKTSVSDAVDGAIKMITVAVTIVVVAVPEGLPLAVTLTLAYS  455

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+A+   ++++PPD  SQ 
Sbjct  456  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAFACERKVDPPDSNSQP  515

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-------GGVPEVSGSPTEKAILQFGVKLGLNFDAI  531
               +I LL+EGIAQN+ GSV+VPE        G PEVSGSPTEKAILQ+G+KLG++F+AI
Sbjct  516  STSLISLLIEGIAQNSNGSVYVPETGGDVEVSGSPEVSGSPTEKAILQWGIKLGMDFEAI  575

Query  532  RSESSIIHAFPFNSEKKRGGVAVKL-DSE  615
            RS SSII  FPFNSEKKRGG AVKL DSE
Sbjct  576  RSRSSIIRVFPFNSEKKRGGAAVKLPDSE  604



>ref|XP_007023813.1| Autoinhibited Ca(2+)-ATPase 9 isoform 4 [Theobroma cacao]
 gb|EOY26435.1| Autoinhibited Ca(2+)-ATPase 9 isoform 4 [Theobroma cacao]
Length=1042

 Score =   287 bits (734),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 180/213 (85%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+ R+FTGHT+DP+    F  G+T V DA +  +KIFTIAVTI+VVAVPEGLPLAV
Sbjct  397  VLAVLLARYFTGHTEDPNGNREFIKGQTTVEDAFNDVVKIFTIAVTIIVVAVPEGLPLAV  456

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+A++G K+INP
Sbjct  457  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAFVGKKKINP  516

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            P D SQL   V+ LL EG+AQN+TG+VFVP +GG  E+SGSPTEKAIL + VKLG+ +D 
Sbjct  517  PADSSQLHPSVVSLLSEGVAQNSTGNVFVPKDGGDVEISGSPTEKAILSWAVKLGMKYDV  576

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IRSES+++H FPFNSEKKRGGVA++L    ++I
Sbjct  577  IRSESTVLHVFPFNSEKKRGGVALQLSDSQVHI  609



>gb|KJB21983.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
 gb|KJB21988.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
Length=1089

 Score =   287 bits (735),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 183/213 (86%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL++R+FTGHT+D +    F AGKT VG+AIDGAIKI T+AVTIVVVAVPEGLPLAV
Sbjct  392  VLVVLLVRYFTGHTEDSNGRQQFVAGKTSVGNAIDGAIKIVTVAVTIVVVAVPEGLPLAV  451

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GG++ +P
Sbjct  452  TLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGGRKNDP  511

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEG-GVPEVSGSPTEKAILQFGVKLGLNFDA  528
            P+ +S+LP  ++ LL+EGIA N  GSVF  E  G  EVSGSPTEKAIL +G+KLG++FDA
Sbjct  512  PESRSELPDTLVSLLIEGIAVNANGSVFTSEACGDVEVSGSPTEKAILIWGIKLGMDFDA  571

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RS SSI+H FPFNSEKKRGGVA++L    ++I
Sbjct  572  VRSGSSIVHVFPFNSEKKRGGVAIRLPDSKVHI  604



>ref|XP_011017707.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X3 [Populus euphratica]
Length=1079

 Score =   287 bits (735),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 179/206 (87%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+    P F AGKTKV  A+DGA+KI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  400  RYFTGHTKNFDGSPEFVAGKTKVSTAVDGAVKILTVAVTIVVVAVPEGLPLAVTLTLAYS  459

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+A+ GGK+++ P+ KSQL
Sbjct  460  MRKMMRDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAFSGGKKMDLPESKSQL  519

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P  +  LL+EGIAQNTTGSVFVPEGG   E+SGSPTEKAI+ + +KLG+NFDA+RSES++
Sbjct  520  PPILSSLLIEGIAQNTTGSVFVPEGGGDLEISGSPTEKAIMGWAIKLGMNFDAVRSESNV  579

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IH FPFNSEKK+GGVA++L    ++I
Sbjct  580  IHVFPFNSEKKKGGVALQLPDSQVHI  605



>gb|KJB21984.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
Length=1092

 Score =   287 bits (735),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 183/213 (86%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL++R+FTGHT+D +    F AGKT VG+AIDGAIKI T+AVTIVVVAVPEGLPLAV
Sbjct  392  VLVVLLVRYFTGHTEDSNGRQQFVAGKTSVGNAIDGAIKIVTVAVTIVVVAVPEGLPLAV  451

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GG++ +P
Sbjct  452  TLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGGRKNDP  511

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEG-GVPEVSGSPTEKAILQFGVKLGLNFDA  528
            P+ +S+LP  ++ LL+EGIA N  GSVF  E  G  EVSGSPTEKAIL +G+KLG++FDA
Sbjct  512  PESRSELPDTLVSLLIEGIAVNANGSVFTSEACGDVEVSGSPTEKAILIWGIKLGMDFDA  571

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RS SSI+H FPFNSEKKRGGVA++L    ++I
Sbjct  572  VRSGSSIVHVFPFNSEKKRGGVAIRLPDSKVHI  604



>gb|KHN22652.1| Calcium-transporting ATPase 8, plasma membrane-type [Glycine 
soja]
Length=1072

 Score =   287 bits (735),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 179/207 (86%), Gaps = 6/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+F+GHT++P     F AGKTKVGDAIDG IKIFT+AVTIVV+AVPEGLPLAVTLTLAYS
Sbjct  398  RYFSGHTRNPDGSVQFIAGKTKVGDAIDGVIKIFTVAVTIVVIAVPEGLPLAVTLTLAYS  457

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYI-GGKRINPPDDKSQ  369
            M+KMMADKALVRRLSACETMGSATTICSDKTGTLT+NQMTVV+A+I GGK+I PP ++S+
Sbjct  458  MKKMMADKALVRRLSACETMGSATTICSDKTGTLTMNQMTVVEAWIGGGKKIVPPYEESK  517

Query  370  LPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESS  546
                +  LL+EG+AQNT GSV++PEGG   EVSGSPTEKAIL++G+KLG+NFD  RS+SS
Sbjct  518  FSHMLCSLLIEGVAQNTNGSVYIPEGGNDVEVSGSPTEKAILEWGIKLGMNFDTARSDSS  577

Query  547  IIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IIH FPFNS+KKRGGVA ++    I+I
Sbjct  578  IIHVFPFNSDKKRGGVATRVSDSEIHI  604



>ref|XP_011017705.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X2 [Populus euphratica]
Length=1095

 Score =   287 bits (735),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 179/206 (87%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+    P F AGKTKV  A+DGA+KI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  400  RYFTGHTKNFDGSPEFVAGKTKVSTAVDGAVKILTVAVTIVVVAVPEGLPLAVTLTLAYS  459

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+A+ GGK+++ P+ KSQL
Sbjct  460  MRKMMRDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAFSGGKKMDLPESKSQL  519

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P  +  LL+EGIAQNTTGSVFVPEGG   E+SGSPTEKAI+ + +KLG+NFDA+RSES++
Sbjct  520  PPILSSLLIEGIAQNTTGSVFVPEGGGDLEISGSPTEKAIMGWAIKLGMNFDAVRSESNV  579

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IH FPFNSEKK+GGVA++L    ++I
Sbjct  580  IHVFPFNSEKKKGGVALQLPDSQVHI  605



>ref|XP_011017704.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Populus euphratica]
Length=1098

 Score =   287 bits (735),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 179/206 (87%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+    P F AGKTKV  A+DGA+KI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  400  RYFTGHTKNFDGSPEFVAGKTKVSTAVDGAVKILTVAVTIVVVAVPEGLPLAVTLTLAYS  459

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+A+ GGK+++ P+ KSQL
Sbjct  460  MRKMMRDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAFSGGKKMDLPESKSQL  519

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P  +  LL+EGIAQNTTGSVFVPEGG   E+SGSPTEKAI+ + +KLG+NFDA+RSES++
Sbjct  520  PPILSSLLIEGIAQNTTGSVFVPEGGGDLEISGSPTEKAIMGWAIKLGMNFDAVRSESNV  579

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IH FPFNSEKK+GGVA++L    ++I
Sbjct  580  IHVFPFNSEKKKGGVALQLPDSQVHI  605



>ref|XP_008227947.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X3 [Prunus mume]
Length=860

 Score =   284 bits (726),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 179/214 (84%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL VL  R+FTG+++D      F AG+T  G AIDGA+K+FTIAVTIVVVAVPEGLPLA
Sbjct  412  LVLAVLWGRYFTGNSRDADGTVQFIAGQTSTGKAIDGAVKVFTIAVTIVVVAVPEGLPLA  471

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+IN
Sbjct  472  VTLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGKKKIN  531

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFD  525
             PDD SQL  +V  LL EGIAQNTTG+VF P +GG  E+SGSPTEKAIL + VKLG+ FD
Sbjct  532  LPDDSSQLHPQVSTLLSEGIAQNTTGNVFEPKQGGEVEISGSPTEKAILSWAVKLGMKFD  591

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             IRSES+++H FPFNSEKKRGGVA+K     ++I
Sbjct  592  FIRSESTVLHVFPFNSEKKRGGVALKQTDSKVHI  625



>ref|XP_007023810.1| Autoinhibited Ca(2+)-ATPase 9 isoform 1 [Theobroma cacao]
 ref|XP_007023811.1| Autoinhibited Ca(2+)-ATPase 9 isoform 1 [Theobroma cacao]
 gb|EOY26432.1| Autoinhibited Ca(2+)-ATPase 9 isoform 1 [Theobroma cacao]
 gb|EOY26433.1| Autoinhibited Ca(2+)-ATPase 9 isoform 1 [Theobroma cacao]
Length=1084

 Score =   286 bits (733),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 180/213 (85%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+ R+FTGHT+DP+    F  G+T V DA +  +KIFTIAVTI+VVAVPEGLPLAV
Sbjct  397  VLAVLLARYFTGHTEDPNGNREFIKGQTTVEDAFNDVVKIFTIAVTIIVVAVPEGLPLAV  456

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+A++G K+INP
Sbjct  457  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAFVGKKKINP  516

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            P D SQL   V+ LL EG+AQN+TG+VFVP +GG  E+SGSPTEKAIL + VKLG+ +D 
Sbjct  517  PADSSQLHPSVVSLLSEGVAQNSTGNVFVPKDGGDVEISGSPTEKAILSWAVKLGMKYDV  576

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IRSES+++H FPFNSEKKRGGVA++L    ++I
Sbjct  577  IRSESTVLHVFPFNSEKKRGGVALQLSDSQVHI  609



>ref|XP_004486584.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Cicer arietinum]
Length=1091

 Score =   286 bits (733),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 177/206 (86%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+F+G+TKD      F AG+T + DA+DG IKIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  414  RYFSGNTKDLDGKVQFVAGETSISDAVDGVIKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  473

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K++NPPDD S+L
Sbjct  474  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGKKKLNPPDDSSKL  533

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              +V+ L+ EGIAQNTTG++FVP +GG  EVSGSPTEKAIL + +KLG+NF+ IRS S I
Sbjct  534  HPEVLSLINEGIAQNTTGNIFVPKDGGEAEVSGSPTEKAILSWAMKLGMNFELIRSNSKI  593

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVAVKL    ++I
Sbjct  594  LHVFPFNSEKKRGGVAVKLVDSGVHI  619



>ref|XP_007023812.1| Autoinhibited Ca(2+)-ATPase 9 isoform 3 [Theobroma cacao]
 gb|EOY26434.1| Autoinhibited Ca(2+)-ATPase 9 isoform 3 [Theobroma cacao]
Length=1085

 Score =   286 bits (733),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 180/213 (85%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+ R+FTGHT+DP+    F  G+T V DA +  +KIFTIAVTI+VVAVPEGLPLAV
Sbjct  397  VLAVLLARYFTGHTEDPNGNREFIKGQTTVEDAFNDVVKIFTIAVTIIVVAVPEGLPLAV  456

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+A++G K+INP
Sbjct  457  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAFVGKKKINP  516

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            P D SQL   V+ LL EG+AQN+TG+VFVP +GG  E+SGSPTEKAIL + VKLG+ +D 
Sbjct  517  PADSSQLHPSVVSLLSEGVAQNSTGNVFVPKDGGDVEISGSPTEKAILSWAVKLGMKYDV  576

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IRSES+++H FPFNSEKKRGGVA++L    ++I
Sbjct  577  IRSESTVLHVFPFNSEKKRGGVALQLSDSQVHI  609



>ref|XP_008801513.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
isoform X2 [Phoenix dactylifera]
Length=865

 Score =   284 bits (726),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 181/213 (85%), Gaps = 6/213 (3%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL++R+FTGHT +P     F  G+T V DA++GAIKI T+AVTIVVVAVPEGLPLAV
Sbjct  388  VLVVLLVRYFTGHTNNPDGTVQFVRGQTGVRDALNGAIKILTVAVTIVVVAVPEGLPLAV  447

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+GG +++ 
Sbjct  448  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGGMKLDT  507

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PDD  +L   + PLL+EGIAQNTTG VF PE GG  EV+GSPTEKAIL +GVKLG+ F+ 
Sbjct  508  PDDVKEL-YNISPLLIEGIAQNTTGDVFEPEDGGAIEVNGSPTEKAILSWGVKLGMKFND  566

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RS+SSI+H FPFNSEKKRGGVA++L    +++
Sbjct  567  VRSKSSILHVFPFNSEKKRGGVAIQLPDSRVHV  599



>gb|KJB56392.1| hypothetical protein B456_009G118300 [Gossypium raimondii]
Length=628

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 172/206 (83%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT+DP     F  G+T   DA +  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  402  RYFTGHTEDPDGTKQFIKGRTNFDDAFNDVVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  461

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+A++G K+INPP D SQL
Sbjct  462  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAFVGKKKINPPSDSSQL  521

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P  V+ LL EG+AQN+TG+VFVP +GG  E+SGSPTEKAIL + VKLG+ FD IRS+S I
Sbjct  522  PASVVSLLNEGVAQNSTGNVFVPKDGGNIEISGSPTEKAILSWAVKLGMKFDIIRSDSKI  581

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVA++     +Y+
Sbjct  582  LHVFPFNSEKKRGGVALQGACPLLYL  607



>ref|XP_006427751.1| hypothetical protein CICLE_v10024770mg [Citrus clementina]
 gb|ESR40991.1| hypothetical protein CICLE_v10024770mg [Citrus clementina]
Length=1019

 Score =   285 bits (730),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 179/211 (85%), Gaps = 6/211 (3%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL VL++RFFTGHT        F  G+T V DA+DG IKI TIAVTIVVVAVPEGLPLA
Sbjct  389  LVLAVLLVRFFTGHTTKEDGSSAFVKGRTSVSDAVDGVIKIVTIAVTIVVVAVPEGLPLA  448

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+A+IG K+IN
Sbjct  449  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAFIGRKKIN  508

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFD  525
            PPDD SQ+   VI LL EGIAQNTTG+VFVP +G   EVSGSPTEKAIL + VKLG+ FD
Sbjct  509  PPDDSSQMHSIVISLLSEGIAQNTTGNVFVPKDGEAVEVSGSPTEKAILSWAVKLGMKFD  568

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVK-LDSE  615
             +RSE++++H FPFNSEKKRGGVAVK ++SE
Sbjct  569  RVRSETTVLHVFPFNSEKKRGGVAVKRINSE  599



>ref|XP_009349647.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X1 [Pyrus x bretschneideri]
Length=1099

 Score =   286 bits (732),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 177/213 (83%), Gaps = 4/213 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL VL  R+FTG+T+D      F AG+T++G A DGA+KIFTIAVTIVVVAVPEGLPLA
Sbjct  411  LVLAVLWGRYFTGNTRDLDGKVQFIAGQTRIGKAFDGAVKIFTIAVTIVVVAVPEGLPLA  470

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+IN
Sbjct  471  VTLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGRKKIN  530

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPDD SQL   V  LL EG+AQNTTG+VF P GG  E+SGSPTEKAIL +  KLG+ F  
Sbjct  531  PPDDSSQLHPLVSTLLSEGVAQNTTGNVFEPTGGEVEISGSPTEKAILSWAFKLGMKFGV  590

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IRSES+++H FPFNSEKKRGGVAVK     ++I
Sbjct  591  IRSESTVLHVFPFNSEKKRGGVAVKQADSKVHI  623



>ref|XP_004167733.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like, 
partial [Cucumis sativus]
Length=888

 Score =   284 bits (726),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 183/209 (88%), Gaps = 5/209 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL+ R+FTGH+K+P     F AG+TKVG A+DGAIKI TIAVTIVVVAVPEGLPLAV
Sbjct  204  VLVVLLARYFTGHSKNPDGSRQFIAGQTKVGRAVDGAIKIVTIAVTIVVVAVPEGLPLAV  263

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLT+NQMT+V+AY GGK+I+P
Sbjct  264  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTVNQMTIVEAYAGGKKIDP  323

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            P+ KS+    +  LL+EGIA N+ GSV+VPE GG  EV+GSPTEKAIL +G+KLG+NF+A
Sbjct  324  PEKKSEFSPTLHSLLVEGIALNSNGSVYVPESGGEVEVTGSPTEKAILNWGIKLGMNFEA  383

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSE  615
            +R+ES+I+H FPF+S+KKRGGVA + D++
Sbjct  384  LRTESTILHVFPFSSDKKRGGVACQQDNQ  412



>ref|XP_006595201.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X1 [Glycine max]
Length=1103

 Score =   286 bits (732),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 181/213 (85%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+ R+F+GH+KD      F AG+T +  A+DG IKIFTIAVTIVVVAVPEGLPLAV
Sbjct  414  VLAVLLGRYFSGHSKDLDGKVQFVAGETSISKAVDGVIKIFTIAVTIVVVAVPEGLPLAV  473

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+A++G K++NP
Sbjct  474  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAFVGRKKLNP  533

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PDD ++L  +V  L+ EGIAQNTTG++FVP +GG  EVSGSPTEKAIL + VKLG+NFD 
Sbjct  534  PDDLTKLHPEVSSLINEGIAQNTTGNIFVPKDGGEAEVSGSPTEKAILSWAVKLGMNFDL  593

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IRS S+I+H FPFNSEKKRGG+A+KL    ++I
Sbjct  594  IRSNSTILHVFPFNSEKKRGGLALKLPDSAVHI  626



>gb|KJB56393.1| hypothetical protein B456_009G118300 [Gossypium raimondii]
Length=611

 Score =   278 bits (710),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 169/198 (85%), Gaps = 5/198 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT+DP     F  G+T   DA +  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  402  RYFTGHTEDPDGTKQFIKGRTNFDDAFNDVVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  461

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+A++G K+INPP D SQL
Sbjct  462  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAFVGKKKINPPSDSSQL  521

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P  V+ LL EG+AQN+TG+VFVP +GG  E+SGSPTEKAIL + VKLG+ FD IRS+S I
Sbjct  522  PASVVSLLNEGVAQNSTGNVFVPKDGGNIEISGSPTEKAILSWAVKLGMKFDIIRSDSKI  581

Query  550  IHAFPFNSEKKRGGVAVK  603
            +H FPFNSEKKRGGVA++
Sbjct  582  LHVFPFNSEKKRGGVALQ  599



>ref|XP_003549287.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Glycine max]
 ref|XP_006600469.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X3 [Glycine max]
 ref|XP_006600470.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X4 [Glycine max]
 ref|XP_006600471.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X5 [Glycine max]
Length=1074

 Score =   286 bits (731),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 177/207 (86%), Gaps = 6/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+F+GHT++P     F AGKTKVGDAIDG IKIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  398  RYFSGHTRNPDGSVQFIAGKTKVGDAIDGVIKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  457

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYI-GGKRINPPDDKSQ  369
            M+KMMADKALVRRLSACETMGSATTICSDKTGTLT+NQMTVV+A+I GGK+I  P D SQ
Sbjct  458  MKKMMADKALVRRLSACETMGSATTICSDKTGTLTMNQMTVVEAWIGGGKKIADPHDVSQ  517

Query  370  LPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESS  546
              + +  LL+EG+AQNT GSV++PEGG   E+SGSPTEKAIL++GVKLG+NFD  RS+SS
Sbjct  518  FSRMLCSLLIEGVAQNTNGSVYIPEGGNDVEISGSPTEKAILEWGVKLGMNFDTARSKSS  577

Query  547  IIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IIH FPFNS+KKRGGVA  +    ++I
Sbjct  578  IIHVFPFNSDKKRGGVATWVSDSEVHI  604



>ref|XP_006600468.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X2 [Glycine max]
Length=1105

 Score =   286 bits (731),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 177/207 (86%), Gaps = 6/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+F+GHT++P     F AGKTKVGDAIDG IKIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  429  RYFSGHTRNPDGSVQFIAGKTKVGDAIDGVIKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  488

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYI-GGKRINPPDDKSQ  369
            M+KMMADKALVRRLSACETMGSATTICSDKTGTLT+NQMTVV+A+I GGK+I  P D SQ
Sbjct  489  MKKMMADKALVRRLSACETMGSATTICSDKTGTLTMNQMTVVEAWIGGGKKIADPHDVSQ  548

Query  370  LPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESS  546
              + +  LL+EG+AQNT GSV++PEGG   E+SGSPTEKAIL++GVKLG+NFD  RS+SS
Sbjct  549  FSRMLCSLLIEGVAQNTNGSVYIPEGGNDVEISGSPTEKAILEWGVKLGMNFDTARSKSS  608

Query  547  IIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IIH FPFNS+KKRGGVA  +    ++I
Sbjct  609  IIHVFPFNSDKKRGGVATWVSDSEVHI  635



>ref|XP_007142130.1| hypothetical protein PHAVU_008G255200g [Phaseolus vulgaris]
 ref|XP_007142131.1| hypothetical protein PHAVU_008G255200g [Phaseolus vulgaris]
 gb|ESW14124.1| hypothetical protein PHAVU_008G255200g [Phaseolus vulgaris]
 gb|ESW14125.1| hypothetical protein PHAVU_008G255200g [Phaseolus vulgaris]
Length=1101

 Score =   286 bits (731),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 175/206 (85%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+F+GHTKD      F AGKT + +A+D  IKIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  420  RYFSGHTKDVDGQVEFVAGKTSLSNAVDAVIKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  479

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G  ++NPPD+ S+L
Sbjct  480  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGSTKVNPPDNSSKL  539

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              KV+ L+ EGIAQNTTG+VFVP +GG  EVSGSPTEKAIL + +KLG+NFD IRS S +
Sbjct  540  HPKVLSLINEGIAQNTTGNVFVPKDGGEKEVSGSPTEKAILSWALKLGMNFDVIRSNSKV  599

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVA+KL    ++I
Sbjct  600  LHVFPFNSEKKRGGVALKLGDSEVHI  625



>ref|XP_008450934.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
[Cucumis melo]
 ref|XP_008450942.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
[Cucumis melo]
Length=1076

 Score =   285 bits (730),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 184/209 (88%), Gaps = 5/209 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL+ R+FTGH+K+P     F AG+TKVG A+DGAIKI TIAVTIVVVAVPEGLPLAV
Sbjct  392  VLVVLLARYFTGHSKNPDGSRQFIAGQTKVGRAVDGAIKIVTIAVTIVVVAVPEGLPLAV  451

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLT+NQMT+V+AY GGK+I+P
Sbjct  452  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTVNQMTIVEAYAGGKKIDP  511

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            P+ KS+L   +  LL+EGIA N+ GSV+VPE GG  EV+GSPTEKAIL +G+KLG+NF+A
Sbjct  512  PEKKSELSPMIHSLLVEGIALNSNGSVYVPESGGEVEVTGSPTEKAILNWGIKLGMNFEA  571

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSE  615
            +R+E +I+H FPF+S+KKRGGVAV+ D++
Sbjct  572  LRAERTILHVFPFSSDKKRGGVAVQQDNQ  600



>gb|KHN17641.1| Calcium-transporting ATPase 10, plasma membrane-type [Glycine 
soja]
Length=1070

 Score =   285 bits (729),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 177/207 (86%), Gaps = 6/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+F+GHT++P     F AGKTKVGDAIDG IKIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  421  RYFSGHTRNPDGSVQFIAGKTKVGDAIDGVIKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  480

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYI-GGKRINPPDDKSQ  369
            M+KMMADKALVRRLSACETMGSATTICSDKTGTLT+NQMTVV+A+I GGK+I  P D SQ
Sbjct  481  MKKMMADKALVRRLSACETMGSATTICSDKTGTLTMNQMTVVEAWIGGGKKIADPHDVSQ  540

Query  370  LPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESS  546
              + +  LL+EG+AQNT GSV++PEGG   E+SGSPTEKAIL++GVKLG+NFD  RS+SS
Sbjct  541  FSRMLCSLLIEGVAQNTNGSVYIPEGGNDVEISGSPTEKAILEWGVKLGMNFDTARSKSS  600

Query  547  IIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IIH FPFNS+KKRGGVA  +    ++I
Sbjct  601  IIHVFPFNSDKKRGGVATWVSDSEVHI  627



>gb|KDO47130.1| hypothetical protein CISIN_1g04209132mg, partial [Citrus sinensis]
Length=434

 Score =   272 bits (695),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 166/209 (79%), Gaps = 13/209 (6%)
 Frame = +1

Query  28   FFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivv-------vavPEGLPLAVT  174
            FFTGHT        F  G+T V DA+DG IKI TIA            VAVPEGLPLAVT
Sbjct  1    FFTGHTTKEDGSSAFVKGRTSVSDAVDGVIKIVTIATNSRAIQVTIVVVAVPEGLPLAVT  60

Query  175  LTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPP  354
            LTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+A+IG K+INPP
Sbjct  61   LTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAFIGRKKINPP  120

Query  355  DDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAI  531
            DD SQ+   VI LL EGIAQNTTG+VFVP +G   EVSGSPTEKAIL + VKLG+ FD +
Sbjct  121  DDSSQMHSIVIYLLSEGIAQNTTGNVFVPKDGEAVEVSGSPTEKAILSWAVKLGMKFDRV  180

Query  532  RSESSIIHAFPFNSEKKRGGVAVK-LDSE  615
            RSE++++H FPFNSEKKRGGVAVK ++SE
Sbjct  181  RSETTVLHVFPFNSEKKRGGVAVKRINSE  209



>ref|XP_006427752.1| hypothetical protein CICLE_v10024770mg [Citrus clementina]
 gb|ESR40992.1| hypothetical protein CICLE_v10024770mg [Citrus clementina]
Length=1076

 Score =   285 bits (729),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 179/211 (85%), Gaps = 6/211 (3%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL VL++RFFTGHT        F  G+T V DA+DG IKI TIAVTIVVVAVPEGLPLA
Sbjct  389  LVLAVLLVRFFTGHTTKEDGSSAFVKGRTSVSDAVDGVIKIVTIAVTIVVVAVPEGLPLA  448

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+A+IG K+IN
Sbjct  449  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAFIGRKKIN  508

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFD  525
            PPDD SQ+   VI LL EGIAQNTTG+VFVP +G   EVSGSPTEKAIL + VKLG+ FD
Sbjct  509  PPDDSSQMHSIVISLLSEGIAQNTTGNVFVPKDGEAVEVSGSPTEKAILSWAVKLGMKFD  568

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVK-LDSE  615
             +RSE++++H FPFNSEKKRGGVAVK ++SE
Sbjct  569  RVRSETTVLHVFPFNSEKKRGGVAVKRINSE  599



>ref|XP_006593507.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X7 [Glycine max]
Length=987

 Score =   284 bits (727),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 178/207 (86%), Gaps = 6/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+F+GHT++P     F AGKTKVGDAIDG IKIFT+AVTIVV+AVPEGLPLAVTLTLAYS
Sbjct  398  RYFSGHTRNPDGSVQFIAGKTKVGDAIDGVIKIFTVAVTIVVIAVPEGLPLAVTLTLAYS  457

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYI-GGKRINPPDDKSQ  369
            M+KMMADKALVRRLSACETMGSATTICSDKTGTLT+NQMTVV+A+I GGK+I PP ++S+
Sbjct  458  MKKMMADKALVRRLSACETMGSATTICSDKTGTLTMNQMTVVEAWIGGGKKIVPPYEESK  517

Query  370  LPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESS  546
                +  LL+EG+AQNT GSV++ EGG   EVSGSPTEKAIL++G+KLG+NFD  RS+SS
Sbjct  518  FSHMLCSLLIEGVAQNTNGSVYIAEGGNDVEVSGSPTEKAILEWGIKLGMNFDTARSDSS  577

Query  547  IIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IIH FPFNS+KKRGGVA ++    I+I
Sbjct  578  IIHVFPFNSDKKRGGVATRVSDSEIHI  604



>ref|XP_010545613.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Tarenaya hassleriana]
Length=1087

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 178/212 (84%), Gaps = 6/212 (3%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+ L++R+FTG+T DP     F  G T  GD ID  +KIFTIAVTIVVVAVPEGLPLAV
Sbjct  401  VLVALLVRYFTGNTHDPDGTTQFIRGNTSAGDIIDDCVKIFTIAVTIVVVAVPEGLPLAV  460

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GGKR+  
Sbjct  461  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGGKRMEL  520

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PD+ S +P +++ L+ EG+AQNTTG+VFVP +GG  E+SGSPTEKAIL +  +LG+ FD 
Sbjct  521  PDNSSGMPSELLSLICEGVAQNTTGNVFVPKDGGDVEISGSPTEKAILSWAYQLGMKFDT  580

Query  529  IRSESSIIHAFPFNSEKKRGGVAV-KLDSEFI  621
            IRSES+IIHAFPFNSEKKRGGVAV + DSE +
Sbjct  581  IRSESAIIHAFPFNSEKKRGGVAVLRGDSEVV  612



>ref|XP_009340519.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X2 [Pyrus x bretschneideri]
Length=1100

 Score =   285 bits (728),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 177/213 (83%), Gaps = 4/213 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL VL  R+FTG+TKD +    FKAG+T +    DGA+KIFTIAVTIVVVAVPEGLPLA
Sbjct  412  LVLAVLWGRYFTGNTKDLYGKVQFKAGQTSISKTFDGAVKIFTIAVTIVVVAVPEGLPLA  471

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+IN
Sbjct  472  VTLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGIKKIN  531

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPDD SQL   V  L+ EG+AQNTTG+VF P GG  E+SGSPTEKAIL +  KLG+ FDA
Sbjct  532  PPDDTSQLHPLVSTLISEGVAQNTTGNVFEPTGGEVEISGSPTEKAILSWAFKLGMKFDA  591

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IR ES+++H FPFNSEKKRGGVA+K     ++I
Sbjct  592  IRLESTVLHVFPFNSEKKRGGVALKQADSKVHI  624



>ref|XP_003543731.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Glycine max]
 ref|XP_006593502.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X2 [Glycine max]
 ref|XP_006593503.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X3 [Glycine max]
 ref|XP_006593504.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X4 [Glycine max]
 ref|XP_006593505.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X5 [Glycine max]
 ref|XP_006593506.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X6 [Glycine max]
Length=1074

 Score =   284 bits (727),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 178/207 (86%), Gaps = 6/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+F+GHT++P     F AGKTKVGDAIDG IKIFT+AVTIVV+AVPEGLPLAVTLTLAYS
Sbjct  398  RYFSGHTRNPDGSVQFIAGKTKVGDAIDGVIKIFTVAVTIVVIAVPEGLPLAVTLTLAYS  457

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYI-GGKRINPPDDKSQ  369
            M+KMMADKALVRRLSACETMGSATTICSDKTGTLT+NQMTVV+A+I GGK+I PP ++S+
Sbjct  458  MKKMMADKALVRRLSACETMGSATTICSDKTGTLTMNQMTVVEAWIGGGKKIVPPYEESK  517

Query  370  LPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESS  546
                +  LL+EG+AQNT GSV++ EGG   EVSGSPTEKAIL++G+KLG+NFD  RS+SS
Sbjct  518  FSHMLCSLLIEGVAQNTNGSVYIAEGGNDVEVSGSPTEKAILEWGIKLGMNFDTARSDSS  577

Query  547  IIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IIH FPFNS+KKRGGVA ++    I+I
Sbjct  578  IIHVFPFNSDKKRGGVATRVSDSEIHI  604



>ref|XP_009333971.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X2 [Pyrus x bretschneideri]
Length=1100

 Score =   284 bits (727),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 176/213 (83%), Gaps = 4/213 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL VL  R+FTG+TKD      FKAG+T +    DGA+KIFTIAVTIVVVAVPEGLPLA
Sbjct  412  LVLAVLWGRYFTGNTKDLEGHVQFKAGQTSISKTFDGAVKIFTIAVTIVVVAVPEGLPLA  471

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+IN
Sbjct  472  VTLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGRKKIN  531

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPDD SQL   V  LL EG+AQNTTG+VF P GG  E+SGSPTEKAIL +  KLG+ F+A
Sbjct  532  PPDDTSQLHPLVSTLLSEGVAQNTTGNVFEPTGGEVEISGSPTEKAILSWAFKLGMKFEA  591

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IR ES+++H FPFNSEKKRGGVA+K     ++I
Sbjct  592  IRLESTVLHVFPFNSEKKRGGVALKQADSKVHI  624



>ref|XP_008342501.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Malus domestica]
Length=978

 Score =   283 bits (724),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 175/213 (82%), Gaps = 4/213 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL VL   +FTG+T+D      F AG+T++G A DGAIKIFTIAVTIVVVAVPEGLPLA
Sbjct  415  LVLAVLWAXYFTGNTRDLDGKVQFIAGQTRIGKAFDGAIKIFTIAVTIVVVAVPEGLPLA  474

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+IN
Sbjct  475  VTLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGRKKIN  534

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPDD SQL   V  LL EG+AQNTTG+VF P GG  E+SGSPTEKAIL +  KLG+ F  
Sbjct  535  PPDDSSQLHPLVSTLLSEGVAQNTTGNVFEPTGGEVEISGSPTEKAILSWAFKLGMKFGV  594

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IR ES+++H FPFNSEKKRGGVAVK     ++I
Sbjct  595  IRLESTVLHVFPFNSEKKRGGVAVKQADSNVHI  627



>ref|XP_006492040.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Citrus sinensis]
Length=1076

 Score =   284 bits (726),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 179/211 (85%), Gaps = 6/211 (3%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL VL++RFFTGHT        F  G+T V DA+DG IKI TIAVTIVVVAVPEGLPLA
Sbjct  389  LVLAVLLVRFFTGHTTKEDGSSAFVKGRTSVSDAVDGVIKIVTIAVTIVVVAVPEGLPLA  448

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+A+IG K+IN
Sbjct  449  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAFIGRKKIN  508

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFD  525
            PPDD SQ+   VI LL EGIAQNTTG+VFVP +G   EVSGSPTEKAIL + VKLG+ FD
Sbjct  509  PPDDSSQMHSIVIYLLSEGIAQNTTGNVFVPKDGEAVEVSGSPTEKAILSWAVKLGMKFD  568

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVK-LDSE  615
             +RSE++++H FPFNSEKKRGGVAVK ++SE
Sbjct  569  RVRSETTVLHVFPFNSEKKRGGVAVKRINSE  599



>ref|XP_008227944.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X1 [Prunus mume]
 ref|XP_008227945.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X1 [Prunus mume]
Length=1099

 Score =   284 bits (726),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 179/214 (84%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL VL  R+FTG+++D      F AG+T  G AIDGA+K+FTIAVTIVVVAVPEGLPLA
Sbjct  412  LVLAVLWGRYFTGNSRDADGTVQFIAGQTSTGKAIDGAVKVFTIAVTIVVVAVPEGLPLA  471

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+IN
Sbjct  472  VTLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGKKKIN  531

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFD  525
             PDD SQL  +V  LL EGIAQNTTG+VF P +GG  E+SGSPTEKAIL + VKLG+ FD
Sbjct  532  LPDDSSQLHPQVSTLLSEGIAQNTTGNVFEPKQGGEVEISGSPTEKAILSWAVKLGMKFD  591

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             IRSES+++H FPFNSEKKRGGVA+K     ++I
Sbjct  592  FIRSESTVLHVFPFNSEKKRGGVALKQTDSKVHI  625



>ref|XP_007217082.1| hypothetical protein PRUPE_ppa000581mg [Prunus persica]
 gb|EMJ18281.1| hypothetical protein PRUPE_ppa000581mg [Prunus persica]
Length=1088

 Score =   283 bits (725),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 179/214 (84%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL VL  R+FTG+++D      F AG+T  G AIDGA+K+FTIAVTIVVVAVPEGLPLA
Sbjct  401  LVLAVLWGRYFTGNSRDADGTVQFIAGQTSTGKAIDGAVKVFTIAVTIVVVAVPEGLPLA  460

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+IN
Sbjct  461  VTLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGKKKIN  520

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFD  525
             PDD SQL  +V  LL EGIAQNTTG+VF P +GG  E+SGSPTEKAIL + VKLG+ FD
Sbjct  521  LPDDSSQLHPQVSTLLSEGIAQNTTGNVFEPKQGGEVEISGSPTEKAILSWAVKLGMKFD  580

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             IRSES+++H FPFNSEKKRGGVA+K     ++I
Sbjct  581  FIRSESTVLHVFPFNSEKKRGGVALKQTDSKVHI  614



>ref|XP_002315383.2| an N-terminal calmodulin binding autoinhibitory domain-containing 
family protein [Populus trichocarpa]
 gb|EEF01554.2| an N-terminal calmodulin binding autoinhibitory domain-containing 
family protein [Populus trichocarpa]
Length=1085

 Score =   283 bits (725),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 179/213 (84%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+ R+FTG+TK+P     F  G+TKV  AIDG IKI T+AVTIVVVAVPEGLPLAV
Sbjct  399  VLAVLLGRYFTGNTKNPDGSVQFIKGETKVSKAIDGVIKILTVAVTIVVVAVPEGLPLAV  458

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGS+TTICSDKTGTLTLNQMTVV+AYIG ++INP
Sbjct  459  TLTLAYSMRKMMADKALVRRLSACETMGSSTTICSDKTGTLTLNQMTVVEAYIGKQKINP  518

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PD+  +L  +V  LL EGIAQNTTG+VFVP +GG  E+SGSPTEKAIL + VKLG+ FDA
Sbjct  519  PDNPLKLHSEVSSLLCEGIAQNTTGNVFVPKDGGDVEISGSPTEKAILSWAVKLGMKFDA  578

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RSES I+H FPFNSEKK+GGVAV+     ++I
Sbjct  579  LRSESKILHVFPFNSEKKQGGVAVQTTDSKVHI  611



>ref|XP_008801512.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
isoform X1 [Phoenix dactylifera]
Length=1074

 Score =   283 bits (725),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 181/213 (85%), Gaps = 6/213 (3%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL++R+FTGHT +P     F  G+T V DA++GAIKI T+AVTIVVVAVPEGLPLAV
Sbjct  388  VLVVLLVRYFTGHTNNPDGTVQFVRGQTGVRDALNGAIKILTVAVTIVVVAVPEGLPLAV  447

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+GG +++ 
Sbjct  448  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGGMKLDT  507

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PDD  +L   + PLL+EGIAQNTTG VF PE GG  EV+GSPTEKAIL +GVKLG+ F+ 
Sbjct  508  PDDVKEL-YNISPLLIEGIAQNTTGDVFEPEDGGAIEVNGSPTEKAILSWGVKLGMKFND  566

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RS+SSI+H FPFNSEKKRGGVA++L    +++
Sbjct  567  VRSKSSILHVFPFNSEKKRGGVAIQLPDSRVHV  599



>ref|XP_010655160.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X2 [Vitis vinifera]
 ref|XP_010655161.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X2 [Vitis vinifera]
Length=1030

 Score =   283 bits (723),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 176/211 (83%), Gaps = 7/211 (3%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+IR+FTGHT+D      FK+G T  GDA+D  IKI TIAVTIVVVAVPEGLPLAV
Sbjct  343  VLAVLLIRYFTGHTRDSDGTVQFKSGVTSFGDAVDDVIKIITIAVTIVVVAVPEGLPLAV  402

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+AY+G K+I+P
Sbjct  403  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNKMTVVEAYVGRKKIDP  462

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP---EVSGSPTEKAILQFGVKLGLNF  522
            PDD SQL   V  LL EGIA NT G+VFVP+GG     E+SGSPTEKAIL + VKLG+ F
Sbjct  463  PDDSSQLHPDVSSLLHEGIACNTQGNVFVPKGGGEEKMEISGSPTEKAILAWAVKLGMKF  522

Query  523  DAIRSESSIIHAFPFNSEKKRGGVAVKLDSE  615
            D IR ESSI+H FPFNSEKKRGGVAV+ D++
Sbjct  523  DVIREESSILHVFPFNSEKKRGGVAVQGDNK  553



>ref|XP_010655162.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X3 [Vitis vinifera]
Length=1029

 Score =   283 bits (723),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 176/211 (83%), Gaps = 7/211 (3%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+IR+FTGHT+D      FK+G T  GDA+D  IKI TIAVTIVVVAVPEGLPLAV
Sbjct  342  VLAVLLIRYFTGHTRDSDGTVQFKSGVTSFGDAVDDVIKIITIAVTIVVVAVPEGLPLAV  401

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+AY+G K+I+P
Sbjct  402  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNKMTVVEAYVGRKKIDP  461

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP---EVSGSPTEKAILQFGVKLGLNF  522
            PDD SQL   V  LL EGIA NT G+VFVP+GG     E+SGSPTEKAIL + VKLG+ F
Sbjct  462  PDDSSQLHPDVSSLLHEGIACNTQGNVFVPKGGGEEKMEISGSPTEKAILAWAVKLGMKF  521

Query  523  DAIRSESSIIHAFPFNSEKKRGGVAVKLDSE  615
            D IR ESSI+H FPFNSEKKRGGVAV+ D++
Sbjct  522  DVIREESSILHVFPFNSEKKRGGVAVQGDNK  552



>ref|XP_004150387.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
[Cucumis sativus]
 gb|KGN61187.1| hypothetical protein Csa_2G062620 [Cucumis sativus]
Length=1076

 Score =   283 bits (724),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 183/209 (88%), Gaps = 5/209 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL+ R+FTGH+K+P     F AG+TKVG A+DGAIKI TIAVTIVVVAVPEGLPLAV
Sbjct  392  VLVVLLARYFTGHSKNPDGSRQFIAGQTKVGRAVDGAIKIVTIAVTIVVVAVPEGLPLAV  451

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLT+NQMT+V+AY GGK+I+P
Sbjct  452  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTVNQMTIVEAYAGGKKIDP  511

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            P+ KS+    +  LL+EGIA N+ GSV+VPE GG  EV+GSPTEKAIL +G+KLG+NF+A
Sbjct  512  PEKKSEFSPTLHSLLVEGIALNSNGSVYVPESGGEVEVTGSPTEKAILNWGIKLGMNFEA  571

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSE  615
            +R+ES+I+H FPF+S+KKRGGVA + D++
Sbjct  572  LRTESTILHVFPFSSDKKRGGVACQQDNQ  600



>ref|XP_011033032.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X2 [Populus euphratica]
Length=1098

 Score =   283 bits (724),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 178/213 (84%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+ R+FTG+TK+P     F  G+T V  A+DG IKI TIAVTIVVVAVPEGLPLAV
Sbjct  402  VLAVLLGRYFTGNTKNPDGSVQFIKGETTVSKAVDGVIKILTIAVTIVVVAVPEGLPLAV  461

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGS+TTICSDKTGTLTLNQMTVV+AY+G ++INP
Sbjct  462  TLTLAYSMRKMMADKALVRRLSACETMGSSTTICSDKTGTLTLNQMTVVEAYVGSQKINP  521

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PDD SQL  +   LL EGIAQNTTG+VFVP +GG  E++GSPTEKAIL + VKLG+ FD 
Sbjct  522  PDDPSQLQSEAGSLLCEGIAQNTTGNVFVPKDGGDVEITGSPTEKAILSWAVKLGMKFDV  581

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +R+ES I+H FPFNSEKKRGGVA+++    ++I
Sbjct  582  LRAESKILHVFPFNSEKKRGGVAIQMADSKVHI  614



>ref|XP_002275074.2| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X1 [Vitis vinifera]
Length=1075

 Score =   283 bits (724),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 176/211 (83%), Gaps = 7/211 (3%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+IR+FTGHT+D      FK+G T  GDA+D  IKI TIAVTIVVVAVPEGLPLAV
Sbjct  388  VLAVLLIRYFTGHTRDSDGTVQFKSGVTSFGDAVDDVIKIITIAVTIVVVAVPEGLPLAV  447

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+AY+G K+I+P
Sbjct  448  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNKMTVVEAYVGRKKIDP  507

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP---EVSGSPTEKAILQFGVKLGLNF  522
            PDD SQL   V  LL EGIA NT G+VFVP+GG     E+SGSPTEKAIL + VKLG+ F
Sbjct  508  PDDSSQLHPDVSSLLHEGIACNTQGNVFVPKGGGEEKMEISGSPTEKAILAWAVKLGMKF  567

Query  523  DAIRSESSIIHAFPFNSEKKRGGVAVKLDSE  615
            D IR ESSI+H FPFNSEKKRGGVAV+ D++
Sbjct  568  DVIREESSILHVFPFNSEKKRGGVAVQGDNK  598



>ref|XP_009349648.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X2 [Pyrus x bretschneideri]
Length=1100

 Score =   283 bits (724),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 178/214 (83%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL VL  R+FTG+T+D      F AG+T++G A DGA+KIFTIAVTIVVVAVPEGLPLA
Sbjct  411  LVLAVLWGRYFTGNTRDLDGKVQFIAGQTRIGKAFDGAVKIFTIAVTIVVVAVPEGLPLA  470

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+IN
Sbjct  471  VTLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGRKKIN  530

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFD  525
            PPDD SQL   V  LL EG+AQNTTG+VF P +GG  E+SGSPTEKAIL +  KLG+ F 
Sbjct  531  PPDDSSQLHPLVSTLLSEGVAQNTTGNVFEPTQGGEVEISGSPTEKAILSWAFKLGMKFG  590

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             IRSES+++H FPFNSEKKRGGVAVK     ++I
Sbjct  591  VIRSESTVLHVFPFNSEKKRGGVAVKQADSKVHI  624



>ref|XP_010929325.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Elaeis guineensis]
Length=923

 Score =   281 bits (719),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 175/206 (85%), Gaps = 6/206 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R FTGHT++P     F  G+T V DA++GAIKIFT+A+TIVVVAVPEGLPLAVTLTLAYS
Sbjct  270  RHFTGHTQNPDGTVQFVRGQTGVRDALNGAIKIFTVAMTIVVVAVPEGLPLAVTLTLAYS  329

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMT+V+AY GG +++PPDD  QL
Sbjct  330  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTIVEAYAGGMKLDPPDDVKQL  389

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
             + + PLL+EG+AQNTTG VF PE GG  EVSGSPTEKAIL +GVKLG+ F+ +RS+SSI
Sbjct  390  -RNISPLLIEGLAQNTTGDVFEPEDGGAIEVSGSPTEKAILSWGVKLGMKFNDVRSKSSI  448

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKK GGVAV+L    ++I
Sbjct  449  LHVFPFNSEKKHGGVAVQLPDSRVHI  474



>ref|XP_011033031.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X1 [Populus euphratica]
Length=1110

 Score =   283 bits (723),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 178/213 (84%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+ R+FTG+TK+P     F  G+T V  A+DG IKI TIAVTIVVVAVPEGLPLAV
Sbjct  414  VLAVLLGRYFTGNTKNPDGSVQFIKGETTVSKAVDGVIKILTIAVTIVVVAVPEGLPLAV  473

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGS+TTICSDKTGTLTLNQMTVV+AY+G ++INP
Sbjct  474  TLTLAYSMRKMMADKALVRRLSACETMGSSTTICSDKTGTLTLNQMTVVEAYVGSQKINP  533

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PDD SQL  +   LL EGIAQNTTG+VFVP +GG  E++GSPTEKAIL + VKLG+ FD 
Sbjct  534  PDDPSQLQSEAGSLLCEGIAQNTTGNVFVPKDGGDVEITGSPTEKAILSWAVKLGMKFDV  593

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +R+ES I+H FPFNSEKKRGGVA+++    ++I
Sbjct  594  LRAESKILHVFPFNSEKKRGGVAIQMADSKVHI  626



>ref|XP_010063652.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X3 [Eucalyptus grandis]
Length=947

 Score =   281 bits (719),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 178/214 (83%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL+ R+FTGHTK+P     F  G TKV D +DG + I TIAVTIVVVAVPEGLPLA
Sbjct  262  VVLTVLLTRYFTGHTKNPDGTVQFVKGMTKVDDILDGVVHIVTIAVTIVVVAVPEGLPLA  321

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+++
Sbjct  322  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGRKKMD  381

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFD  525
            PPDD SQL   +  LL+EGIA NT G+V+VP +GG  EV+GSPTEKAIL + VKLG+ FD
Sbjct  382  PPDDASQLHHLISSLLIEGIAHNTQGNVYVPKDGGDAEVTGSPTEKAILSWAVKLGMKFD  441

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            A+R+ES+ +H FPFNSEKKRGGVA++  S  ++I
Sbjct  442  AVRAESTELHVFPFNSEKKRGGVAIQKTSSDVHI  475



>ref|XP_010536881.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Tarenaya hassleriana]
 ref|XP_010536882.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Tarenaya hassleriana]
 ref|XP_010536883.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Tarenaya hassleriana]
 ref|XP_010536884.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Tarenaya hassleriana]
Length=1080

 Score =   282 bits (722),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 176/207 (85%), Gaps = 5/207 (2%)
 Frame = +1

Query  22   IRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAY  189
            IR+FTGHT+D    P F  GKTK G  +D  IKI T+AVTIVVVAVPEGLPLAVTLTLAY
Sbjct  393  IRYFTGHTEDIKGNPQFVKGKTKPGHVVDDVIKIVTVAVTIVVVAVPEGLPLAVTLTLAY  452

Query  190  SMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQ  369
            SMRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GG +++ PDD SQ
Sbjct  453  SMRKMMVDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGGDKMDTPDDSSQ  512

Query  370  LPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESS  546
            LP ++  LL+EG+AQNTTG V+VPE GG  E+SGSPTEKAIL +G+KLG++FDA+RS+SS
Sbjct  513  LPPELNSLLVEGVAQNTTGGVYVPESGGNVELSGSPTEKAILGWGIKLGMDFDAVRSQSS  572

Query  547  IIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            I+H FPFNSEKKRGGVAVKL    ++I
Sbjct  573  ILHVFPFNSEKKRGGVAVKLPDGQVHI  599



>gb|KCW70887.1| hypothetical protein EUGRSUZ_F04017 [Eucalyptus grandis]
Length=994

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 178/214 (83%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL+ R+FTGHTK+P     F  G TKV D +DG + I TIAVTIVVVAVPEGLPLA
Sbjct  309  VVLTVLLTRYFTGHTKNPDGTVQFVKGMTKVDDILDGVVHIVTIAVTIVVVAVPEGLPLA  368

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+++
Sbjct  369  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGRKKMD  428

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFD  525
            PPDD SQL   +  LL+EGIA NT G+V+VP +GG  EV+GSPTEKAIL + VKLG+ FD
Sbjct  429  PPDDASQLHHLISSLLIEGIAHNTQGNVYVPKDGGDAEVTGSPTEKAILSWAVKLGMKFD  488

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            A+R+ES+ +H FPFNSEKKRGGVA++  S  ++I
Sbjct  489  AVRAESTELHVFPFNSEKKRGGVAIQKTSSDVHI  522



>ref|XP_010063650.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X1 [Eucalyptus grandis]
Length=1072

 Score =   281 bits (719),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 178/214 (83%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL+ R+FTGHTK+P     F  G TKV D +DG + I TIAVTIVVVAVPEGLPLA
Sbjct  387  VVLTVLLTRYFTGHTKNPDGTVQFVKGMTKVDDILDGVVHIVTIAVTIVVVAVPEGLPLA  446

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+++
Sbjct  447  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGRKKMD  506

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFD  525
            PPDD SQL   +  LL+EGIA NT G+V+VP +GG  EV+GSPTEKAIL + VKLG+ FD
Sbjct  507  PPDDASQLHHLISSLLIEGIAHNTQGNVYVPKDGGDAEVTGSPTEKAILSWAVKLGMKFD  566

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            A+R+ES+ +H FPFNSEKKRGGVA++  S  ++I
Sbjct  567  AVRAESTELHVFPFNSEKKRGGVAIQKTSSDVHI  600



>ref|XP_010063651.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X2 [Eucalyptus grandis]
Length=1070

 Score =   281 bits (719),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 178/214 (83%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL+ R+FTGHTK+P     F  G TKV D +DG + I TIAVTIVVVAVPEGLPLA
Sbjct  385  VVLTVLLTRYFTGHTKNPDGTVQFVKGMTKVDDILDGVVHIVTIAVTIVVVAVPEGLPLA  444

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+++
Sbjct  445  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGRKKMD  504

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFD  525
            PPDD SQL   +  LL+EGIA NT G+V+VP +GG  EV+GSPTEKAIL + VKLG+ FD
Sbjct  505  PPDDASQLHHLISSLLIEGIAHNTQGNVYVPKDGGDAEVTGSPTEKAILSWAVKLGMKFD  564

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            A+R+ES+ +H FPFNSEKKRGGVA++  S  ++I
Sbjct  565  AVRAESTELHVFPFNSEKKRGGVAIQKTSSDVHI  598



>ref|XP_009340518.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X1 [Pyrus x bretschneideri]
Length=1101

 Score =   281 bits (720),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 178/214 (83%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL VL  R+FTG+TKD +    FKAG+T +    DGA+KIFTIAVTIVVVAVPEGLPLA
Sbjct  412  LVLAVLWGRYFTGNTKDLYGKVQFKAGQTSISKTFDGAVKIFTIAVTIVVVAVPEGLPLA  471

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+IN
Sbjct  472  VTLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGIKKIN  531

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFD  525
            PPDD SQL   V  L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL +  KLG+ FD
Sbjct  532  PPDDTSQLHPLVSTLISEGVAQNTTGNVFEPTQGGEVEISGSPTEKAILSWAFKLGMKFD  591

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            AIR ES+++H FPFNSEKKRGGVA+K     ++I
Sbjct  592  AIRLESTVLHVFPFNSEKKRGGVALKQADSKVHI  625



>ref|XP_006401243.1| hypothetical protein EUTSA_v10012523mg [Eutrema salsugineum]
 gb|ESQ42696.1| hypothetical protein EUTSA_v10012523mg [Eutrema salsugineum]
Length=999

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 173/205 (84%), Gaps = 9/205 (4%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L++R+FTGHT+D    P F  GKTK+G  +D  IK+ T+AVTIVVVAVPEGLPLAV
Sbjct  313  VLVILLVRYFTGHTRDIRGGPQFVKGKTKIGHVVDDVIKVITVAVTIVVVAVPEGLPLAV  372

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV++Y GGK+   
Sbjct  373  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVESYAGGKKT--  430

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
              D  QLP  +  L +EGIAQNTTGS+FVPEGG   E SGSPTEKAIL +G+KLG+NFD 
Sbjct  431  --DTEQLPATITSLCVEGIAQNTTGSIFVPEGGGDLEFSGSPTEKAILGWGIKLGMNFDT  488

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
             RS+SSI+HAFPFNSEKKRGGVAVK
Sbjct  489  ARSQSSILHAFPFNSEKKRGGVAVK  513



>ref|XP_010048692.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Eucalyptus grandis]
 gb|KCW81053.1| hypothetical protein EUGRSUZ_C02428 [Eucalyptus grandis]
Length=1033

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 175/211 (83%), Gaps = 5/211 (2%)
 Frame = +1

Query  10   LVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTL  177
            +VL+ R+FTG TK+    P F+AGKT +G A+DG IKIFTIA+ IVV+AVPEGLPLAVTL
Sbjct  351  IVLLARYFTGLTKNSDGSPQFQAGKTSIGSAVDGVIKIFTIAILIVVIAVPEGLPLAVTL  410

Query  178  TLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPD  357
             LAYSMRKMM DKALVRRLSACETMGSATTICSDKTGTLT NQMTVV+A+IGG++++ P+
Sbjct  411  ILAYSMRKMMVDKALVRRLSACETMGSATTICSDKTGTLTSNQMTVVEAHIGGEKMDSPN  470

Query  358  DKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIR  534
              SQ P  ++ LL E IAQNT GSVF PEGG   E+SGSPTEKAIL +G+KLG+NF+  R
Sbjct  471  GSSQQPTTMVTLLTESIAQNTNGSVFTPEGGEDVEISGSPTEKAILSWGLKLGMNFEVTR  530

Query  535  SESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            S+SSIIH FPFNS+KKRGGVA+KL    +++
Sbjct  531  SQSSIIHVFPFNSQKKRGGVALKLTETEVHV  561



>ref|XP_008380287.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Malus domestica]
Length=1100

 Score =   281 bits (719),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 174/213 (82%), Gaps = 4/213 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL VL  R+FTG+TKD      FKAG+T +    DGA+KIFTIAVTIVVVAVPEGLPLA
Sbjct  412  LVLAVLWGRYFTGNTKDLEGNVQFKAGQTSISKTFDGAVKIFTIAVTIVVVAVPEGLPLA  471

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+IN
Sbjct  472  VTLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGRKKIN  531

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPDD SQL   V  LL EG+A NTTG+VF P GG  E+SGSPTEKAIL +  KLG+ FD 
Sbjct  532  PPDDTSQLHPLVSTLLSEGVAHNTTGNVFEPTGGKVEISGSPTEKAILSWAFKLGMKFDV  591

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            I+ ES+++H FPFNSEKKRGGVA+K     ++I
Sbjct  592  IKLESTVLHVFPFNSEKKRGGVALKQADSKVHI  624



>gb|KJB56395.1| hypothetical protein B456_009G118300 [Gossypium raimondii]
Length=900

 Score =   279 bits (713),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 172/203 (85%), Gaps = 6/203 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT+DP     F  G+T   DA +  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  402  RYFTGHTEDPDGTKQFIKGRTNFDDAFNDVVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  461

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+A++G K+INPP D SQL
Sbjct  462  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAFVGKKKINPPSDSSQL  521

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P  V+ LL EG+AQN+TG+VFVP +GG  E+SGSPTEKAIL + VKLG+ FD IRS+S I
Sbjct  522  PASVVSLLNEGVAQNSTGNVFVPKDGGNIEISGSPTEKAILSWAVKLGMKFDIIRSDSKI  581

Query  550  IHAFPFNSEKKRGGVAVK-LDSE  615
            +H FPFNSEKKRGGVA++  DSE
Sbjct  582  LHVFPFNSEKKRGGVALQGADSE  604



>ref|XP_010276717.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Nelumbo nucifera]
 ref|XP_010276718.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Nelumbo nucifera]
Length=1074

 Score =   281 bits (718),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 178/206 (86%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTKDP     F  GKT+VG A+DGAIKI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  402  RYFTGHTKDPDGTVQFIRGKTRVGKAVDGAIKIVTVAVTIVVVAVPEGLPLAVTLTLAYS  461

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+GG++++ PD+   L
Sbjct  462  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGGEKMDAPDNALLL  521

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               +  LL+EGIAQNTTGSVF+PEGG   E+SGSPTEKAIL +GVKLG+ FD +RSESSI
Sbjct  522  SPTLSSLLIEGIAQNTTGSVFMPEGGGDVEISGSPTEKAILYWGVKLGMKFDRVRSESSI  581

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVAV+L +  ++I
Sbjct  582  LHVFPFNSEKKRGGVAVQLPNSEVHI  607



>gb|KJB56394.1| hypothetical protein B456_009G118300 [Gossypium raimondii]
Length=873

 Score =   278 bits (712),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 172/203 (85%), Gaps = 6/203 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT+DP     F  G+T   DA +  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  402  RYFTGHTEDPDGTKQFIKGRTNFDDAFNDVVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  461

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+A++G K+INPP D SQL
Sbjct  462  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAFVGKKKINPPSDSSQL  521

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P  V+ LL EG+AQN+TG+VFVP +GG  E+SGSPTEKAIL + VKLG+ FD IRS+S I
Sbjct  522  PASVVSLLNEGVAQNSTGNVFVPKDGGNIEISGSPTEKAILSWAVKLGMKFDIIRSDSKI  581

Query  550  IHAFPFNSEKKRGGVAVK-LDSE  615
            +H FPFNSEKKRGGVA++  DSE
Sbjct  582  LHVFPFNSEKKRGGVALQGADSE  604



>ref|XP_009333970.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X1 [Pyrus x bretschneideri]
Length=1101

 Score =   281 bits (718),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 177/214 (83%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL VL  R+FTG+TKD      FKAG+T +    DGA+KIFTIAVTIVVVAVPEGLPLA
Sbjct  412  LVLAVLWGRYFTGNTKDLEGHVQFKAGQTSISKTFDGAVKIFTIAVTIVVVAVPEGLPLA  471

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+IN
Sbjct  472  VTLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGRKKIN  531

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFD  525
            PPDD SQL   V  LL EG+AQNTTG+VF P +GG  E+SGSPTEKAIL +  KLG+ F+
Sbjct  532  PPDDTSQLHPLVSTLLSEGVAQNTTGNVFEPTQGGEVEISGSPTEKAILSWAFKLGMKFE  591

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            AIR ES+++H FPFNSEKKRGGVA+K     ++I
Sbjct  592  AIRLESTVLHVFPFNSEKKRGGVALKQADSKVHI  625



>ref|XP_006401244.1| hypothetical protein EUTSA_v10012523mg [Eutrema salsugineum]
 dbj|BAJ34212.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42697.1| hypothetical protein EUTSA_v10012523mg [Eutrema salsugineum]
Length=1073

 Score =   281 bits (718),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 173/205 (84%), Gaps = 9/205 (4%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L++R+FTGHT+D    P F  GKTK+G  +D  IK+ T+AVTIVVVAVPEGLPLAV
Sbjct  387  VLVILLVRYFTGHTRDIRGGPQFVKGKTKIGHVVDDVIKVITVAVTIVVVAVPEGLPLAV  446

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV++Y GGK+   
Sbjct  447  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVESYAGGKKT--  504

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
              D  QLP  +  L +EGIAQNTTGS+FVPEGG   E SGSPTEKAIL +G+KLG+NFD 
Sbjct  505  --DTEQLPATITSLCVEGIAQNTTGSIFVPEGGGDLEFSGSPTEKAILGWGIKLGMNFDT  562

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
             RS+SSI+HAFPFNSEKKRGGVAVK
Sbjct  563  ARSQSSILHAFPFNSEKKRGGVAVK  587



>gb|KJB56396.1| hypothetical protein B456_009G118300 [Gossypium raimondii]
Length=941

 Score =   278 bits (712),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 172/203 (85%), Gaps = 6/203 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT+DP     F  G+T   DA +  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  402  RYFTGHTEDPDGTKQFIKGRTNFDDAFNDVVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  461

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+A++G K+INPP D SQL
Sbjct  462  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAFVGKKKINPPSDSSQL  521

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P  V+ LL EG+AQN+TG+VFVP +GG  E+SGSPTEKAIL + VKLG+ FD IRS+S I
Sbjct  522  PASVVSLLNEGVAQNSTGNVFVPKDGGNIEISGSPTEKAILSWAVKLGMKFDIIRSDSKI  581

Query  550  IHAFPFNSEKKRGGVAVK-LDSE  615
            +H FPFNSEKKRGGVA++  DSE
Sbjct  582  LHVFPFNSEKKRGGVALQGADSE  604



>gb|KJB70755.1| hypothetical protein B456_011G090300 [Gossypium raimondii]
Length=699

 Score =   274 bits (700),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 178/213 (84%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL +L+ R+FTG+T+DP+    F  G+TK  DA +  +KIFTIAVTIVVVAVPEGLPLAV
Sbjct  397  VLAILLARYFTGNTEDPNGATQFIKGRTKFDDAFNDVVKIFTIAVTIVVVAVPEGLPLAV  456

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+A++G K+INP
Sbjct  457  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAFVGKKKINP  516

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            P + SQL   V+ LL EG+AQ+TTG+VFV + G   E+SGSPTEKAIL + ++LG+ FDA
Sbjct  517  PAESSQLHLSVVSLLSEGVAQSTTGNVFVSKDGDDVEISGSPTEKAILSWAIELGMKFDA  576

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IRSES+I+H FPFNSEKKRGGVA++     ++I
Sbjct  577  IRSESTILHVFPFNSEKKRGGVALRRSDAEVHI  609



>ref|XP_006582993.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Glycine max]
Length=1090

 Score =   280 bits (715),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 174/206 (84%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+F+GHTKD      F AGKT V +A+D  IKIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  409  RYFSGHTKDIDGNVEFVAGKTSVSNAVDDVIKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  468

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G  ++  PDD S+L
Sbjct  469  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGSTKVYSPDDSSKL  528

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K + L+ EGIAQNTTG+VFVP +GG  EVSGSPTEKAIL++ VKLG++FD IRS S++
Sbjct  529  HPKALSLINEGIAQNTTGNVFVPKDGGETEVSGSPTEKAILKWAVKLGMDFDVIRSNSTV  588

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVA+KL    ++I
Sbjct  589  LHVFPFNSEKKRGGVALKLGDSGVHI  614



>emb|CDY20693.1| BnaA02g08330D [Brassica napus]
Length=1070

 Score =   279 bits (714),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 173/205 (84%), Gaps = 9/205 (4%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L++R+FTGHT+D    P F  GKTK+G  +D  IK+ T+AVTIVVVAVPEGLPLAV
Sbjct  387  VLVILLVRYFTGHTEDERGGPQFVKGKTKIGHVVDDVIKVITVAVTIVVVAVPEGLPLAV  446

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV++Y GGK+   
Sbjct  447  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVESYAGGKKT--  504

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
              D  QLP  +  L +EGIAQNTTGS++VPEGG   E SGSPTEKAIL +G+KLG+NFD 
Sbjct  505  --DTEQLPATITSLCVEGIAQNTTGSIYVPEGGGDLEFSGSPTEKAILGWGIKLGMNFDT  562

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
             RS+SSI+HAFPFNSEKKRGGVAVK
Sbjct  563  ARSQSSILHAFPFNSEKKRGGVAVK  587



>ref|XP_006281735.1| hypothetical protein CARUB_v10027891mg [Capsella rubella]
 gb|EOA14633.1| hypothetical protein CARUB_v10027891mg [Capsella rubella]
Length=1080

 Score =   279 bits (714),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 178/213 (84%), Gaps = 9/213 (4%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L+ R+FTGHTKD    P F  GKTK+G  +D  IK+ T+AVTIVVVAVPEGLPLAV
Sbjct  387  VLVILLTRYFTGHTKDVHGGPQFIKGKTKIGHVVDDVIKVVTVAVTIVVVAVPEGLPLAV  446

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV++Y GGK+   
Sbjct  447  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVESYAGGKKT--  504

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
              D +QLP  +  L++EGI+QNTTGS+FVPEGG   E+SGSPTEKAIL +G+KLG+NF+ 
Sbjct  505  --DTAQLPATITSLVVEGISQNTTGSIFVPEGGGELELSGSPTEKAILGWGIKLGMNFET  562

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             RS+SSI+HAFPFNSEKKRGGVAVK     ++I
Sbjct  563  TRSQSSILHAFPFNSEKKRGGVAVKTADGEVHI  595



>ref|NP_851200.1| calcium-transporting ATPase 8 [Arabidopsis thaliana]
 ref|NP_200521.3| calcium-transporting ATPase 8 [Arabidopsis thaliana]
 sp|Q9LF79.1|ACA8_ARATH RecName: Full=Calcium-transporting ATPase 8, plasma membrane-type; 
AltName: Full=Ca(2+)-ATPase isoform 8 [Arabidopsis thaliana]
 emb|CAB96189.1| plasma membrane Ca2+-ATPase [Arabidopsis thaliana]
 gb|AAL47426.1| AT5g57110/MUL3_5 [Arabidopsis thaliana]
 dbj|BAE99029.1| Ca2+-transporting ATPase like protein [Arabidopsis thaliana]
 gb|AED96847.1| calcium-transporting ATPase 8 [Arabidopsis thaliana]
 gb|AED96848.1| calcium-transporting ATPase 8 [Arabidopsis thaliana]
Length=1074

 Score =   279 bits (714),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 173/205 (84%), Gaps = 9/205 (4%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L+ R+FTGHTKD    P F  GKTKVG  ID  +K+ T+AVTIVVVAVPEGLPLAV
Sbjct  387  VLVILLTRYFTGHTKDNNGGPQFVKGKTKVGHVIDDVVKVLTVAVTIVVVAVPEGLPLAV  446

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV++Y GGK+   
Sbjct  447  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVESYAGGKKT--  504

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
              D  QLP  +  L++EGI+QNTTGS+FVPEGG   E SGSPTEKAIL +GVKLG+NF+ 
Sbjct  505  --DTEQLPATITSLVVEGISQNTTGSIFVPEGGGDLEYSGSPTEKAILGWGVKLGMNFET  562

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
             RS+SSI+HAFPFNSEKKRGGVAVK
Sbjct  563  ARSQSSILHAFPFNSEKKRGGVAVK  587



>gb|KCW44504.1| hypothetical protein EUGRSUZ_L019901, partial [Eucalyptus grandis]
Length=432

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 176/213 (83%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L++R+FTG+T+D +    F  G+T +   +D  IKI TIAVTIVVVAVPEGLPLAV
Sbjct  49   VLVILVVRYFTGNTEDANGNVQFIKGRTSISHVVDDIIKIVTIAVTIVVVAVPEGLPLAV  108

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY G K+++P
Sbjct  109  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGQKKLDP  168

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            P+D S+L + V  LL EGIAQNT G+VFVP+GG   E+SGSPTEKAIL + VKLG+ FD 
Sbjct  169  PNDSSKLHEVVTSLLHEGIAQNTQGNVFVPKGGEDVEISGSPTEKAILSWAVKLGMKFDV  228

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             RSES+++H  PFNS KKRGGVA+K ++  ++I
Sbjct  229  SRSESTVLHVVPFNSCKKRGGVAIKRNNSEVFI  261



>ref|XP_010451807.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Camelina sativa]
Length=1074

 Score =   279 bits (713),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 175/205 (85%), Gaps = 9/205 (4%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L+ R+FTGHTKD    P F  GKTK+G  +D  +K+ T+AVTIVVVAVPEGLPLAV
Sbjct  387  VLVILLTRYFTGHTKDVGGGPQFIKGKTKIGHVVDDVVKVITVAVTIVVVAVPEGLPLAV  446

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV++Y GGK+   
Sbjct  447  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVESYAGGKKT--  504

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
              D +QLP  +  L++EGI+QNTTGS+FVPEGG   E+SGSPTEKAIL +G+KLG+NF+ 
Sbjct  505  --DTAQLPATITSLVVEGISQNTTGSIFVPEGGGELELSGSPTEKAILGWGIKLGMNFET  562

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
             RS+SSI+HAFPFNSEKKRGGVAVK
Sbjct  563  TRSQSSILHAFPFNSEKKRGGVAVK  587



>ref|XP_009126900.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Brassica rapa]
 ref|XP_009126902.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Brassica rapa]
Length=1070

 Score =   279 bits (713),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 173/205 (84%), Gaps = 9/205 (4%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L++R+FTGHT+D    P F  GKTK+G  +D  IK+ T+AVTIVVVAVPEGLPLAV
Sbjct  387  VLVILLVRYFTGHTEDERGGPQFVKGKTKIGHVVDDVIKVITVAVTIVVVAVPEGLPLAV  446

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV++Y GGK+   
Sbjct  447  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVESYAGGKKT--  504

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEG-GVPEVSGSPTEKAILQFGVKLGLNFDA  528
              D  QLP  +  L +EGIAQNTTGS++VPEG G  E SGSPTEKAIL +G+KLG+NFD 
Sbjct  505  --DTEQLPATITSLCVEGIAQNTTGSIYVPEGRGDLEFSGSPTEKAILGWGIKLGMNFDT  562

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
             RS+SSI+HAFPFNSEKKRGGVAVK
Sbjct  563  ARSQSSILHAFPFNSEKKRGGVAVK  587



>gb|KJB56391.1| hypothetical protein B456_009G118300 [Gossypium raimondii]
Length=1082

 Score =   278 bits (712),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 172/203 (85%), Gaps = 6/203 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT+DP     F  G+T   DA +  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  402  RYFTGHTEDPDGTKQFIKGRTNFDDAFNDVVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  461

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+A++G K+INPP D SQL
Sbjct  462  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAFVGKKKINPPSDSSQL  521

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P  V+ LL EG+AQN+TG+VFVP +GG  E+SGSPTEKAIL + VKLG+ FD IRS+S I
Sbjct  522  PASVVSLLNEGVAQNSTGNVFVPKDGGNIEISGSPTEKAILSWAVKLGMKFDIIRSDSKI  581

Query  550  IHAFPFNSEKKRGGVAVK-LDSE  615
            +H FPFNSEKKRGGVA++  DSE
Sbjct  582  LHVFPFNSEKKRGGVALQGADSE  604



>ref|XP_010443383.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Camelina sativa]
Length=1074

 Score =   278 bits (712),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 175/205 (85%), Gaps = 9/205 (4%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L+ R+FTGHTKD    P F  GKTK+G  +D  +K+ T+AVTIVVVAVPEGLPLAV
Sbjct  387  VLVILLTRYFTGHTKDVGGGPQFIKGKTKIGHVVDDVVKVITVAVTIVVVAVPEGLPLAV  446

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV++Y GGK+   
Sbjct  447  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVESYAGGKKT--  504

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
              D +QLP  +  L++EGI+QNTTGS+FVPEGG   E+SGSPTEKAIL +G+KLG+NF+ 
Sbjct  505  --DTAQLPPTITSLVVEGISQNTTGSIFVPEGGGELELSGSPTEKAILGWGIKLGMNFET  562

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
             RS+SSI+HAFPFNSEKKRGGVAVK
Sbjct  563  TRSQSSILHAFPFNSEKKRGGVAVK  587



>ref|XP_004507012.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Cicer arietinum]
Length=1096

 Score =   278 bits (711),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 172/206 (83%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+F+GHT D    P F +GKT + DA+DG IKIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  417  RYFSGHTDDLNGNPEFVSGKTSISDAVDGVIKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  476

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G  +INPP D S+L
Sbjct  477  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGRGKINPPVDSSKL  536

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              + + L+ E +AQNTTG+VFV  +GG  EVSGSPTEKAIL + VKLG+NFD  RS S++
Sbjct  537  QPETLSLIHESVAQNTTGNVFVSKDGGEVEVSGSPTEKAILSWAVKLGMNFDLTRSNSTV  596

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVA+KL    ++I
Sbjct  597  LHVFPFNSEKKRGGVALKLADSGVHI  622



>gb|KEH28612.1| calcium-transporting ATPase 8, plasma membrane-type protein [Medicago 
truncatula]
Length=1104

 Score =   278 bits (711),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 172/206 (83%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+F+GHT D    P F AGKT++   +DG IKIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  425  RYFSGHTYDAKGNPQFVAGKTEISIVVDGVIKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  484

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G  ++NPPDD S+ 
Sbjct  485  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGKSKLNPPDDSSKF  544

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              + + L+ E IAQNTTG+VFV  +GG  EVSGSPTEKAIL + VKLG+NFD IRS S++
Sbjct  545  HPEALSLINESIAQNTTGNVFVSKDGGELEVSGSPTEKAILSWAVKLGMNFDVIRSNSTV  604

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVA+KL    ++I
Sbjct  605  LHVFPFNSEKKRGGVALKLVDSGVHI  630



>gb|KEH28611.1| calcium-transporting ATPase 8, plasma membrane-type protein [Medicago 
truncatula]
Length=1111

 Score =   278 bits (710),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 172/206 (83%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+F+GHT D    P F AGKT++   +DG IKIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  432  RYFSGHTYDAKGNPQFVAGKTEISIVVDGVIKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  491

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G  ++NPPDD S+ 
Sbjct  492  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGKSKLNPPDDSSKF  551

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              + + L+ E IAQNTTG+VFV  +GG  EVSGSPTEKAIL + VKLG+NFD IRS S++
Sbjct  552  HPEALSLINESIAQNTTGNVFVSKDGGELEVSGSPTEKAILSWAVKLGMNFDVIRSNSTV  611

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVA+KL    ++I
Sbjct  612  LHVFPFNSEKKRGGVALKLVDSGVHI  637



>gb|KDP34443.1| hypothetical protein JCGZ_11914 [Jatropha curcas]
Length=1069

 Score =   277 bits (709),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 177/213 (83%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+IR+FTG+T++ +    F  G TK+G+A+DG +KI TIAVTIVVVAVPEGLPLAV
Sbjct  383  VLAVLLIRYFTGNTRNSNGEVQFIRGHTKIGEAVDGVVKIITIAVTIVVVAVPEGLPLAV  442

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G  ++N 
Sbjct  443  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGRMKMNG  502

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PDD SQL  +V+ LL EG AQN+TG+VF P +GG  EVSGSPTEKAIL + VKLG+ FD 
Sbjct  503  PDDSSQLHSEVVSLLCEGAAQNSTGNVFAPKDGGDVEVSGSPTEKAILSWAVKLGMKFDV  562

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IRS+S ++  FPFNSEKKRGGVAV+     I+I
Sbjct  563  IRSQSKVLQVFPFNSEKKRGGVAVQRSDSKIHI  595



>gb|KCW44503.1| hypothetical protein EUGRSUZ_L019901, partial [Eucalyptus grandis]
Length=481

 Score =   266 bits (680),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 176/213 (83%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L++R+FTG+T+D +    F  G+T +   +D  IKI TIAVTIVVVAVPEGLPLAV
Sbjct  49   VLVILVVRYFTGNTEDANGNVQFIKGRTSISHVVDDIIKIVTIAVTIVVVAVPEGLPLAV  108

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY G K+++P
Sbjct  109  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGQKKLDP  168

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            P+D S+L + V  LL EGIAQNT G+VFVP+GG   E+SGSPTEKAIL + VKLG+ FD 
Sbjct  169  PNDSSKLHEVVTSLLHEGIAQNTQGNVFVPKGGEDVEISGSPTEKAILSWAVKLGMKFDV  228

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             RSES+++H  PFNS KKRGGVA+K ++  ++I
Sbjct  229  SRSESTVLHVVPFNSCKKRGGVAIKRNNSEVFI  261



>ref|XP_009359960.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X2 [Pyrus x bretschneideri]
Length=1070

 Score =   277 bits (709),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 175/206 (85%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+ +    FKAGKTK GDAIDGAIKI TIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  392  RYFTGHTKNANGSSQFKAGKTKFGDAIDGAIKIVTIAVTIVVVAVPEGLPLAVTLTLAYS  451

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+A+ GG +I+    KS +
Sbjct  452  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNKMTVVEAFTGGGKIDLSGSKSDV  511

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               +  LL+EGIA NT GSV+ PE GG  EVSGSPTEKAILQ G+KLG+NFDAIRS+SSI
Sbjct  512  SPMLSSLLIEGIALNTNGSVYTPETGGDIEVSGSPTEKAILQLGIKLGMNFDAIRSKSSI  571

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGG AVKL +  ++I
Sbjct  572  LHVFPFNSEKKRGGAAVKLPNTEVHI  597



>ref|XP_002310944.2| an N-terminal calmodulin binding autoinhibitory domain-containing 
family protein [Populus trichocarpa]
 gb|EEE88311.2| an N-terminal calmodulin binding autoinhibitory domain-containing 
family protein [Populus trichocarpa]
Length=1106

 Score =   277 bits (709),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 176/213 (83%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+ R+FTG+TK+P     F  G+T V  A+DG IKI TIAVTIVVVAVPEGLPLAV
Sbjct  416  VLAVLLGRYFTGNTKNPDGSVQFIKGETTVSKAVDGVIKILTIAVTIVVVAVPEGLPLAV  475

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGS+TTICSDKTGTLTLNQMTVV+AY+G ++INP
Sbjct  476  TLTLAYSMRKMMADKALVRRLSACETMGSSTTICSDKTGTLTLNQMTVVEAYVGNQKINP  535

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PDD SQL  +   LL EGIAQNTTG+VFVP +GG  E++GSPTEKAIL + VKLG+ FD 
Sbjct  536  PDDPSQLQSEAGLLLCEGIAQNTTGNVFVPKDGGDVEITGSPTEKAILSWAVKLGMKFDV  595

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +R+ES I+  FPFNSEKKRGGVA++     ++I
Sbjct  596  LRAESKILRVFPFNSEKKRGGVAIQTADSKVHI  628



>emb|CDY32902.1| BnaC02g11860D [Brassica napus]
Length=1122

 Score =   277 bits (709),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 173/205 (84%), Gaps = 9/205 (4%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L++R+FTGHT+D    P F  GKTK+G  +D  IK+ T+AVTIVVVAVPEGLPLAV
Sbjct  388  VLVILLVRYFTGHTEDERGGPQFVKGKTKIGHVVDDVIKVITVAVTIVVVAVPEGLPLAV  447

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV++Y GGK+   
Sbjct  448  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVESYAGGKKT--  505

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
              D  QLP  +  L +EGIAQNTTGS++VPEGG   E SGSPTEKAIL +G+KLG+NF+ 
Sbjct  506  --DTQQLPATITSLCVEGIAQNTTGSIYVPEGGGDLEFSGSPTEKAILGWGIKLGMNFET  563

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
             RS+SSI+HAFPFNSEKKRGGVAVK
Sbjct  564  ARSQSSILHAFPFNSEKKRGGVAVK  588



>emb|CBI25301.3| unnamed protein product [Vitis vinifera]
Length=1152

 Score =   277 bits (709),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 176/213 (83%), Gaps = 9/213 (4%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+IR+FTGHT+D      FK+G T  GDA+D  IKI TIAVTIVVVAVPEGLPLAV
Sbjct  463  VLAVLLIRYFTGHTRDSDGTVQFKSGVTSFGDAVDDVIKIITIAVTIVVVAVPEGLPLAV  522

Query  172  TLTLAYSMRKMMADKAL--VRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRI  345
            TLTLAYSMRKMMADKAL  VRRLSACETMGSATTICSDKTGTLTLN+MTVV+AY+G K+I
Sbjct  523  TLTLAYSMRKMMADKALACVRRLSACETMGSATTICSDKTGTLTLNKMTVVEAYVGRKKI  582

Query  346  NPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP---EVSGSPTEKAILQFGVKLGL  516
            +PPDD SQL   V  LL EGIA NT G+VFVP+GG     E+SGSPTEKAIL + VKLG+
Sbjct  583  DPPDDSSQLHPDVSSLLHEGIACNTQGNVFVPKGGGEEKMEISGSPTEKAILAWAVKLGM  642

Query  517  NFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSE  615
             FD IR ESSI+H FPFNSEKKRGGVAV+ D++
Sbjct  643  KFDVIREESSILHVFPFNSEKKRGGVAVQGDNK  675



>ref|XP_009359959.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Pyrus x bretschneideri]
Length=1113

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 175/206 (85%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+ +    FKAGKTK GDAIDGAIKI TIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  435  RYFTGHTKNANGSSQFKAGKTKFGDAIDGAIKIVTIAVTIVVVAVPEGLPLAVTLTLAYS  494

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+A+ GG +I+    KS +
Sbjct  495  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNKMTVVEAFTGGGKIDLSGSKSDV  554

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               +  LL+EGIA NT GSV+ PE GG  EVSGSPTEKAILQ G+KLG+NFDAIRS+SSI
Sbjct  555  SPMLSSLLIEGIALNTNGSVYTPETGGDIEVSGSPTEKAILQLGIKLGMNFDAIRSKSSI  614

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGG AVKL +  ++I
Sbjct  615  LHVFPFNSEKKRGGAAVKLPNTEVHI  640



>ref|XP_010927267.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
isoform X2 [Elaeis guineensis]
Length=1047

 Score =   276 bits (706),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 175/206 (85%), Gaps = 6/206 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+P     F  G+T V DA++GAIKI TIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  367  RYFTGHTKNPDGTVQFIRGQTGVRDALNGAIKILTIAVTIVVVAVPEGLPLAVTLTLAYS  426

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+GG +++ P+D  +L
Sbjct  427  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGGMKLDAPNDVKEL  486

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               + PLL+EGIAQNTTG VF PE GG  EV+GSPTEKAIL +GVKLG+ F+ +RS+SSI
Sbjct  487  CN-ISPLLIEGIAQNTTGDVFEPEDGGAMEVTGSPTEKAILSWGVKLGMKFNDVRSKSSI  545

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVA++L    ++I
Sbjct  546  LHVFPFNSEKKRGGVAIQLPDSRVHI  571



>gb|KJB70754.1| hypothetical protein B456_011G090300 [Gossypium raimondii]
Length=902

 Score =   275 bits (702),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 178/213 (84%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL +L+ R+FTG+T+DP+    F  G+TK  DA +  +KIFTIAVTIVVVAVPEGLPLAV
Sbjct  397  VLAILLARYFTGNTEDPNGATQFIKGRTKFDDAFNDVVKIFTIAVTIVVVAVPEGLPLAV  456

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+A++G K+INP
Sbjct  457  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAFVGKKKINP  516

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            P + SQL   V+ LL EG+AQ+TTG+VFV + G   E+SGSPTEKAIL + ++LG+ FDA
Sbjct  517  PAESSQLHLSVVSLLSEGVAQSTTGNVFVSKDGDDVEISGSPTEKAILSWAIELGMKFDA  576

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IRSES+I+H FPFNSEKKRGGVA++     ++I
Sbjct  577  IRSESTILHVFPFNSEKKRGGVALRRSDAEVHI  609



>gb|KCW44502.1| hypothetical protein EUGRSUZ_L019901, partial [Eucalyptus grandis]
Length=549

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 176/213 (83%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L++R+FTG+T+D +    F  G+T +   +D  IKI TIAVTIVVVAVPEGLPLAV
Sbjct  49   VLVILVVRYFTGNTEDANGNVQFIKGRTSISHVVDDIIKIVTIAVTIVVVAVPEGLPLAV  108

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY G K+++P
Sbjct  109  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGQKKLDP  168

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            P+D S+L + V  LL EGIAQNT G+VFVP+GG   E+SGSPTEKAIL + VKLG+ FD 
Sbjct  169  PNDSSKLHEVVTSLLHEGIAQNTQGNVFVPKGGEDVEISGSPTEKAILSWAVKLGMKFDV  228

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             RSES+++H  PFNS KKRGGVA+K ++  ++I
Sbjct  229  SRSESTVLHVVPFNSCKKRGGVAIKRNNSEVFI  261



>dbj|BAH20100.1| AT5G57110 [Arabidopsis thaliana]
Length=1074

 Score =   276 bits (706),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 172/205 (84%), Gaps = 9/205 (4%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L+ R+FTGHTKD    P F  GKTKVG  I   +K+ T+AVTIVVVAVPEGLPLAV
Sbjct  387  VLVILLTRYFTGHTKDNNGGPQFVKGKTKVGHVIGDVVKVLTVAVTIVVVAVPEGLPLAV  446

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV++Y GGK+   
Sbjct  447  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVESYAGGKKT--  504

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
              D  QLP  +  L++EGI+QNTTGS+FVPEGG   E SGSPTEKAIL +GVKLG+NF+ 
Sbjct  505  --DTEQLPATITSLVVEGISQNTTGSIFVPEGGGDLEYSGSPTEKAILGWGVKLGMNFET  562

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
             RS+SSI+HAFPFNSEKKRGGVAVK
Sbjct  563  ARSQSSILHAFPFNSEKKRGGVAVK  587



>ref|XP_010927266.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
isoform X1 [Elaeis guineensis]
Length=1075

 Score =   276 bits (705),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 175/206 (85%), Gaps = 6/206 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+P     F  G+T V DA++GAIKI TIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  395  RYFTGHTKNPDGTVQFIRGQTGVRDALNGAIKILTIAVTIVVVAVPEGLPLAVTLTLAYS  454

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+GG +++ P+D  +L
Sbjct  455  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGGMKLDAPNDVKEL  514

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               + PLL+EGIAQNTTG VF PE GG  EV+GSPTEKAIL +GVKLG+ F+ +RS+SSI
Sbjct  515  CN-ISPLLIEGIAQNTTGDVFEPEDGGAMEVTGSPTEKAILSWGVKLGMKFNDVRSKSSI  573

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVA++L    ++I
Sbjct  574  LHVFPFNSEKKRGGVAIQLPDSRVHI  599



>ref|XP_006845776.1| hypothetical protein AMTR_s00019p00251600 [Amborella trichopoda]
 gb|ERN07451.1| hypothetical protein AMTR_s00019p00251600 [Amborella trichopoda]
Length=1079

 Score =   276 bits (705),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 178/214 (83%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL +L++R+FTG+TKDP     F  GKTK    +D  +KIF IAVTIVVVAVPEGLPLA
Sbjct  389  LVLGILLVRYFTGNTKDPGGAVQFIKGKTKTSTILDDCVKIFAIAVTIVVVAVPEGLPLA  448

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+A++GG  ++
Sbjct  449  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAFVGGAMVH  508

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQFGVKLGLNFD  525
            PP++  ++  KV  L+ EGIAQNTTGSVF+PEGG  P+V+GSPTE+AIL +G++L ++FD
Sbjct  509  PPENTEKMSPKVASLITEGIAQNTTGSVFIPEGGRAPDVTGSPTERAILSWGLQLRMDFD  568

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             +RS SS++H F FNSEKKRGGVA+KL    ++I
Sbjct  569  VLRSISSVLHVFTFNSEKKRGGVAIKLSESEVHI  602



>emb|CDY38264.1| BnaA10g11120D [Brassica napus]
Length=1073

 Score =   276 bits (705),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 173/205 (84%), Gaps = 9/205 (4%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L++R+FTGHT+D    P F  GKTK+G  +D  IK+ T+AVTIVVVAVPEGLPLAV
Sbjct  387  VLVILLVRYFTGHTEDVGGGPQFVKGKTKIGHVVDDVIKVVTVAVTIVVVAVPEGLPLAV  446

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV++Y GGK+   
Sbjct  447  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVESYAGGKKT--  504

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
              D  QLP  +  L +EGIAQNTTGS++VPEGG   E SGSPTEKAIL +GVKLG+NF+ 
Sbjct  505  --DSQQLPATITSLCVEGIAQNTTGSIYVPEGGGDLEFSGSPTEKAILGWGVKLGMNFET  562

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
             RS+SSI+HAFPF+SEKKRGGVAVK
Sbjct  563  ARSQSSILHAFPFSSEKKRGGVAVK  587



>ref|XP_010928700.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Elaeis guineensis]
 ref|XP_010928701.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Elaeis guineensis]
 ref|XP_010928702.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Elaeis guineensis]
 ref|XP_010928703.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Elaeis guineensis]
Length=1067

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 172/203 (85%), Gaps = 6/203 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG+TK+P     F  G+T V  A+DGAIK+ TIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  391  RYFTGNTKNPDGSVQFIKGQTSVKAAVDGAIKMLTIAVTIVVVAVPEGLPLAVTLTLAYS  450

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMT+V+AY+GG++I+PP+D S +
Sbjct  451  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTIVEAYVGGEKIDPPEDVSLM  510

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
                  LL+EGIAQNTTGSVF PE GG  E++GSPTEKAIL + VKLG+ FD  RSESSI
Sbjct  511  SSTASSLLIEGIAQNTTGSVFEPERGGTIEITGSPTEKAILSWAVKLGMKFDDARSESSI  570

Query  550  IHAFPFNSEKKRGGVAVKL-DSE  615
            +H FPFNSEKKRGGVAV + DSE
Sbjct  571  LHVFPFNSEKKRGGVAVHVGDSE  593



>ref|XP_009120228.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Brassica rapa]
 ref|XP_009120229.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Brassica rapa]
Length=1073

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 173/205 (84%), Gaps = 9/205 (4%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L++R+FTGHT+D    P F  GKTK+G  +D  IK+ T+AVTIVVVAVPEGLPLAV
Sbjct  387  VLVILLVRYFTGHTEDVGGGPQFVKGKTKIGHVVDDVIKVVTVAVTIVVVAVPEGLPLAV  446

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV++Y GGK+   
Sbjct  447  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVESYAGGKKT--  504

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
              D  QLP  +  L +EGIAQNTTGS++VPEGG   E SGSPTEKAIL +GVKLG+NF+ 
Sbjct  505  --DSQQLPATITSLCVEGIAQNTTGSIYVPEGGGDLEFSGSPTEKAILGWGVKLGMNFET  562

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
             RS+SSI+HAFPF+SEKKRGGVAVK
Sbjct  563  ARSQSSILHAFPFSSEKKRGGVAVK  587



>ref|XP_010109302.1| Calcium-transporting ATPase 9, plasma membrane-type [Morus notabilis]
 gb|EXC21596.1| Calcium-transporting ATPase 9, plasma membrane-type [Morus notabilis]
Length=1104

 Score =   276 bits (705),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 176/219 (80%), Gaps = 11/219 (5%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTK----DPHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+ R+F+GHTK       F  G+T V DA+DG IKIFTIAVTIVVVAVPEGLPLAV
Sbjct  412  VLAVLLGRYFSGHTKTHDGSRQFIRGRTSVSDAVDGVIKIFTIAVTIVVVAVPEGLPLAV  471

Query  172  TLTLAYSMRKMMADKAL------VRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIG  333
            TLTLAYSMRKMMADKAL      VRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G
Sbjct  472  TLTLAYSMRKMMADKALANIHVQVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVG  531

Query  334  GKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEG-GVPEVSGSPTEKAILQFGVKL  510
             K++NPPDD SQL      LL EGIAQNTTG+VFVP+G G  E++GSPTEKAIL + ++L
Sbjct  532  KKKMNPPDDPSQLHSDASALLSEGIAQNTTGNVFVPKGDGDVEITGSPTEKAILSWAMEL  591

Query  511  GLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            G+ FD IRSE+ ++H FPFNSEKKRGGVA+K     ++I
Sbjct  592  GMKFDIIRSETIVLHVFPFNSEKKRGGVALKQKDSKVHI  630



>ref|XP_008781797.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Phoenix dactylifera]
 ref|XP_008781798.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Phoenix dactylifera]
 ref|XP_008781799.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Phoenix dactylifera]
Length=1086

 Score =   275 bits (704),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 168/199 (84%), Gaps = 5/199 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+P     F  G+T V  A++GAIKI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  399  RYFTGHTKNPDGSVQFIKGQTSVKSAVNGAIKILTVAVTIVVVAVPEGLPLAVTLTLAYS  458

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMT+V AY+GGK+I+PPD+   +
Sbjct  459  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTIVVAYVGGKKIDPPDNIESM  518

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P   + LL+EGIAQNTTG+VF PE GG  EV+GSPTEKAIL + VKLG+ FD  RS+SSI
Sbjct  519  PSNAVSLLIEGIAQNTTGNVFEPESGGTIEVTGSPTEKAILSWAVKLGMKFDDARSKSSI  578

Query  550  IHAFPFNSEKKRGGVAVKL  606
            +H FPFNSEKKRG VAV +
Sbjct  579  LHVFPFNSEKKRGAVAVHV  597



>ref|XP_010913722.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X2 [Elaeis guineensis]
Length=1085

 Score =   275 bits (703),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 170/206 (83%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGH+K+P     F  G+T V  A++GAIKI T AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  396  RYFTGHSKNPDGSVQFIKGQTSVKSAVNGAIKILTDAVTIVVVAVPEGLPLAVTLTLAYS  455

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMT+V+AY+GGK+I+PPD+   +
Sbjct  456  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTIVEAYVGGKKIDPPDNIESM  515

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
                I LL+EGIAQNTTG+VF PE GG  EV+GSPTEKAIL + VKLG+ FD  RS+SSI
Sbjct  516  SSTAISLLIEGIAQNTTGNVFEPESGGTIEVTGSPTEKAILSWAVKLGMKFDDARSKSSI  575

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRG VAV +    +++
Sbjct  576  LHVFPFNSEKKRGAVAVHVGGSEVHV  601



>ref|XP_009128366.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X3 [Brassica rapa]
 ref|XP_009128368.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X3 [Brassica rapa]
 ref|XP_009128376.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X3 [Brassica rapa]
 ref|XP_009128385.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X3 [Brassica rapa]
Length=997

 Score =   275 bits (702),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 170/205 (83%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL++R+FTGHTKD    P F  GKTK    +D  +KI T+AVTIVVVAVPEGLPLA
Sbjct  312  VVLFVLVVRYFTGHTKDANGAPQFVGGKTKFDHVLDDLVKIITVAVTIVVVAVPEGLPLA  371

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+ Y G ++++
Sbjct  372  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVECYAGFQKMD  431

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPD  S+LP      L+EGIA NTTGSVF+ E G  +VSGSPTE+AIL + +KLG+NFDA
Sbjct  432  PPDSSSKLPPAFTCKLVEGIAHNTTGSVFLSESGEIQVSGSPTERAILNWAIKLGMNFDA  491

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
            +RSESS IH FPFNSE+KRGGVAVK
Sbjct  492  LRSESSAIHFFPFNSEQKRGGVAVK  516



>ref|XP_010913719.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010913720.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010913721.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Elaeis guineensis]
Length=1088

 Score =   275 bits (703),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 170/206 (83%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGH+K+P     F  G+T V  A++GAIKI T AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  399  RYFTGHSKNPDGSVQFIKGQTSVKSAVNGAIKILTDAVTIVVVAVPEGLPLAVTLTLAYS  458

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMT+V+AY+GGK+I+PPD+   +
Sbjct  459  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTIVEAYVGGKKIDPPDNIESM  518

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
                I LL+EGIAQNTTG+VF PE GG  EV+GSPTEKAIL + VKLG+ FD  RS+SSI
Sbjct  519  SSTAISLLIEGIAQNTTGNVFEPESGGTIEVTGSPTEKAILSWAVKLGMKFDDARSKSSI  578

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRG VAV +    +++
Sbjct  579  LHVFPFNSEKKRGAVAVHVGGSEVHV  604



>ref|XP_008799456.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X2 [Phoenix dactylifera]
Length=953

 Score =   274 bits (700),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 173/206 (84%), Gaps = 6/206 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+P     F  G+T V DA++GAIKI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  270  RYFTGHTKNPDGTVQFIRGQTGVRDAVNGAIKILTVAVTIVVVAVPEGLPLAVTLTLAYS  329

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GG +++PPDD  QL
Sbjct  330  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGGMKLDPPDDVEQL  389

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               + PLL+EG+AQNTTG VF PE G   EVSGSPTEKAIL +GVKLG+ F+ +RS+SSI
Sbjct  390  CD-ISPLLIEGLAQNTTGDVFEPEDGKAIEVSGSPTEKAILSWGVKLGMKFNEVRSKSSI  448

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +  FPFNS+KKRGGVAV+L    +++
Sbjct  449  LRVFPFNSDKKRGGVAVQLPDSRVHV  474



>ref|XP_009386789.1| PREDICTED: LOW QUALITY PROTEIN: calcium-transporting ATPase 9, 
plasma membrane-type-like, partial [Musa acuminata subsp. 
malaccensis]
Length=858

 Score =   272 bits (696),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 171/212 (81%), Gaps = 4/212 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL  R+FTGHTK+P     F  G T    AIDGA+KI TIAVTIVVVAVPEGLPLAV
Sbjct  175  VLIVLWARYFTGHTKNPDGTAQFIRGLTSAKAAIDGAVKILTIAVTIVVVAVPEGLPLAV  234

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+A +GG +++ 
Sbjct  235  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEANVGGMKLSS  294

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDAI  531
            PD+   L      LL+EGIAQNTTG+VFVPE G  EVSGSPTEKAIL +G+KLG+ FD +
Sbjct  295  PDNCDILTDAASHLLIEGIAQNTTGNVFVPEDGPAEVSGSPTEKAILSWGIKLGMKFDVV  354

Query  532  RSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            R+ +SI+H  PFNSEKK GGVA+K+    I++
Sbjct  355  RAAASILHVVPFNSEKKHGGVAIKVADSKIHV  386



>emb|CDY53981.1| BnaC09g53480D [Brassica napus]
Length=1158

 Score =   275 bits (703),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 173/205 (84%), Gaps = 9/205 (4%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L++R+FTGHT+D    P F  GKTK+G  +D  IK+ T+AVTIVVVAVPEGLPLAV
Sbjct  387  VLVILLVRYFTGHTEDVGGGPQFVKGKTKIGHVVDDVIKVVTVAVTIVVVAVPEGLPLAV  446

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV++Y GGK+   
Sbjct  447  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVESYAGGKKT--  504

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
              D  QLP  +  L +EGIAQNTTGS++VPEGG   E SGSPTEKAIL +GVKLG+NF+ 
Sbjct  505  --DSQQLPATITSLCVEGIAQNTTGSIYVPEGGGDLEFSGSPTEKAILGWGVKLGMNFET  562

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
             RS+SSI+HAFPF+SEKKRGGVAVK
Sbjct  563  ARSQSSILHAFPFSSEKKRGGVAVK  587



>emb|CDX68595.1| BnaC01g08580D [Brassica napus]
Length=1058

 Score =   275 bits (702),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 173/213 (81%), Gaps = 4/213 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL++R+FTGHTKD    P F  GKTK    +D  +KI T+AVTIVVVAVPEGLPLA
Sbjct  374  VVLFVLVVRYFTGHTKDANGAPQFIGGKTKFDHVLDDLVKIITVAVTIVVVAVPEGLPLA  433

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV++Y G ++++
Sbjct  434  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVESYAGFQKMD  493

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPD  S+LP      L+EGIA NTTGSVF  E G  +VSGSPTE+AIL + +KLG+NFDA
Sbjct  494  PPDSSSKLPPAFTSKLVEGIAHNTTGSVFRSESGEIQVSGSPTERAILNWAIKLGMNFDA  553

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RSESS +H FPFNSE+KRGGVAVK     +++
Sbjct  554  LRSESSAVHFFPFNSEQKRGGVAVKSADSSVHV  586



>ref|XP_009128358.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X2 [Brassica rapa]
Length=1071

 Score =   275 bits (702),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 170/205 (83%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL++R+FTGHTKD    P F  GKTK    +D  +KI T+AVTIVVVAVPEGLPLA
Sbjct  388  VVLFVLVVRYFTGHTKDANGAPQFVGGKTKFDHVLDDLVKIITVAVTIVVVAVPEGLPLA  447

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+ Y G ++++
Sbjct  448  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVECYAGFQKMD  507

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPD  S+LP      L+EGIA NTTGSVF+ E G  +VSGSPTE+AIL + +KLG+NFDA
Sbjct  508  PPDSSSKLPPAFTCKLVEGIAHNTTGSVFLSESGEIQVSGSPTERAILNWAIKLGMNFDA  567

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
            +RSESS IH FPFNSE+KRGGVAVK
Sbjct  568  LRSESSAIHFFPFNSEQKRGGVAVK  592



>ref|XP_009128346.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Brassica rapa]
 ref|XP_009128354.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Brassica rapa]
Length=1073

 Score =   275 bits (702),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 170/205 (83%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL++R+FTGHTKD    P F  GKTK    +D  +KI T+AVTIVVVAVPEGLPLA
Sbjct  388  VVLFVLVVRYFTGHTKDANGAPQFVGGKTKFDHVLDDLVKIITVAVTIVVVAVPEGLPLA  447

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+ Y G ++++
Sbjct  448  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVECYAGFQKMD  507

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPD  S+LP      L+EGIA NTTGSVF+ E G  +VSGSPTE+AIL + +KLG+NFDA
Sbjct  508  PPDSSSKLPPAFTCKLVEGIAHNTTGSVFLSESGEIQVSGSPTERAILNWAIKLGMNFDA  567

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
            +RSESS IH FPFNSE+KRGGVAVK
Sbjct  568  LRSESSAIHFFPFNSEQKRGGVAVK  592



>ref|XP_002866184.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42443.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1079

 Score =   274 bits (701),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 171/205 (83%), Gaps = 9/205 (4%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTK----DPHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L+ R+FTGHTK     P F  GKTK+G  +D  IK+ T+AVTIVVVAVPEGLPLAV
Sbjct  387  VLVILLTRYFTGHTKAANGGPQFVKGKTKIGHVVDDVIKVLTVAVTIVVVAVPEGLPLAV  446

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV++Y GGK+   
Sbjct  447  TLTLAYSMRKMMVDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVESYAGGKKT--  504

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
              D  QLP  +  L++EGI+QNTTGS+FVPEGG   E SGSPTEKAIL +GVKLG+NF+ 
Sbjct  505  --DTEQLPATITSLVVEGISQNTTGSIFVPEGGGDLEYSGSPTEKAILGWGVKLGMNFET  562

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
             RS+SSI+HAFPFNSEKKRGGVAVK
Sbjct  563  ARSQSSILHAFPFNSEKKRGGVAVK  587



>ref|XP_004299792.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Fragaria vesca subsp. vesca]
 ref|XP_011464741.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Fragaria vesca subsp. vesca]
 ref|XP_011464742.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Fragaria vesca subsp. vesca]
 ref|XP_011464743.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Fragaria vesca subsp. vesca]
Length=1087

 Score =   274 bits (700),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 179/214 (84%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            +VL+VL++R+FTGHT +    P F +G TK G AIDGAIKI TIAVTIVVVAVPEGLPLA
Sbjct  385  LVLIVLLVRYFTGHTLNANGTPQFVSGTTKFGKAIDGAIKIVTIAVTIVVVAVPEGLPLA  444

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV++    +++N
Sbjct  445  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVESCACLRKVN  504

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFD  525
              D K  L   +  L++EGIAQNTTG+V+VPE GG  EV+GSPTEKAILQ+ +KLG+NF 
Sbjct  505  SNDGKPDLSPTISSLIIEGIAQNTTGNVYVPETGGDVEVTGSPTEKAILQWALKLGMNFV  564

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            A RS+SSI+H FPFNSEKKRGGVAVKL +  ++I
Sbjct  565  AARSQSSILHVFPFNSEKKRGGVAVKLPNSEVHI  598



>ref|XP_008799453.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008799454.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008799455.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Phoenix dactylifera]
Length=1074

 Score =   273 bits (699),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 173/206 (84%), Gaps = 6/206 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+P     F  G+T V DA++GAIKI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  391  RYFTGHTKNPDGTVQFIRGQTGVRDAVNGAIKILTVAVTIVVVAVPEGLPLAVTLTLAYS  450

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GG +++PPDD  QL
Sbjct  451  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGGMKLDPPDDVEQL  510

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               + PLL+EG+AQNTTG VF PE G   EVSGSPTEKAIL +GVKLG+ F+ +RS+SSI
Sbjct  511  CD-ISPLLIEGLAQNTTGDVFEPEDGKAIEVSGSPTEKAILSWGVKLGMKFNEVRSKSSI  569

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +  FPFNS+KKRGGVAV+L    +++
Sbjct  570  LRVFPFNSDKKRGGVAVQLPDSRVHV  595



>gb|KJB70750.1| hypothetical protein B456_011G090300 [Gossypium raimondii]
 gb|KJB70751.1| hypothetical protein B456_011G090300 [Gossypium raimondii]
 gb|KJB70752.1| hypothetical protein B456_011G090300 [Gossypium raimondii]
 gb|KJB70753.1| hypothetical protein B456_011G090300 [Gossypium raimondii]
Length=1084

 Score =   273 bits (699),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 178/213 (84%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL +L+ R+FTG+T+DP+    F  G+TK  DA +  +KIFTIAVTIVVVAVPEGLPLAV
Sbjct  397  VLAILLARYFTGNTEDPNGATQFIKGRTKFDDAFNDVVKIFTIAVTIVVVAVPEGLPLAV  456

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+A++G K+INP
Sbjct  457  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAFVGKKKINP  516

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            P + SQL   V+ LL EG+AQ+TTG+VFV + G   E+SGSPTEKAIL + ++LG+ FDA
Sbjct  517  PAESSQLHLSVVSLLSEGVAQSTTGNVFVSKDGDDVEISGSPTEKAILSWAIELGMKFDA  576

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IRSES+I+H FPFNSEKKRGGVA++     ++I
Sbjct  577  IRSESTILHVFPFNSEKKRGGVALRRSDAEVHI  609



>gb|KEH39694.1| calcium-transporting ATPase 9, plasma membrane-type protein [Medicago 
truncatula]
Length=878

 Score =   271 bits (694),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 176/214 (82%), Gaps = 6/214 (3%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L+ R+F+GHT        F    TK+   ++G I IFTIAVTIVVVAVPEGLPLAV
Sbjct  407  VLVILLGRYFSGHTTGSDGKVQFVYKVTKIDKVLEGFIAIFTIAVTIVVVAVPEGLPLAV  466

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGK-RIN  348
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GG+ ++N
Sbjct  467  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGGREKLN  526

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFD  525
            PPDD S+L  +V+ L+ EGIAQNTTG++F+P +GG  E+SGSPTEKAIL + VKLG+NF+
Sbjct  527  PPDDSSKLHPEVLSLINEGIAQNTTGNIFIPKDGGETEISGSPTEKAILSWAVKLGMNFE  586

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             +RS S I+H FPFNSEKKRGGVAVKL    ++I
Sbjct  587  LVRSRSKILHVFPFNSEKKRGGVAVKLADSEVHI  620



>ref|XP_004976722.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X2 [Setaria italica]
Length=1092

 Score =   273 bits (699),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 173/213 (81%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL+ R+FTGHT +P     +  GK  VG  I G ++IFT+AVTIVVVAVPEGLPLAV
Sbjct  390  VLIVLLARYFTGHTYNPDGTVQYVKGKMGVGQTIGGVVRIFTVAVTIVVVAVPEGLPLAV  449

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLA+SMRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GGK++  
Sbjct  450  TLTLAFSMRKMMKDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYFGGKKMES  509

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQFGVKLGLNFDA  528
            PD+   L   V  L++EGIAQNT+GS+F PEGG  PEV+GSPTEKAIL +G+KLG+ F+ 
Sbjct  510  PDNAQVLSADVTSLIVEGIAQNTSGSIFEPEGGQEPEVTGSPTEKAILSWGLKLGMKFNE  569

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             RS+SSI+H FPFNSEKKRGGVAV L    ++I
Sbjct  570  TRSKSSILHVFPFNSEKKRGGVAVHLGGSEVHI  602



>emb|CDY43534.1| BnaA01g07100D [Brassica napus]
Length=1060

 Score =   272 bits (696),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 169/205 (82%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL++R+FTGHTKD    P F  G TK    +D  +KI T+AVTIVVVAVPEGLPLA
Sbjct  376  VVLFVLVVRYFTGHTKDANGAPQFVGGTTKFDHVLDDLVKIITVAVTIVVVAVPEGLPLA  435

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+ Y G ++++
Sbjct  436  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVECYAGFQKMD  495

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPD  S+LP      L+EGIA NTTGSVF+ E G  +VSGSPTE+AIL + +KLG+NFDA
Sbjct  496  PPDSSSKLPPAFTCKLVEGIAHNTTGSVFLSESGEIQVSGSPTERAILNWAIKLGMNFDA  555

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
            +RSESS IH FPFNSE+KRGGVAVK
Sbjct  556  LRSESSAIHFFPFNSEQKRGGVAVK  580



>gb|KCW77157.1| hypothetical protein EUGRSUZ_D01503 [Eucalyptus grandis]
Length=1052

 Score =   272 bits (695),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 168/206 (82%), Gaps = 10/206 (5%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            RFFTGHTK+P     FKAG+T V +A+DGAIKI  +AVTI+ VAVPEGLPLAVTLTLAYS
Sbjct  389  RFFTGHTKNPDGTVQFKAGQTSVSNAVDGAIKIVIVAVTIMAVAVPEGLPLAVTLTLAYS  448

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            M KM+ADKALVRRLSACE MGSATTIC DKTGTLTLNQ     AY  G+++NPPD  SQL
Sbjct  449  MGKMIADKALVRRLSACEAMGSATTICCDKTGTLTLNQ-----AYACGRKVNPPDSNSQL  503

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               +I LL+EGIAQN+ GSV+VPE GG  EVSGSPTEKAILQ+G+KLG++F+ +RS SSI
Sbjct  504  STSLISLLIEGIAQNSNGSVYVPETGGDVEVSGSPTEKAILQWGIKLGMDFEVVRSRSSI  563

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            I  FPFNS+KKRGGVAVKL +  + I
Sbjct  564  IRVFPFNSDKKRGGVAVKLPNSEVRI  589



>dbj|BAA97361.1| Ca2+-transporting ATPase-like protein [Arabidopsis thaliana]
Length=1099

 Score =   272 bits (695),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 173/222 (78%), Gaps = 26/222 (12%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiav---------------  126
            VL++L+ R+FTGHTKD    P F  GKTKVG  ID  +K+ T+AV               
Sbjct  387  VLVILLTRYFTGHTKDNNGGPQFVKGKTKVGHVIDDVVKVLTVAVCFLVNNLSLIGIRDP  446

Query  127  --tivvvavPEGLPLAVTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTL  300
              TIVVVAVPEGLPLAVTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTL
Sbjct  447  AVTIVVVAVPEGLPLAVTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTL  506

Query  301  NQMTVVDAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPT  477
            NQMTVV++Y GGK+     D  QLP  +  L++EGI+QNTTGS+FVPEGG   E SGSPT
Sbjct  507  NQMTVVESYAGGKKT----DTEQLPATITSLVVEGISQNTTGSIFVPEGGGDLEYSGSPT  562

Query  478  EKAILQFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK  603
            EKAIL +GVKLG+NF+  RS+SSI+HAFPFNSEKKRGGVAVK
Sbjct  563  EKAILGWGVKLGMNFETARSQSSILHAFPFNSEKKRGGVAVK  604



>ref|XP_010433051.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Camelina sativa]
Length=1067

 Score =   271 bits (694),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 173/213 (81%), Gaps = 4/213 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL++R+FTGHTK+    P F  GKTK    +D  ++IFT+AVTIVVVAVPEGLPLA
Sbjct  384  VVLFVLVVRYFTGHTKNEQGGPQFIGGKTKFDHVLDDLVEIFTVAVTIVVVAVPEGLPLA  443

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+ Y G ++++
Sbjct  444  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVECYAGFQKMD  503

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPD  ++LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL + +KLG++FDA
Sbjct  504  PPDSSAKLPSAFTSILVEGIAHNTTGSVFRSESGEIQVSGSPTERAILNWAIKLGMDFDA  563

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            ++SESS +  +PFNSEKKRGGVAVK     +++
Sbjct  564  LKSESSAVQFYPFNSEKKRGGVAVKSSDSSVHV  596



>gb|KGN45423.1| Autoinhibited calcium ATPase [Cucumis sativus]
Length=1089

 Score =   271 bits (693),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 170/205 (83%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+ R+FTG+T D    P F+ G T +GDA++G IKI T+AVTIVVVAVPEGLPLAV
Sbjct  403  VLAVLLGRYFTGNTHDANGNPQFQRGHTSLGDAVNGVIKIVTVAVTIVVVAVPEGLPLAV  462

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+  +G K INP
Sbjct  463  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEVCVGRKMINP  522

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PDD  QL   V+ LL EG+AQN+TG+VFV  +GG  EVSGSPTEKAIL + VKLG+ FD 
Sbjct  523  PDDPLQLNSSVLSLLHEGVAQNSTGNVFVAKDGGGIEVSGSPTEKAILSWAVKLGMKFDD  582

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
            I+SES ++H  PFNSEKKRGGVA+K
Sbjct  583  IKSESKVLHVVPFNSEKKRGGVAIK  607



>ref|XP_004159010.1| PREDICTED: LOW QUALITY PROTEIN: calcium-transporting ATPase 9, 
plasma membrane-type-like [Cucumis sativus]
Length=1089

 Score =   271 bits (693),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 170/205 (83%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+ R+FTG+T D    P F+ G T +GDA++G IKI T+AVTIVVVAVPEGLPLAV
Sbjct  403  VLAVLLGRYFTGNTHDANGNPQFQRGHTSLGDAVNGVIKIVTVAVTIVVVAVPEGLPLAV  462

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+  +G K INP
Sbjct  463  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEVCVGRKMINP  522

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PDD  QL   V+ LL EG+AQN+TG+VFV  +GG  EVSGSPTEKAIL + VKLG+ FD 
Sbjct  523  PDDPLQLNSSVLSLLHEGVAQNSTGNVFVAKDGGGIEVSGSPTEKAILSWAVKLGMKFDD  582

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
            I+SES ++H  PFNSEKKRGGVA+K
Sbjct  583  IKSESKVLHVVPFNSEKKRGGVAIK  607



>ref|XP_004141743.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Cucumis sativus]
Length=1089

 Score =   271 bits (693),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 170/205 (83%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+ R+FTG+T D    P F+ G T +GDA++G IKI T+AVTIVVVAVPEGLPLAV
Sbjct  403  VLAVLLGRYFTGNTHDANGNPQFQRGHTSLGDAVNGVIKIVTVAVTIVVVAVPEGLPLAV  462

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+  +G K INP
Sbjct  463  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEVCVGRKMINP  522

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PDD  QL   V+ LL EG+AQN+TG+VFV  +GG  EVSGSPTEKAIL + VKLG+ FD 
Sbjct  523  PDDPLQLNSSVLSLLHEGVAQNSTGNVFVAKDGGGIEVSGSPTEKAILSWAVKLGMKFDD  582

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
            I+SES ++H  PFNSEKKRGGVA+K
Sbjct  583  IKSESKVLHVVPFNSEKKRGGVAIK  607



>ref|XP_009414910.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Musa acuminata subsp. malaccensis]
 ref|XP_009414919.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Musa acuminata subsp. malaccensis]
Length=1095

 Score =   271 bits (693),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 170/205 (83%), Gaps = 4/205 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT +P     F  G+T    AI+GAIKI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  399  RYFTGHTTNPDGSVQFIKGQTGTKTAINGAIKILTVAVTIVVVAVPEGLPLAVTLTLAYS  458

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+GG++I+PPD+   L
Sbjct  459  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGGRKIDPPDNPELL  518

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSII  552
                  LL+EGIAQNTTGSVFV E GV +V+GSPTEKAIL +GVKLG+ FD  RS+SSI+
Sbjct  519  SPTASTLLIEGIAQNTTGSVFVLETGVVDVTGSPTEKAILSWGVKLGMIFDDARSKSSIV  578

Query  553  HAFPFNSEKKRGGVAVKLDSEFIYI  627
            H FPFNS+KKRGGVAV    + I++
Sbjct  579  HVFPFNSDKKRGGVAVYQGGDDIHV  603



>ref|XP_002867382.1| autoinhibited Ca2+-ATPase 10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43641.1| autoinhibited Ca2+-ATPase 10 [Arabidopsis lyrata subsp. lyrata]
Length=1078

 Score =   270 bits (691),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 169/205 (82%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL++R+FTGHTK+    P F  GKTK    +D  ++IFT+AVTIVVVAVPEGLPLA
Sbjct  391  VVLFVLVVRYFTGHTKNEQGGPQFIGGKTKFEHVLDDLVEIFTVAVTIVVVAVPEGLPLA  450

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+ Y G ++++
Sbjct  451  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVECYAGFQKMD  510

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPD  S+LP      L+EGIA NTTGSVF  E G  +VSGSPTE+AIL + +KLG++FDA
Sbjct  511  PPDSSSKLPSAFTSRLVEGIAHNTTGSVFRSETGEIQVSGSPTERAILSWAIKLGMDFDA  570

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
            ++SESS +  FPFNSEKKRGGVAVK
Sbjct  571  LKSESSAVQFFPFNSEKKRGGVAVK  595



>ref|XP_007138755.1| hypothetical protein PHAVU_009G234600g [Phaseolus vulgaris]
 gb|ESW10749.1| hypothetical protein PHAVU_009G234600g [Phaseolus vulgaris]
Length=1082

 Score =   270 bits (691),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 173/207 (84%), Gaps = 9/207 (4%)
 Frame = +1

Query  25   RFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+F+GHT++    P FKAGKTKVGDA+DGAIKI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  403  RYFSGHTENADGSPQFKAGKTKVGDAVDGAIKIVTVAVTIVVVAVPEGLPLAVTLTLAYS  462

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLT+N+MTVV+AY G  +I+PP    +L
Sbjct  463  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTMNEMTVVEAYAGSNKIDPP---HKL  519

Query  373  PQKVI-PLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESS  546
               ++  LL+EGIA NT GSV+ PEG    EVSGSPTEKAIL +G++LG+NF A RSESS
Sbjct  520  ENSMLRSLLIEGIALNTNGSVYAPEGANDVEVSGSPTEKAILHWGIQLGMNFTAARSESS  579

Query  547  IIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IIH FPFNSEKKRGGVA++     I+I
Sbjct  580  IIHVFPFNSEKKRGGVALQTADSNIHI  606



>ref|XP_009385903.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
[Musa acuminata subsp. malaccensis]
Length=1090

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 167/205 (81%), Gaps = 4/205 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+P     F  G+T    AI+G IKI T+AV IVVVAVPEGLPLAVTLTLAYS
Sbjct  402  RYFTGHTKNPDGSVQFIKGQTDTKTAINGVIKILTVAVIIVVVAVPEGLPLAVTLTLAYS  461

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+GG++INPPD+   L
Sbjct  462  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGGRKINPPDNAELL  521

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSII  552
                  LL+EGIAQNTTGSVF  E G  EV+GSPTEKAIL +GVKLG+ F+  RSESSII
Sbjct  522  SSTASSLLIEGIAQNTTGSVFKAETGAFEVTGSPTEKAILSWGVKLGMTFNDARSESSII  581

Query  553  HAFPFNSEKKRGGVAVKLDSEFIYI  627
            H FPFNS+KKRGGVAV    + I++
Sbjct  582  HVFPFNSDKKRGGVAVHQAGDDIHV  606



>emb|CDY46716.1| BnaC07g42210D [Brassica napus]
Length=1073

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 171/213 (80%), Gaps = 4/213 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL++R+FTGHTK     P F  G TK    +D  +KI T+AVTIVVVAVPEGLPLA
Sbjct  389  VVLFVLVVRYFTGHTKGANGAPQFVGGHTKFDHVLDDLVKIITVAVTIVVVAVPEGLPLA  448

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+ Y G ++++
Sbjct  449  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVECYTGFQKMD  508

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPD  S+LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL + +KLG+NFDA
Sbjct  509  PPDSSSKLPPPFTSILVEGIAHNTTGSVFRSESGEVQVSGSPTERAILNWAIKLGMNFDA  568

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RSESS +H FPFNSE+KRGGVAVK     +++
Sbjct  569  LRSESSAVHFFPFNSEQKRGGVAVKSPDSTVHV  601



>ref|XP_010034879.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Eucalyptus grandis]
Length=1036

 Score =   270 bits (689),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 173/213 (81%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+ L++R+FTGHT+D +    F  G+T +   +D  IKI TIAVTI VVAVPEGLPLAV
Sbjct  341  VLVTLVVRYFTGHTEDAYGKVQFIKGRTSISHVVDDIIKIVTIAVTITVVAVPEGLPLAV  400

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMT V+AY G K+++P
Sbjct  401  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTAVEAYAGRKKLDP  460

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            P+D S+L + V  LL EG+AQNT G+VFVP+GG   E+SGSPTEKAIL + VKLG+ FD 
Sbjct  461  PNDSSKLHEVVTSLLHEGVAQNTQGNVFVPKGGEDVEISGSPTEKAILLWAVKLGMKFDV  520

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             RSES+++H  PFNS KKRGGVA+K ++  ++I
Sbjct  521  SRSESTVLHVVPFNSHKKRGGVAIKRNNSEVFI  553



>ref|XP_010483208.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Camelina sativa]
Length=1074

 Score =   270 bits (690),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 175/205 (85%), Gaps = 9/205 (4%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L+ R+FTGHTKD    P F  GKTK+G  +D  +K+ T+AVTIVVVAVPEGLPLAV
Sbjct  387  VLVILLTRYFTGHTKDVGGGPQFIKGKTKIGHVVDDVVKVVTVAVTIVVVAVPEGLPLAV  446

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV++Y GGK+   
Sbjct  447  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVESYAGGKKT--  504

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
              D +QLP  +  L++EGI+QNTTGS+FVPEGG   E+SGSPTEKAIL +G+KLG+NF+ 
Sbjct  505  --DTAQLPPTITSLVVEGISQNTTGSIFVPEGGGELELSGSPTEKAILGWGIKLGMNFET  562

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
             RS+SSI+HAFPFNSEKKRGGVAVK
Sbjct  563  TRSQSSILHAFPFNSEKKRGGVAVK  587



>ref|XP_004976721.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Setaria italica]
Length=1093

 Score =   270 bits (690),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 172/214 (80%), Gaps = 6/214 (3%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL+ R+FTGHT +P     +  GK  VG  I G ++IFT+AVTIVVVAVPEGLPLAV
Sbjct  390  VLIVLLARYFTGHTYNPDGTVQYVKGKMGVGQTIGGVVRIFTVAVTIVVVAVPEGLPLAV  449

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLA+SMRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GGK++  
Sbjct  450  TLTLAFSMRKMMKDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYFGGKKMES  509

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE--GGVPEVSGSPTEKAILQFGVKLGLNFD  525
            PD+   L   V  L++EGIAQNT+GS+F PE  G  PEV+GSPTEKAIL +G+KLG+ F+
Sbjct  510  PDNAQVLSADVTSLIVEGIAQNTSGSIFEPEQGGQEPEVTGSPTEKAILSWGLKLGMKFN  569

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
              RS+SSI+H FPFNSEKKRGGVAV L    ++I
Sbjct  570  ETRSKSSILHVFPFNSEKKRGGVAVHLGGSEVHI  603



>ref|NP_194719.1| calcium-transporting ATPase 10 [Arabidopsis thaliana]
 sp|Q9SZR1.2|ACA10_ARATH RecName: Full=Calcium-transporting ATPase 10, plasma membrane-type; 
AltName: Full=Ca(2+)-ATPase isoform 10 [Arabidopsis thaliana]
 emb|CAB79748.1| Ca2+-transporting ATPase-like protein [Arabidopsis thaliana]
 gb|AEE85690.1| calcium-transporting ATPase 10 [Arabidopsis thaliana]
Length=1069

 Score =   270 bits (689),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 172/213 (81%), Gaps = 4/213 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL++R+FTGHTK+    P F  GKTK    +D  ++IFT+AVTIVVVAVPEGLPLA
Sbjct  386  VVLFVLVVRYFTGHTKNEQGGPQFIGGKTKFEHVLDDLVEIFTVAVTIVVVAVPEGLPLA  445

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+ Y G ++++
Sbjct  446  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVECYAGLQKMD  505

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
             PD  S+LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL + +KLG++FDA
Sbjct  506  SPDSSSKLPSAFTSILVEGIAHNTTGSVFRSESGEIQVSGSPTERAILNWAIKLGMDFDA  565

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            ++SESS +  FPFNSEKKRGGVAVK     ++I
Sbjct  566  LKSESSAVQFFPFNSEKKRGGVAVKSPDSSVHI  598



>gb|KHG22770.1| Calcium-transporting ATPase 9, plasma membrane-type [Gossypium 
arboreum]
Length=1109

 Score =   270 bits (689),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 175/213 (82%), Gaps = 11/213 (5%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL +L+ R+FTG+T+DP     F  G+TK  DA +  +KIFTIAVTIVVVAVPEGLPLAV
Sbjct  397  VLAILLARYFTGNTEDPDGATQFIKGRTKFDDAFNDVVKIFTIAVTIVVVAVPEGLPLAV  456

Query  172  TLTLAYSMRKMMADKAL------VRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIG  333
            TLTLAYSMRKMMADKAL      VRRLSACETMGSATTICSDKTGTLTLN+MTVV+A++G
Sbjct  457  TLTLAYSMRKMMADKALANTDTQVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAFVG  516

Query  334  GKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKL  510
             K+INPP D SQL   V+ LL EG+AQ+T G+VFV  +GG  E+SGSPTEKAIL + ++L
Sbjct  517  KKKINPPADSSQLHLSVVSLLSEGVAQSTMGNVFVSKDGGDVEISGSPTEKAILSWAIEL  576

Query  511  GLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLD  609
            G+ FDAIRSES+I+H FPFNSEKKRGGVA++ D
Sbjct  577  GMKFDAIRSESTILHVFPFNSEKKRGGVALRRD  609



>ref|XP_010041252.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like, 
partial [Eucalyptus grandis]
Length=798

 Score =   266 bits (680),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 176/213 (83%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L++R+FTG+T+D +    F  G+T +   +D  IKI TIAVTIVVVAVPEGLPLAV
Sbjct  298  VLVILVVRYFTGNTEDANGNVQFIKGRTSISHVVDDIIKIVTIAVTIVVVAVPEGLPLAV  357

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY G K+++P
Sbjct  358  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGQKKLDP  417

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            P+D S+L + V  LL EGIAQNT G+VFVP+GG   E+SGSPTEKAIL + VKLG+ FD 
Sbjct  418  PNDSSKLHEVVTSLLHEGIAQNTQGNVFVPKGGEDVEISGSPTEKAILSWAVKLGMKFDV  477

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             RSES+++H  PFNS KKRGGVA+K ++  ++I
Sbjct  478  SRSESTVLHVVPFNSCKKRGGVAIKRNNSEVFI  510



>tpg|DAA48121.1| TPA: hypothetical protein ZEAMMB73_416489 [Zea mays]
Length=1143

 Score =   270 bits (689),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 173/207 (84%), Gaps = 5/207 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL IR+FTGHT++P     F AG T V     GAI+I TIAVTIVVVAVPEGLPLAV
Sbjct  453  VLVVLWIRYFTGHTENPDGTPQFVAGTTGVKQGFMGAIRILTIAVTIVVVAVPEGLPLAV  512

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSM+KMM DKALVRRLS+CETMGSATTICSDKTGTLTLN+MTVV+AY  G +++P
Sbjct  513  TLTLAYSMKKMMRDKALVRRLSSCETMGSATTICSDKTGTLTLNKMTVVEAYFAGTKLDP  572

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
             DD SQ+      L++EGIAQNTTG+VF+PE GG  E++GSPTEKAIL +G+K+G++FD 
Sbjct  573  CDDVSQMSDSAASLIIEGIAQNTTGTVFLPEDGGAAELTGSPTEKAILSWGLKIGMDFDD  632

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLD  609
            +R++SS+IH FPFNSEKKRG VAV+LD
Sbjct  633  VRTKSSVIHVFPFNSEKKRGAVAVQLD  659



>ref|XP_010541090.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Tarenaya hassleriana]
 ref|XP_010541091.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Tarenaya hassleriana]
 ref|XP_010541092.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Tarenaya hassleriana]
 ref|XP_010541094.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Tarenaya hassleriana]
Length=1071

 Score =   269 bits (688),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 169/205 (82%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHT----KDPHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL++R+FTGHT    K P F  GKTK    ++  +KI T+AVTIVVVAVPEGLPLA
Sbjct  386  VVLFVLVVRYFTGHTENADKTPQFIKGKTKFDHVVNDMVKIITVAVTIVVVAVPEGLPLA  445

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+AY G ++++
Sbjct  446  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAYTGFQKMD  505

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPD  ++LP     LL+EGIA NT+GSVF  + G  EVSGSPTE+AIL + +KLG+NFDA
Sbjct  506  PPDSHAKLPPTFTSLLVEGIAHNTSGSVFQSDHGETEVSGSPTERAILNWAIKLGMNFDA  565

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
            IRS+SS I  FPFNSEKKRGGVAVK
Sbjct  566  IRSDSSAIQFFPFNSEKKRGGVAVK  590



>gb|KHG22771.1| Calcium-transporting ATPase 9, plasma membrane-type [Gossypium 
arboreum]
Length=1140

 Score =   269 bits (688),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 175/213 (82%), Gaps = 11/213 (5%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL +L+ R+FTG+T+DP     F  G+TK  DA +  +KIFTIAVTIVVVAVPEGLPLAV
Sbjct  428  VLAILLARYFTGNTEDPDGATQFIKGRTKFDDAFNDVVKIFTIAVTIVVVAVPEGLPLAV  487

Query  172  TLTLAYSMRKMMADKAL------VRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIG  333
            TLTLAYSMRKMMADKAL      VRRLSACETMGSATTICSDKTGTLTLN+MTVV+A++G
Sbjct  488  TLTLAYSMRKMMADKALANTDTQVRRLSACETMGSATTICSDKTGTLTLNEMTVVEAFVG  547

Query  334  GKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKL  510
             K+INPP D SQL   V+ LL EG+AQ+T G+VFV  +GG  E+SGSPTEKAIL + ++L
Sbjct  548  KKKINPPADSSQLHLSVVSLLSEGVAQSTMGNVFVSKDGGDVEISGSPTEKAILSWAIEL  607

Query  511  GLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLD  609
            G+ FDAIRSES+I+H FPFNSEKKRGGVA++ D
Sbjct  608  GMKFDAIRSESTILHVFPFNSEKKRGGVALRRD  640



>ref|XP_002514375.1| cation-transporting atpase plant, putative [Ricinus communis]
 gb|EEF47971.1| cation-transporting atpase plant, putative [Ricinus communis]
Length=1017

 Score =   268 bits (686),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 150/217 (69%), Positives = 177/217 (82%), Gaps = 9/217 (4%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTK----DPHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+ R+FTG+T+    D  F  G+TK+ +AIDG IKI TIAVTIVVVAVPEGLPLAV
Sbjct  352  VLAVLLGRYFTGNTRNSNGDVQFVKGETKISEAIDGVIKIVTIAVTIVVVAVPEGLPLAV  411

Query  172  TLTLAYSMRKMMADKAL----VRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGK  339
            TLTLAYSMRKMMADKAL    VRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K
Sbjct  412  TLTLAYSMRKMMADKALANLQVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGKK  471

Query  340  RINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGL  516
            ++ P DD +QL  +V  LL EG+AQN+TGSVFVP +GG  E+SGSPTEKAIL + VKLG+
Sbjct  472  KMIPADDSAQLHSEVSSLLCEGVAQNSTGSVFVPKDGGDVEISGSPTEKAILSWAVKLGM  531

Query  517  NFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             FD+IRS+S ++  FPFNSEKKRGGVA++     ++I
Sbjct  532  KFDSIRSQSKVLQVFPFNSEKKRGGVAIQRTDSKVHI  568



>tpg|DAA36133.1| TPA: hypothetical protein ZEAMMB73_748084 [Zea mays]
Length=997

 Score =   268 bits (686),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 168/206 (82%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT +P     +  GK  VG  I G ++IFT+AVTIVVVAVPEGLPLAVTLTLA+S
Sbjct  392  RYFTGHTYNPDGSVQYVKGKMGVGQTIRGVVRIFTVAVTIVVVAVPEGLPLAVTLTLAFS  451

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GGK+++ PD+   L
Sbjct  452  MRKMMKDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYFGGKKMDSPDNAQML  511

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               V  L++EGIAQNT+GS+F PEGG  PEV+GSPTEKAIL +G+KLG+ F+  R +SSI
Sbjct  512  SADVTSLIVEGIAQNTSGSIFEPEGGQEPEVTGSPTEKAILSWGLKLGMKFNETRLKSSI  571

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVAV LD   ++I
Sbjct  572  LHVFPFNSEKKRGGVAVHLDGPEVHI  597



>ref|XP_006285159.1| hypothetical protein CARUB_v10006503mg [Capsella rubella]
 gb|EOA18057.1| hypothetical protein CARUB_v10006503mg [Capsella rubella]
Length=1070

 Score =   269 bits (687),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 169/205 (82%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL++R+FTGHTK+    P F  GKTK    +D  ++IFT+AVTIVVVAVPEGLPLA
Sbjct  386  VVLFVLVVRYFTGHTKNEKGAPQFIGGKTKFDHVLDDLVEIFTVAVTIVVVAVPEGLPLA  445

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+ Y G ++++
Sbjct  446  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVECYTGFQKMD  505

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
             PD  ++LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL + +KLG++FDA
Sbjct  506  TPDSSAKLPSAFTSILVEGIAHNTTGSVFRSESGEIQVSGSPTERAILNWAIKLGMDFDA  565

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
            ++SESS +  FPFNSEKKRGGVAVK
Sbjct  566  LKSESSAVQFFPFNSEKKRGGVAVK  590



>gb|EPS66913.1| hypothetical protein M569_07863, partial [Genlisea aurea]
Length=1071

 Score =   268 bits (686),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 168/199 (84%), Gaps = 5/199 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R FTGHTK+      F AG T VG AI+  IKIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  404  RLFTGHTKNADGSVQFVAGHTSVGTAINAFIKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  463

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            M+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ +   +++  PD+KS  
Sbjct  464  MKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEVHACVQKVPQPDNKSMF  523

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P ++   L+EGIA+NTTGSVFVPE GG  E+SGSPTEKAILQ+GV LG++F+A +SES I
Sbjct  524  PPRLHSFLVEGIAKNTTGSVFVPEGGGAHEISGSPTEKAILQWGVNLGMDFNAAQSESMI  583

Query  550  IHAFPFNSEKKRGGVAVKL  606
            IHAFPFNSEKKRGGVA+KL
Sbjct  584  IHAFPFNSEKKRGGVALKL  602



>ref|XP_010447798.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X2 [Camelina sativa]
Length=1067

 Score =   268 bits (686),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 172/213 (81%), Gaps = 4/213 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL++R+FTGHTK+    P F  GKTK    +D  ++IFT+AVTIVVVAVPEGLPLA
Sbjct  384  VVLFVLVVRYFTGHTKNEQGGPQFVGGKTKFDHVLDDLVEIFTVAVTIVVVAVPEGLPLA  443

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+ Y G ++++
Sbjct  444  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVECYAGFQKMD  503

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPD  ++LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL + +KLG++FDA
Sbjct  504  PPDSSAKLPSAFTSILVEGIAHNTTGSVFRSESGEIQVSGSPTERAILNWAIKLGMDFDA  563

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            ++S SS +  +PFNSEKKRGGVAVK     +++
Sbjct  564  LKSGSSAVQFYPFNSEKKRGGVAVKSSDSSVHV  596



>emb|CDY30184.1| BnaA03g49860D [Brassica napus]
Length=1062

 Score =   268 bits (686),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 171/213 (80%), Gaps = 4/213 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL++R+FTGHTK     P F  G TK    +D  +KI T+AVTIVVVAVPEGLPLA
Sbjct  378  VVLFVLVVRYFTGHTKGANGAPQFVGGHTKFDHVLDDLVKIITVAVTIVVVAVPEGLPLA  437

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+ Y G ++++
Sbjct  438  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVECYTGFQKMD  497

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPD  S+LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL + +KLG++FDA
Sbjct  498  PPDSSSKLPPPFTSILVEGIAHNTTGSVFRSESGEVQVSGSPTERAILNWAIKLGMDFDA  557

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RSESS +H FPFNSE+KRGGVAVK     +++
Sbjct  558  LRSESSAVHFFPFNSEQKRGGVAVKSPDSTVHV  590



>tpg|DAA36132.1| TPA: hypothetical protein ZEAMMB73_748084 [Zea mays]
Length=1036

 Score =   268 bits (685),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 168/206 (82%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT +P     +  GK  VG  I G ++IFT+AVTIVVVAVPEGLPLAVTLTLA+S
Sbjct  392  RYFTGHTYNPDGSVQYVKGKMGVGQTIRGVVRIFTVAVTIVVVAVPEGLPLAVTLTLAFS  451

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GGK+++ PD+   L
Sbjct  452  MRKMMKDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYFGGKKMDSPDNAQML  511

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               V  L++EGIAQNT+GS+F PEGG  PEV+GSPTEKAIL +G+KLG+ F+  R +SSI
Sbjct  512  SADVTSLIVEGIAQNTSGSIFEPEGGQEPEVTGSPTEKAILSWGLKLGMKFNETRLKSSI  571

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVAV LD   ++I
Sbjct  572  LHVFPFNSEKKRGGVAVHLDGPEVHI  597



>ref|XP_008462221.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X2 [Cucumis melo]
Length=994

 Score =   268 bits (684),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 169/205 (82%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+ R+FTG T D    P F+ G T +GDA++G IKI T+AVTIVVVAVPEGLPLAV
Sbjct  308  VLAVLLGRYFTGTTHDANGNPQFRHGHTSLGDAVNGVIKIVTVAVTIVVVAVPEGLPLAV  367

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+A +G K INP
Sbjct  368  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEACVGRKMINP  427

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PDD  QL   V+ LL EG+A N+TG+VFV  +GG  EVSGSPTEKAIL + VKLG+ FD 
Sbjct  428  PDDPLQLNSLVLTLLHEGVALNSTGNVFVAKDGGGIEVSGSPTEKAILSWAVKLGMKFDD  487

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
            I+SES ++H  PFNSEKKRGGVA+K
Sbjct  488  IKSESKVLHVVPFNSEKKRGGVAIK  512



>gb|AFW59361.1| hypothetical protein ZEAMMB73_703991 [Zea mays]
Length=834

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 166/206 (81%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT +P     +  G   VG  I G +KIFT+AVTIVVVAVPEGLPLAVTLTLA+S
Sbjct  396  RYFTGHTYNPDGSVQYVKGNMGVGQTIRGIVKIFTVAVTIVVVAVPEGLPLAVTLTLAFS  455

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GGK+++ PD+   L
Sbjct  456  MRKMMKDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYFGGKKMDSPDNAQML  515

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               V  L++EGIAQNT+GS+F PEGG  PEV+GSPTEKAIL +G+KLG+ F   RS+SSI
Sbjct  516  SADVTSLIVEGIAQNTSGSIFEPEGGQEPEVTGSPTEKAILSWGLKLGMKFSETRSKSSI  575

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVAV L    ++I
Sbjct  576  LHVFPFNSEKKRGGVAVYLAGSEVHI  601



>ref|XP_009137874.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Brassica rapa]
 ref|XP_009137875.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Brassica rapa]
Length=1073

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 171/213 (80%), Gaps = 4/213 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL++R+FTGHTK     P F  G TK    +D  +KI T+AVTIVVVAVPEGLPLA
Sbjct  390  VVLFVLVVRYFTGHTKGANGAPQFVGGHTKFDHVLDDLVKIITVAVTIVVVAVPEGLPLA  449

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+ Y G ++++
Sbjct  450  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVECYTGFQKMD  509

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPD  S+LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL + +KLG++FDA
Sbjct  510  PPDSSSKLPPPFTSILVEGIAHNTTGSVFRSESGEVQVSGSPTERAILNWAIKLGMDFDA  569

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RSESS +H FPFNSE+KRGGVAVK     +++
Sbjct  570  LRSESSAVHFFPFNSEQKRGGVAVKSPDSTVHV  602



>ref|XP_008462219.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X1 [Cucumis melo]
Length=1089

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 169/205 (82%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL VL+ R+FTG T D    P F+ G T +GDA++G IKI T+AVTIVVVAVPEGLPLAV
Sbjct  403  VLAVLLGRYFTGTTHDANGNPQFRHGHTSLGDAVNGVIKIVTVAVTIVVVAVPEGLPLAV  462

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+A +G K INP
Sbjct  463  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEACVGRKMINP  522

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PDD  QL   V+ LL EG+A N+TG+VFV  +GG  EVSGSPTEKAIL + VKLG+ FD 
Sbjct  523  PDDPLQLNSLVLTLLHEGVALNSTGNVFVAKDGGGIEVSGSPTEKAILSWAVKLGMKFDD  582

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
            I+SES ++H  PFNSEKKRGGVA+K
Sbjct  583  IKSESKVLHVVPFNSEKKRGGVAIK  607



>ref|XP_010447795.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Camelina sativa]
 ref|XP_010447796.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Camelina sativa]
 ref|XP_010447797.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Camelina sativa]
Length=1074

 Score =   268 bits (684),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 169/205 (82%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL++R+FTGHTK+    P F  GKTK    +D  ++IFT+AVTIVVVAVPEGLPLA
Sbjct  384  VVLFVLVVRYFTGHTKNEQGGPQFVGGKTKFDHVLDDLVEIFTVAVTIVVVAVPEGLPLA  443

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+ Y G ++++
Sbjct  444  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVECYAGFQKMD  503

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPD  ++LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL + +KLG++FDA
Sbjct  504  PPDSSAKLPSAFTSILVEGIAHNTTGSVFRSESGEIQVSGSPTERAILNWAIKLGMDFDA  563

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
            ++S SS +  +PFNSEKKRGGVAVK
Sbjct  564  LKSGSSAVQFYPFNSEKKRGGVAVK  588



>ref|XP_010447799.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X3 [Camelina sativa]
Length=1057

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 169/205 (82%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL++R+FTGHTK+    P F  GKTK    +D  ++IFT+AVTIVVVAVPEGLPLA
Sbjct  384  VVLFVLVVRYFTGHTKNEQGGPQFVGGKTKFDHVLDDLVEIFTVAVTIVVVAVPEGLPLA  443

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+ Y G ++++
Sbjct  444  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVECYAGFQKMD  503

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPD  ++LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL + +KLG++FDA
Sbjct  504  PPDSSAKLPSAFTSILVEGIAHNTTGSVFRSESGEIQVSGSPTERAILNWAIKLGMDFDA  563

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
            ++S SS +  +PFNSEKKRGGVAVK
Sbjct  564  LKSGSSAVQFYPFNSEKKRGGVAVK  588



>gb|AES65356.2| calcium-transporting ATPase 8, plasma membrane-type protein [Medicago 
truncatula]
Length=1009

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 171/206 (83%), Gaps = 6/206 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+F+GHT++      F AGKTK G AIDGAIKI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  412  RYFSGHTRNSDGTKQFIAGKTKAGHAIDGAIKIITVAVTIVVVAVPEGLPLAVTLTLAYS  471

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLT+NQMTVV+ Y GG +++PP +  + 
Sbjct  472  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTMNQMTVVEVYAGGSKVDPPHELERS  531

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P K+  LL+EG+AQNT GSV+VPEG    EVSGSPTEKAIL +G+++G+NF   RSESSI
Sbjct  532  P-KLRTLLIEGVAQNTNGSVYVPEGANDIEVSGSPTEKAILNWGLQVGMNFVTARSESSI  590

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVA++     ++I
Sbjct  591  LHVFPFNSEKKRGGVAIQTADSDVHI  616



>ref|XP_008668924.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Zea mays]
 ref|XP_008668925.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Zea mays]
 tpg|DAA36130.1| TPA: hypothetical protein ZEAMMB73_748084 [Zea mays]
 tpg|DAA36131.1| TPA: hypothetical protein ZEAMMB73_748084 [Zea mays]
Length=1085

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 168/206 (82%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT +P     +  GK  VG  I G ++IFT+AVTIVVVAVPEGLPLAVTLTLA+S
Sbjct  392  RYFTGHTYNPDGSVQYVKGKMGVGQTIRGVVRIFTVAVTIVVVAVPEGLPLAVTLTLAFS  451

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GGK+++ PD+   L
Sbjct  452  MRKMMKDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYFGGKKMDSPDNAQML  511

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               V  L++EGIAQNT+GS+F PEGG  PEV+GSPTEKAIL +G+KLG+ F+  R +SSI
Sbjct  512  SADVTSLIVEGIAQNTSGSIFEPEGGQEPEVTGSPTEKAILSWGLKLGMKFNETRLKSSI  571

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVAV LD   ++I
Sbjct  572  LHVFPFNSEKKRGGVAVHLDGPEVHI  597



>ref|XP_002445842.1| hypothetical protein SORBIDRAFT_07g026810 [Sorghum bicolor]
 gb|EES15337.1| hypothetical protein SORBIDRAFT_07g026810 [Sorghum bicolor]
Length=1087

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 172/207 (83%), Gaps = 5/207 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL IR+FTGHT++P     F AG T V     GAI+I TIAVTIVVVAVPEGLPLAV
Sbjct  397  VLVVLWIRYFTGHTENPDGTTQFVAGTTGVKQGFMGAIRILTIAVTIVVVAVPEGLPLAV  456

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSM+KMM DKALVRRLS+CETMGSATTICSDKTGTLTLN+MTVV+AY  G +++P
Sbjct  457  TLTLAYSMKKMMRDKALVRRLSSCETMGSATTICSDKTGTLTLNKMTVVEAYFAGTKLDP  516

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
             DD SQ+    + L++EGIAQNTTG+VF+PE GG  E+SGSPTEKAIL +G+K+G++F  
Sbjct  517  CDDVSQMTDSAVSLIIEGIAQNTTGTVFLPEDGGTAELSGSPTEKAILSWGLKIGMDFHD  576

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLD  609
            +R++SS+IH FPFNSEKKRG VAV+ D
Sbjct  577  VRTKSSVIHVFPFNSEKKRGAVAVQSD  603



>ref|XP_009385965.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009385966.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=1078

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 168/205 (82%), Gaps = 4/205 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+P     F  G+T    A++GAIKI TIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  392  RYFTGHTKNPDGSAQFIKGQTSAKAAVNGAIKILTIAVTIVVVAVPEGLPLAVTLTLAYS  451

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AYIGGK+I+PPD+   +
Sbjct  452  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYIGGKKIDPPDNVRLI  511

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSII  552
               V  LL EGIAQNTTGSVF PE G  E+SGSPTEKAIL +G KL + FD  +S+SSII
Sbjct  512  SSSVSSLLYEGIAQNTTGSVFKPESGALELSGSPTEKAILHWGFKLEMEFDYAKSKSSII  571

Query  553  HAFPFNSEKKRGGVAVKLDSEFIYI  627
            + FPFNSEKKRGGVAV L    +++
Sbjct  572  YVFPFNSEKKRGGVAVHLSGSEVHV  596



>ref|XP_009385964.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=1103

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 168/205 (82%), Gaps = 4/205 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+P     F  G+T    A++GAIKI TIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  417  RYFTGHTKNPDGSAQFIKGQTSAKAAVNGAIKILTIAVTIVVVAVPEGLPLAVTLTLAYS  476

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AYIGGK+I+PPD+   +
Sbjct  477  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYIGGKKIDPPDNVRLI  536

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSII  552
               V  LL EGIAQNTTGSVF PE G  E+SGSPTEKAIL +G KL + FD  +S+SSII
Sbjct  537  SSSVSSLLYEGIAQNTTGSVFKPESGALELSGSPTEKAILHWGFKLEMEFDYAKSKSSII  596

Query  553  HAFPFNSEKKRGGVAVKLDSEFIYI  627
            + FPFNSEKKRGGVAV L    +++
Sbjct  597  YVFPFNSEKKRGGVAVHLSGSEVHV  621



>gb|EYU21222.1| hypothetical protein MIMGU_mgv1a000501mg [Erythranthe guttata]
Length=1112

 Score =   266 bits (681),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 171/204 (84%), Gaps = 4/204 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L+IRFFTG +K+P     F  G+T V + +DG I I T AVTIVVVAVPEGLPLAV
Sbjct  422  VLIILLIRFFTGTSKNPDGSVQFVHGETSVSEIVDGVIHIITAAVTIVVVAVPEGLPLAV  481

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G ++++P
Sbjct  482  TLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGKQKMDP  541

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDAI  531
            P+D +QL   +  LL EG+AQNT+GSVF+ + G  EVSGSPTEKA+LQ+GVKLG+ FD +
Sbjct  542  PEDGAQLHATISSLLDEGLAQNTSGSVFLSKEGAMEVSGSPTEKAVLQWGVKLGMKFDVV  601

Query  532  RSESSIIHAFPFNSEKKRGGVAVK  603
            +SES ++H  PFNS KKRGGVAV+
Sbjct  602  KSESIVLHVSPFNSTKKRGGVAVR  625



>gb|AES65357.2| calcium-transporting ATPase 8, plasma membrane-type protein [Medicago 
truncatula]
Length=1093

 Score =   266 bits (681),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 171/206 (83%), Gaps = 6/206 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+F+GHT++      F AGKTK G AIDGAIKI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  412  RYFSGHTRNSDGTKQFIAGKTKAGHAIDGAIKIITVAVTIVVVAVPEGLPLAVTLTLAYS  471

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLT+NQMTVV+ Y GG +++PP +  + 
Sbjct  472  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTMNQMTVVEVYAGGSKVDPPHELERS  531

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P K+  LL+EG+AQNT GSV+VPEG    EVSGSPTEKAIL +G+++G+NF   RSESSI
Sbjct  532  P-KLRTLLIEGVAQNTNGSVYVPEGANDIEVSGSPTEKAILNWGLQVGMNFVTARSESSI  590

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVA++     ++I
Sbjct  591  LHVFPFNSEKKRGGVAIQTADSDVHI  616



>emb|CBI17890.3| unnamed protein product [Vitis vinifera]
Length=1080

 Score =   266 bits (679),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 171/206 (83%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+      F  G+T VGDA+DGAIKI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  399  RYFTGHTKNSDGSKQFIPGRTGVGDAVDGAIKIVTVAVTIVVVAVPEGLPLAVTLTLAYS  458

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGS+TTICSDKTGTLTLNQMTVV AY GGK+I+ PD  S  
Sbjct  459  MRKMMVDKALVRRLSACETMGSSTTICSDKTGTLTLNQMTVVVAYAGGKKIDTPDRGSLS  518

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               +  LL+EGIAQNT GSVF+PEGG   EVSGSPTEKAIL +G+K+G+NF+A+RS SSI
Sbjct  519  SSLLSSLLIEGIAQNTNGSVFIPEGGGDVEVSGSPTEKAILNWGIKIGMNFEAVRSGSSI  578

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            I  FPFNSEKKRGGVA+KL    +++
Sbjct  579  IQVFPFNSEKKRGGVAIKLPDSQVHL  604



>ref|XP_002262829.2| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Vitis vinifera]
 ref|XP_010656879.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Vitis vinifera]
Length=1078

 Score =   266 bits (679),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 171/206 (83%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+      F  G+T VGDA+DGAIKI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  399  RYFTGHTKNSDGSKQFIPGRTGVGDAVDGAIKIVTVAVTIVVVAVPEGLPLAVTLTLAYS  458

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGS+TTICSDKTGTLTLNQMTVV AY GGK+I+ PD  S  
Sbjct  459  MRKMMVDKALVRRLSACETMGSSTTICSDKTGTLTLNQMTVVVAYAGGKKIDTPDRGSLS  518

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               +  LL+EGIAQNT GSVF+PEGG   EVSGSPTEKAIL +G+K+G+NF+A+RS SSI
Sbjct  519  SSLLSSLLIEGIAQNTNGSVFIPEGGGDVEVSGSPTEKAILNWGIKIGMNFEAVRSGSSI  578

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            I  FPFNSEKKRGGVA+KL    +++
Sbjct  579  IQVFPFNSEKKRGGVAIKLPDSQVHL  604



>ref|XP_009395465.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Musa acuminata subsp. malaccensis]
Length=1082

 Score =   266 bits (679),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 170/197 (86%), Gaps = 6/197 (3%)
 Frame = +1

Query  25   RFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+P+    F  G+T V  A++GAIKIFT+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  395  RYFTGHTKNPNGSVQFAKGQTNVKAAVNGAIKIFTVAVTIVVVAVPEGLPLAVTLTLAYS  454

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AYIGG++IN  ++  +L
Sbjct  455  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYIGGRKINHLEN-VEL  513

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
                  LL+EGIA NT+GSVF PE GGV EV+GSPTEKAIL +G+KLG+ FD+ RS++SI
Sbjct  514  SPITASLLIEGIAHNTSGSVFEPEDGGVIEVTGSPTEKAILLWGLKLGMKFDSERSKTSI  573

Query  550  IHAFPFNSEKKRGGVAV  600
            +H FPFNSEKKRGGVAV
Sbjct  574  LHVFPFNSEKKRGGVAV  590



>gb|EEC83883.1| hypothetical protein OsI_29887 [Oryza sativa Indica Group]
Length=1067

 Score =   266 bits (679),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 169/208 (81%), Gaps = 5/208 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL IR+FTGHTKDP     F AG T+      GAI+I TIAVTIVVVAVPEGLPLAV
Sbjct  390  VLVVLWIRYFTGHTKDPDGTTQFVAGTTRAKKGFMGAIRILTIAVTIVVVAVPEGLPLAV  449

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMM DKALVRRLS+CETMGSATTICSDKTGTLTLN+MTVV AY GG  ++P
Sbjct  450  TLTLAYSMRKMMRDKALVRRLSSCETMGSATTICSDKTGTLTLNKMTVVQAYFGGTMLDP  509

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
             DD   +      LL+EGIAQNTTG++FVPE GG  E+SGSPTEKAIL +G+K+G++F+ 
Sbjct  510  CDDIRAVSCGATELLIEGIAQNTTGTIFVPEDGGDAELSGSPTEKAILSWGLKIGMDFND  569

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDS  612
             RS+S I+H FPFNSEKKRGGVAV+ D+
Sbjct  570  ARSKSQILHVFPFNSEKKRGGVAVQSDA  597



>gb|EEE68995.1| hypothetical protein OsJ_27935 [Oryza sativa Japonica Group]
Length=1080

 Score =   265 bits (678),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 169/208 (81%), Gaps = 5/208 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL IR+FTGHTKDP     F AG T+      GAI+I TIAVTIVVVAVPEGLPLAV
Sbjct  390  VLVVLWIRYFTGHTKDPDGTTQFVAGTTRAKKGFMGAIRILTIAVTIVVVAVPEGLPLAV  449

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMM DKALVRRLS+CETMGSATTICSDKTGTLTLN+MTVV AY GG  ++P
Sbjct  450  TLTLAYSMRKMMRDKALVRRLSSCETMGSATTICSDKTGTLTLNKMTVVQAYFGGTMLDP  509

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
             DD   +      LL+EGIAQNTTG++FVPE GG  E+SGSPTEKAIL +G+K+G++F+ 
Sbjct  510  CDDIRAVSCGATELLIEGIAQNTTGTIFVPEDGGDAELSGSPTEKAILSWGLKIGMDFND  569

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDS  612
             RS+S I+H FPFNSEKKRGGVAV+ D+
Sbjct  570  ARSKSQILHVFPFNSEKKRGGVAVQSDA  597



>ref|XP_004488018.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Cicer arietinum]
Length=1090

 Score =   266 bits (679),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 171/206 (83%), Gaps = 6/206 (3%)
 Frame = +1

Query  25   RFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+F+GHT++ +    F AGKT+V DA+DGAIKI T+AVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  408  RYFSGHTENANGTKQFVAGKTRVRDAVDGAIKIITVAVTIVVVAVPEGLPLAVTLTLAYS  467

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLT+N+MT+V+ Y GG +I+PP      
Sbjct  468  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTMNKMTIVEVYAGGTKIDPPHQLESS  527

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
            P K+  LL+EG+AQNT GSV+VPEGG   EVSGSPTEKAIL + +++G+NF   RSESSI
Sbjct  528  P-KLRSLLIEGVAQNTNGSVYVPEGGNDVEVSGSPTEKAILHWAIQVGMNFATARSESSI  586

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            IH FPFNSEKKRGGVA++     ++I
Sbjct  587  IHVFPFNSEKKRGGVAIQTADSDVHI  612



>ref|XP_008789606.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Phoenix dactylifera]
Length=1063

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 170/203 (84%), Gaps = 9/203 (4%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHTK+P     F  G+T V  A++GAIKI TIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  398  RYFTGHTKNPDGSVQFIKGQTSVKAAVNGAIKILTIAVTIVVVAVPEGLPLAVTLTLAYS  457

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMT+V+AY+GGK+I+P +D   +
Sbjct  458  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTIVEAYVGGKKIDPLED---V  514

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
                  LL+EGIAQNTTGSVF PE GG+ E++GSPTEKAIL + VKLG+ F   RS+SSI
Sbjct  515  ESTACALLIEGIAQNTTGSVFEPENGGMIEITGSPTEKAILSWAVKLGMKFRDARSKSSI  574

Query  550  IHAFPFNSEKKRGGVAVKL-DSE  615
            +H FPFNSEKKRGGVAV + DSE
Sbjct  575  LHVFPFNSEKKRGGVAVHVGDSE  597



>ref|XP_004973946.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Setaria italica]
Length=1083

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 172/207 (83%), Gaps = 5/207 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL IR+FTGHT++P     F AG T V     GAI+I TIAVTIVVVAVPEGLPLAV
Sbjct  394  VLVVLWIRYFTGHTENPDGTTQFVAGTTGVKQGFMGAIRILTIAVTIVVVAVPEGLPLAV  453

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSM+KMM DKALVRRLS+CETMGSATTICSDKTGTLTLN+MTVV+AY  G +++P
Sbjct  454  TLTLAYSMKKMMRDKALVRRLSSCETMGSATTICSDKTGTLTLNKMTVVEAYFAGTKLDP  513

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
             DD SQ+      ++LEGIAQNTTG+VF+PE GG PE++GSPTEKAIL +G+K+G++F  
Sbjct  514  CDDISQISDDSAAIILEGIAQNTTGTVFLPEDGGEPELTGSPTEKAILSWGLKIGMDFHD  573

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLD  609
            +RS+SS+IH FPFNS+KKRG VAV+ D
Sbjct  574  MRSKSSVIHVFPFNSDKKRGAVAVQSD  600



>ref|XP_008663568.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X2 [Zea mays]
Length=1089

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 166/206 (81%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT +P     +  G   VG  I G +KIFT+AVTIVVVAVPEGLPLAVTLTLA+S
Sbjct  396  RYFTGHTYNPDGSVQYVKGNMGVGQTIRGIVKIFTVAVTIVVVAVPEGLPLAVTLTLAFS  455

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GGK+++ PD+   L
Sbjct  456  MRKMMKDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYFGGKKMDSPDNAQML  515

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               V  L++EGIAQNT+GS+F PEGG  PEV+GSPTEKAIL +G+KLG+ F   RS+SSI
Sbjct  516  SADVTSLIVEGIAQNTSGSIFEPEGGQEPEVTGSPTEKAILSWGLKLGMKFSETRSKSSI  575

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVAV L    ++I
Sbjct  576  LHVFPFNSEKKRGGVAVYLAGSEVHI  601



>emb|CDY19575.1| BnaA05g19830D [Brassica napus]
Length=1095

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 171/207 (83%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG T+D +    F  GKT + D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  415  RYFTGTTQDSNGATQFVKGKTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  474

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG +++  D+ S L
Sbjct  475  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGL  534

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K++ L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL +  KLG+ FD IRSES+I
Sbjct  535  HTKLVALISEGVAQNTTGNVFHPKDGGEVEISGSPTEKAILSWAYKLGMKFDTIRSESAI  594

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAFPFNSEKKRGGVAV + DSE FI+
Sbjct  595  IHAFPFNSEKKRGGVAVLRGDSEVFIH  621



>emb|CDY50072.1| BnaC05g30810D [Brassica napus]
Length=1095

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 171/207 (83%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG T+D +    F  GKT + D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  415  RYFTGTTQDSNGATQFVKGKTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  474

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG +++  D+ S L
Sbjct  475  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGL  534

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K++ L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL +  KLG+ FD IRSES+I
Sbjct  535  HTKLVALISEGVAQNTTGNVFHPKDGGEVEISGSPTEKAILSWAYKLGMKFDTIRSESAI  594

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAFPFNSEKKRGGVAV + DSE FI+
Sbjct  595  IHAFPFNSEKKRGGVAVLRGDSEVFIH  621



>ref|XP_002448481.1| hypothetical protein SORBIDRAFT_06g027770 [Sorghum bicolor]
 gb|EES12809.1| hypothetical protein SORBIDRAFT_06g027770 [Sorghum bicolor]
Length=1092

 Score =   264 bits (675),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 167/207 (81%), Gaps = 6/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT +P     +  GK  VG  I G ++IFT+AVTIVVVAVPEGLPLAVTLTLA+S
Sbjct  400  RYFTGHTYNPDGSVQYVKGKMGVGQTIRGVVRIFTVAVTIVVVAVPEGLPLAVTLTLAFS  459

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GGK+++ PD+   L
Sbjct  460  MRKMMKDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYFGGKKMDSPDNAQML  519

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGG--VPEVSGSPTEKAILQFGVKLGLNFDAIRSESS  546
               V  L++EGIAQNT+GS+F PE G   PEV+GSPTEKAIL +G+KLG+ F+  RS+SS
Sbjct  520  SADVTSLIVEGIAQNTSGSIFEPEHGGQEPEVTGSPTEKAILSWGLKLGMKFNETRSKSS  579

Query  547  IIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            I+H FPFNSEKKRGGVAV L    ++I
Sbjct  580  ILHVFPFNSEKKRGGVAVHLGGSEVHI  606



>ref|XP_006660796.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X1 [Oryza brachyantha]
Length=741

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 171/214 (80%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL+IR+FTGHTK+P     F AG T V     GAI+IFTIAVTIVVVAVPEGLPLA
Sbjct  51   VVLAVLLIRYFTGHTKNPDGTTQFLAGTTGVKHGFMGAIRIFTIAVTIVVVAVPEGLPLA  110

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMM DKA+VRRLS+CETMGSATTICSDKTGTLTLN+MTVV+AY+GG +++
Sbjct  111  VTLTLAYSMRKMMRDKAMVRRLSSCETMGSATTICSDKTGTLTLNKMTVVEAYLGGTKLD  170

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFD  525
            P D+   +   V  LL+EGIAQNT G VF+ E GGV EV+GSPTEKAIL +G+K+G+ F 
Sbjct  171  PSDNTRMIYSSVAALLIEGIAQNTAGDVFLSEDGGVAEVTGSPTEKAILSWGLKIGMKFK  230

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
              RS+SS++H  PFNS KKR GVAV++    ++I
Sbjct  231  NERSKSSVLHVIPFNSVKKRSGVAVQVSDVSVHI  264



>emb|CDY37311.1| BnaA01g25310D [Brassica napus]
Length=1091

 Score =   264 bits (674),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 170/207 (82%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG T+D      F  GKT + D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  411  RYFTGTTQDSSGATQFVKGKTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  470

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG +++  D+ S L
Sbjct  471  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGL  530

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K++ L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL +  KLG+ FD IRSES+I
Sbjct  531  HPKLVALISEGVAQNTTGNVFHPKDGGEVEISGSPTEKAILSWAYKLGMKFDTIRSESAI  590

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAFPFNSEKKRGGVAV + DSE FI+
Sbjct  591  IHAFPFNSEKKRGGVAVLRGDSEVFIH  617



>ref|XP_009145511.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Brassica rapa]
Length=1095

 Score =   264 bits (674),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 171/207 (83%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG T+D +    F  GKT + D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  415  RYFTGTTQDSNGATQFVKGKTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  474

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG +++  D+ S L
Sbjct  475  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGL  534

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K++ L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL +  KLG+ FD IRSES+I
Sbjct  535  HPKLVALISEGVAQNTTGNVFHPKDGGEVEISGSPTEKAILSWAYKLGMKFDTIRSESAI  594

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAFPFNSEKKRGGVAV + DSE FI+
Sbjct  595  IHAFPFNSEKKRGGVAVLRGDSEVFIH  621



>ref|XP_006659616.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Oryza brachyantha]
Length=1086

 Score =   264 bits (674),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 170/208 (82%), Gaps = 5/208 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL IR+FTGHTKDP+    F AG T+      GAI+I TIAVTIVVVAVPEGLPLAV
Sbjct  396  VLIVLWIRYFTGHTKDPNGTTQFVAGTTRAKKGFMGAIRILTIAVTIVVVAVPEGLPLAV  455

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMM DKALVRRLS+CETMGSATTICSDKTGTLTLN+MTVV AY GG  ++P
Sbjct  456  TLTLAYSMRKMMRDKALVRRLSSCETMGSATTICSDKTGTLTLNKMTVVQAYFGGTILDP  515

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
             DD   +      LL+EGIAQNTTG++F+PE GG  E+SGSPTEKAIL +G+K+G++F+ 
Sbjct  516  CDDIRAMSSGATELLIEGIAQNTTGTIFLPEDGGDAELSGSPTEKAILSWGLKIGMDFND  575

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDS  612
             +S+S I+H FPFNSEKKRGGVAV+ D+
Sbjct  576  AQSKSQILHVFPFNSEKKRGGVAVQSDA  603



>ref|XP_010034881.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Eucalyptus grandis]
Length=642

 Score =   257 bits (657),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 172/213 (81%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L++R+FTG+T+D +    F  G T +   +D  IKI TIAVTIVVVAVPEGLPLAV
Sbjct  263  VLVILVVRYFTGNTEDAYGNVQFIKGHTSISHVVDDIIKIVTIAVTIVVVAVPEGLPLAV  322

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY G K+++P
Sbjct  323  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGQKKLDP  382

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            P+D S+L + V  LL EGIAQNT  +VFVP+GG   E+SGSPTEKAIL + VKLG+ FD 
Sbjct  383  PNDSSKLHEVVTSLLHEGIAQNTQANVFVPKGGEDVEISGSPTEKAILLWAVKLGMKFDV  442

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             RSES+++   PFNS KK GGVA+K ++  ++I
Sbjct  443  SRSESTVLRVVPFNSRKKCGGVAIKRNNSEVFI  475



>ref|XP_008652882.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X2 [Zea mays]
Length=869

 Score =   261 bits (667),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 175/213 (82%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L +R+FTGHTK+P     F AG T V     GAI+I TIAVTIVVVAVPEGLPLAV
Sbjct  178  VLVILWLRYFTGHTKNPDGTTQFLAGTTGVKQGFMGAIRILTIAVTIVVVAVPEGLPLAV  237

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMM DKALVRRLS+CETMGSATTICSDKTGTLT+N+MTVV+AY+GG++++ 
Sbjct  238  TLTLAYSMRKMMRDKALVRRLSSCETMGSATTICSDKTGTLTMNKMTVVEAYLGGEKMDT  297

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
             D+ S +   V  LL+EGIAQNTTG+VF+PE GG  E++GSPTEKAIL +G+ +G++F  
Sbjct  298  YDNASTMCTSVTALLIEGIAQNTTGTVFMPEDGGAAEITGSPTEKAILSWGLMIGMDFKD  357

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RS+SS++H  PFNSEKKRGGVA+++    ++I
Sbjct  358  VRSKSSVLHVVPFNSEKKRGGVALQVSDTEVHI  390



>ref|XP_006660797.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X2 [Oryza brachyantha]
Length=769

 Score =   259 bits (663),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 171/214 (80%), Gaps = 5/214 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL+IR+FTGHTK+P     F AG T V     GAI+IFTIAVTIVVVAVPEGLPLA
Sbjct  79   VVLAVLLIRYFTGHTKNPDGTTQFLAGTTGVKHGFMGAIRIFTIAVTIVVVAVPEGLPLA  138

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMM DKA+VRRLS+CETMGSATTICSDKTGTLTLN+MTVV+AY+GG +++
Sbjct  139  VTLTLAYSMRKMMRDKAMVRRLSSCETMGSATTICSDKTGTLTLNKMTVVEAYLGGTKLD  198

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFD  525
            P D+   +   V  LL+EGIAQNT G VF+ E GGV EV+GSPTEKAIL +G+K+G+ F 
Sbjct  199  PSDNTRMIYSSVAALLIEGIAQNTAGDVFLSEDGGVAEVTGSPTEKAILSWGLKIGMKFK  258

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
              RS+SS++H  PFNS KKR GVAV++    ++I
Sbjct  259  NERSKSSVLHVIPFNSVKKRSGVAVQVSDVSVHI  292



>ref|XP_003580413.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Brachypodium distachyon]
Length=1082

 Score =   263 bits (671),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 166/206 (81%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT +P     +  GK  VG  I G +KIFT+AVTIVVVAVPEGLPLAVTLTLA+S
Sbjct  394  RYFTGHTYNPDGSPQYVKGKMGVGSTIRGIVKIFTVAVTIVVVAVPEGLPLAVTLTLAFS  453

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GGK++ P D+   L
Sbjct  454  MRKMMKDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYFGGKKLAPADNTQML  513

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               ++ L++EGIAQNTTGS+F PEGG  PEV+GSPTEKAIL +G++LG+ F   RS+SS+
Sbjct  514  SAAMLSLIIEGIAQNTTGSIFEPEGGQAPEVTGSPTEKAILSWGLQLGMKFSETRSKSSV  573

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +  FPFNSEKKRGGVAV L    +++
Sbjct  574  LQVFPFNSEKKRGGVAVHLGGSEVHV  599



>ref|XP_009786114.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Nicotiana sylvestris]
 ref|XP_009786115.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Nicotiana sylvestris]
Length=1079

 Score =   263 bits (671),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 168/205 (82%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL+ RFFTG+TK+P     F  GKT V  +IDG + I T AVTIVVVAVPEGLPLAV
Sbjct  392  VLIVLLCRFFTGNTKNPDGTTQFVHGKTSVSKSIDGVVHIITAAVTIVVVAVPEGLPLAV  451

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AYIG K+++P
Sbjct  452  TLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYIGEKKLDP  511

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            P+D SQL   V  LL EGI QNT+GSVF  + G   EVSGSPTEKAIL +GVK+G+ F+ 
Sbjct  512  PEDGSQLHSAVSSLLDEGITQNTSGSVFASKDGKGIEVSGSPTEKAILTWGVKMGMKFEV  571

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
            +RS+S I+H  PFNS KKRGGVAV+
Sbjct  572  VRSQSIILHVSPFNSTKKRGGVAVR  596



>ref|XP_006406305.1| hypothetical protein EUTSA_v10019954mg [Eutrema salsugineum]
 gb|ESQ47758.1| hypothetical protein EUTSA_v10019954mg [Eutrema salsugineum]
Length=1087

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 170/207 (82%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG T+DP     F  G T + D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  408  RYFTGTTQDPDGKTQFVKGTTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  467

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG +++  D+ S L
Sbjct  468  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGL  527

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K++ L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL +  KLG+ F+ IRSES+I
Sbjct  528  HPKLVALISEGVAQNTTGNVFHPKDGGEVEISGSPTEKAILSWAYKLGMKFETIRSESAI  587

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAFPFNSEKKRGGVAV + DSE FI+
Sbjct  588  IHAFPFNSEKKRGGVAVLRGDSEVFIH  614



>ref|XP_009594203.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Nicotiana tomentosiformis]
 ref|XP_009594204.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Nicotiana tomentosiformis]
 ref|XP_009594205.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Nicotiana tomentosiformis]
Length=1079

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 167/205 (81%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL+ RFFTG+TK+P     F  GKT V  +IDG + I T AVTIVVVAVPEGLPLAV
Sbjct  392  VLIVLLCRFFTGNTKNPDGTTQFVHGKTSVSKSIDGVVHIITAAVTIVVVAVPEGLPLAV  451

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AYIG K+++P
Sbjct  452  TLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYIGEKKLDP  511

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            P+D SQL   V  LL EGI QNT+GSVF  + G   EVSGSPTEKAIL +GVK+G+ F  
Sbjct  512  PEDGSQLHSAVSSLLDEGITQNTSGSVFASKDGKGIEVSGSPTEKAILSWGVKMGMKFKV  571

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
            +RS+S I+H  PFNS KKRGGVAV+
Sbjct  572  VRSQSIILHVSPFNSTKKRGGVAVR  596



>ref|XP_006412793.1| hypothetical protein EUTSA_v10024281mg [Eutrema salsugineum]
 ref|XP_006412794.1| hypothetical protein EUTSA_v10024281mg [Eutrema salsugineum]
 gb|ESQ54246.1| hypothetical protein EUTSA_v10024281mg [Eutrema salsugineum]
 gb|ESQ54247.1| hypothetical protein EUTSA_v10024281mg [Eutrema salsugineum]
Length=1069

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 165/205 (80%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL++R+FTGHT +    P F  GKTK    +D  +KI T+AVTIVVVAVPEGLPLA
Sbjct  386  VVLFVLVVRYFTGHTTNADGTPQFVGGKTKFDHVLDDLVKIITVAVTIVVVAVPEGLPLA  445

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+ Y G  +++
Sbjct  446  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVECYAGFLKMD  505

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPD  S+LP     +LLEGIA NTTGSVF  E G  +VSGSPTE+AIL + +KLG+NFD+
Sbjct  506  PPDSSSKLPPAFTSILLEGIAHNTTGSVFRSESGEIQVSGSPTERAILNWAIKLGMNFDS  565

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
            +RS SS +   PFNSE+KRGGVAVK
Sbjct  566  LRSASSAVQFVPFNSEQKRGGVAVK  590



>ref|XP_006652779.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Oryza brachyantha]
Length=1084

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 167/206 (81%), Gaps = 5/206 (2%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT +P     +  GK  VG  I G + IFT+AVTIVVVAVPEGLPLAVTLTLA+S
Sbjct  396  RYFTGHTYNPDGSVQYVKGKMSVGQTIRGIVGIFTVAVTIVVVAVPEGLPLAVTLTLAFS  455

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GGK+++PPD+   L
Sbjct  456  MRKMMRDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYFGGKKMDPPDNVQVL  515

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               V  L++EGIAQNT+GS+F P+ G  PEV+GSPTEKAIL +G+KLG+ F+  R++SSI
Sbjct  516  SATVSSLIVEGIAQNTSGSIFEPDNGQDPEVTGSPTEKAILSWGLKLGMRFNDTRAKSSI  575

Query  550  IHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +H FPFNSEKKRGGVAV L    ++I
Sbjct  576  LHVFPFNSEKKRGGVAVHLGGSEVHI  601



>ref|XP_010235324.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Brachypodium distachyon]
Length=1094

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 172/209 (82%), Gaps = 5/209 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VV  VL+IR+FTGHTK+P     F+AG T     + GAI+I TIAVTIVVVAVPEGLPLA
Sbjct  403  VVFGVLVIRYFTGHTKNPDGTVQFRAGTTGGKHGLMGAIRILTIAVTIVVVAVPEGLPLA  462

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMM DKALVRRLS+CETMGSATTICSDKTGTLTLN+MTVV+AY  G +++
Sbjct  463  VTLTLAYSMRKMMRDKALVRRLSSCETMGSATTICSDKTGTLTLNKMTVVEAYFIGTKLD  522

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFD  525
            P DD        + LL+EGIAQNTTG+VFVPE GG  +V+GSPTEKAIL +G+K+G++F 
Sbjct  523  PCDDVRATSPSALALLVEGIAQNTTGTVFVPEDGGAADVTGSPTEKAILSWGLKIGMDFS  582

Query  526  AIRSESSIIHAFPFNSEKKRGGVAVKLDS  612
             +R++SS++H FPFNSEKKRGGVAV+ D+
Sbjct  583  DVRAKSSVLHVFPFNSEKKRGGVAVQSDT  611



>ref|XP_006412795.1| hypothetical protein EUTSA_v10024281mg [Eutrema salsugineum]
 gb|ESQ54248.1| hypothetical protein EUTSA_v10024281mg [Eutrema salsugineum]
Length=1070

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 165/205 (80%), Gaps = 4/205 (2%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLA  168
            VVL VL++R+FTGHT +    P F  GKTK    +D  +KI T+AVTIVVVAVPEGLPLA
Sbjct  386  VVLFVLVVRYFTGHTTNADGTPQFVGGKTKFDHVLDDLVKIITVAVTIVVVAVPEGLPLA  445

Query  169  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRIN  348
            VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+MTVV+ Y G  +++
Sbjct  446  VTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVECYAGFLKMD  505

Query  349  PPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQFGVKLGLNFDA  528
            PPD  S+LP     +LLEGIA NTTGSVF  E G  +VSGSPTE+AIL + +KLG+NFD+
Sbjct  506  PPDSSSKLPPAFTSILLEGIAHNTTGSVFRSESGEIQVSGSPTERAILNWAIKLGMNFDS  565

Query  529  IRSESSIIHAFPFNSEKKRGGVAVK  603
            +RS SS +   PFNSE+KRGGVAVK
Sbjct  566  LRSASSAVQFVPFNSEQKRGGVAVK  590



>ref|XP_002883291.1| Ca2+-transporting ATPase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59550.1| Ca2+-transporting ATPase [Arabidopsis lyrata subsp. lyrata]
Length=1087

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 170/207 (82%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG T+D +    F  G T + D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  408  RYFTGTTQDTNGATQFIKGTTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  467

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG +++  D+ S L
Sbjct  468  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGL  527

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K++ L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL +  KLG+ FD IRSES+I
Sbjct  528  HPKLVALISEGVAQNTTGNVFHPKDGGEVEISGSPTEKAILSWAYKLGMKFDTIRSESAI  587

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAFPFNSEKKRGGVAV + DSE FI+
Sbjct  588  IHAFPFNSEKKRGGVAVLRGDSEVFIH  614



>gb|KCW53959.1| hypothetical protein EUGRSUZ_J03164 [Eucalyptus grandis]
Length=705

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 172/213 (81%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L++R+FTG+T+D +    F  G T +   +D  IKI TIAVTIVVVAVPEGLPLAV
Sbjct  326  VLVILVVRYFTGNTEDAYGNVQFIKGHTSISHVVDDIIKIVTIAVTIVVVAVPEGLPLAV  385

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY G K+++P
Sbjct  386  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYAGQKKLDP  445

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
            P+D S+L + V  LL EGIAQNT  +VFVP+GG   E+SGSPTEKAIL + VKLG+ FD 
Sbjct  446  PNDSSKLHEVVTSLLHEGIAQNTQANVFVPKGGEDVEISGSPTEKAILLWAVKLGMKFDV  505

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
             RSES+++   PFNS KK GGVA+K ++  ++I
Sbjct  506  SRSESTVLRVVPFNSRKKCGGVAIKRNNSEVFI  538



>tpg|DAA62117.1| TPA: hypothetical protein ZEAMMB73_938570, partial [Zea mays]
Length=1051

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 175/213 (82%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L +R+FTGHTK+P     F AG T V     GAI+I TIAVTIVVVAVPEGLPLAV
Sbjct  378  VLVILWLRYFTGHTKNPDGTTQFLAGTTGVKQGFMGAIRILTIAVTIVVVAVPEGLPLAV  437

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMM DKALVRRLS+CETMGSATTICSDKTGTLT+N+MTVV+AY+GG++++ 
Sbjct  438  TLTLAYSMRKMMRDKALVRRLSSCETMGSATTICSDKTGTLTMNKMTVVEAYLGGEKMDT  497

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
             D+ S +   V  LL+EGIAQNTTG+VF+PE GG  E++GSPTEKAIL +G+ +G++F  
Sbjct  498  YDNASTMCTSVTALLIEGIAQNTTGTVFMPEDGGAAEITGSPTEKAILSWGLMIGMDFKD  557

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RS+SS++H  PFNSEKKRGGVA+++    ++I
Sbjct  558  VRSKSSVLHVVPFNSEKKRGGVALQVSDTEVHI  590



>ref|NP_001053795.1| Os04g0605500 [Oryza sativa Japonica Group]
 emb|CAD41784.2| OSJNBa0035M09.2 [Oryza sativa Japonica Group]
 emb|CAE03884.2| OSJNBb0015N08.12 [Oryza sativa Japonica Group]
 dbj|BAF15709.1| Os04g0605500 [Oryza sativa Japonica Group]
 gb|EEC77944.1| hypothetical protein OsI_17291 [Oryza sativa Indica Group]
 gb|EEE61631.1| hypothetical protein OsJ_16068 [Oryza sativa Japonica Group]
Length=1088

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 164/199 (82%), Gaps = 5/199 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT +P     +  GK  VG  I G + IFT+AVTIVVVAVPEGLPLAVTLTLA+S
Sbjct  398  RYFTGHTYNPDGSVQYVKGKMGVGQTIRGIVGIFTVAVTIVVVAVPEGLPLAVTLTLAFS  457

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GGK+++PPD+   L
Sbjct  458  MRKMMRDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYFGGKKMDPPDNVQVL  517

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               +  L++EGIAQNT+GS+F PE G  PEV+GSPTEKAIL +G+KLG+ F+  R++SSI
Sbjct  518  SASISSLIVEGIAQNTSGSIFEPENGQDPEVTGSPTEKAILSWGLKLGMRFNDTRTKSSI  577

Query  550  IHAFPFNSEKKRGGVAVKL  606
            +H FPFNSEKKRGGVAV L
Sbjct  578  LHVFPFNSEKKRGGVAVHL  596



>ref|XP_009109767.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Brassica rapa]
Length=1096

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 169/207 (82%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG T+D      F  G T + D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  416  RYFTGTTQDSSGATQFVKGTTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  475

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG +++  D+ S L
Sbjct  476  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGL  535

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K++ L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL +  KLG+ FD IRSES+I
Sbjct  536  HPKLVALISEGVAQNTTGNVFHPKDGGEVEISGSPTEKAILSWAYKLGMKFDTIRSESAI  595

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAFPFNSEKKRGGVAV + DSE FI+
Sbjct  596  IHAFPFNSEKKRGGVAVLRGDSEVFIH  622



>emb|CAB43665.1| Ca2+-transporting ATPase-like protein [Arabidopsis thaliana]
Length=1093

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 168/218 (77%), Gaps = 17/218 (8%)
 Frame = +1

Query  1    VVLLVLMIRFFTGHTKD----PHFKAGKTKVGDAIDGAIKIFtiavtiv-----------  135
            VVL VL++R+FTGHTK+    P F  GKTK    +D  ++IFT+AV++            
Sbjct  387  VVLFVLVVRYFTGHTKNEQGGPQFIGGKTKFEHVLDDLVEIFTVAVSVSLEEISMANTVT  446

Query  136  --vvavPEGLPLAVTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQM  309
              VVAVPEGLPLAVTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLN+M
Sbjct  447  IVVVAVPEGLPLAVTLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEM  506

Query  310  TVVDAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAI  489
            TVV+ Y G ++++ PD  S+LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AI
Sbjct  507  TVVECYAGLQKMDSPDSSSKLPSAFTSILVEGIAHNTTGSVFRSESGEIQVSGSPTERAI  566

Query  490  LQFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK  603
            L + +KLG++FDA++SESS +  FPFNSEKKRGGVAVK
Sbjct  567  LNWAIKLGMDFDALKSESSAVQFFPFNSEKKRGGVAVK  604



>gb|AGW24530.1| type IIB Ca2+ATPase [Oryza sativa]
Length=1088

 Score =   261 bits (668),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 164/199 (82%), Gaps = 5/199 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT +P     +  GK  VG  I G + IFT+AVTIVVVAVPEGLPLAVTLTLA+S
Sbjct  398  RYFTGHTYNPDGSVQYVKGKMGVGQTIRGIVGIFTVAVTIVVVAVPEGLPLAVTLTLAFS  457

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GGK+++PPD+   L
Sbjct  458  MRKMMRDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYFGGKKMDPPDNVQVL  517

Query  373  PQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               +  L++EGIAQNT+GS+F PE G  PEV+GSPTEKAIL +G+KLG+ F+  R++SSI
Sbjct  518  SASISSLIVEGIAQNTSGSIFEPENGQDPEVTGSPTEKAILSWGLKLGMRFNDTRTKSSI  577

Query  550  IHAFPFNSEKKRGGVAVKL  606
            +H FPFNSEKKRGGVAV L
Sbjct  578  LHVFPFNSEKKRGGVAVHL  596



>ref|XP_008652881.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X1 [Zea mays]
Length=1071

 Score =   261 bits (667),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 175/213 (82%), Gaps = 5/213 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL++L +R+FTGHTK+P     F AG T V     GAI+I TIAVTIVVVAVPEGLPLAV
Sbjct  380  VLVILWLRYFTGHTKNPDGTTQFLAGTTGVKQGFMGAIRILTIAVTIVVVAVPEGLPLAV  439

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMM DKALVRRLS+CETMGSATTICSDKTGTLT+N+MTVV+AY+GG++++ 
Sbjct  440  TLTLAYSMRKMMRDKALVRRLSSCETMGSATTICSDKTGTLTMNKMTVVEAYLGGEKMDT  499

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLGLNFDA  528
             D+ S +   V  LL+EGIAQNTTG+VF+PE GG  E++GSPTEKAIL +G+ +G++F  
Sbjct  500  YDNASTMCTSVTALLIEGIAQNTTGTVFMPEDGGAAEITGSPTEKAILSWGLMIGMDFKD  559

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            +RS+SS++H  PFNSEKKRGGVA+++    ++I
Sbjct  560  VRSKSSVLHVVPFNSEKKRGGVALQVSDTEVHI  592



>ref|XP_002460472.1| hypothetical protein SORBIDRAFT_02g028935 [Sorghum bicolor]
 gb|EER96993.1| hypothetical protein SORBIDRAFT_02g028935 [Sorghum bicolor]
Length=1052

 Score =   261 bits (667),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 175/210 (83%), Gaps = 6/210 (3%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL +R+FTGHTK+P     F AG T V     GAI+I TIAVTIVVVAVPEGLPLAV
Sbjct  380  VLVVLWLRYFTGHTKNPDGTTQFLAGTTGVKQGFMGAIRILTIAVTIVVVAVPEGLPLAV  439

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMM DKALVRRLS+CETMGSATTICSDKTGTLT+N+MTVV+AY+GGK ++P
Sbjct  440  TLTLAYSMRKMMRDKALVRRLSSCETMGSATTICSDKTGTLTMNKMTVVEAYLGGKEMDP  499

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQFGVKLGLNFDA  528
             D+ + +   V  LL+EGIAQNTTG+VF+PE G P EV+GSPTEKAI+ +G+ +G++F  
Sbjct  500  YDNANTMCTSVTTLLIEGIAQNTTGTVFMPEDGGPVEVTGSPTEKAIISWGLMIGMDFKD  559

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKL-DSE  615
            +RS+SS++H  PF+SEKKRGGVA+K+ D+E
Sbjct  560  VRSKSSVLHVLPFSSEKKRGGVALKVSDTE  589



>ref|NP_188755.2| calcium-transporting ATPase 9 [Arabidopsis thaliana]
 sp|Q9LU41.2|ACA9_ARATH RecName: Full=Calcium-transporting ATPase 9, plasma membrane-type; 
AltName: Full=Ca(2+)-ATPase isoform 9 [Arabidopsis thaliana]
 dbj|BAE99265.1| putative Ca2+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE76473.1| calcium-transporting ATPase 9 [Arabidopsis thaliana]
Length=1086

 Score =   261 bits (667),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 170/207 (82%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG T+D +    F  G T + D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  407  RYFTGTTQDTNGATQFIKGTTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  466

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG +++  D+ S L
Sbjct  467  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGL  526

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K++ L+ EG+AQNTTG++F P +GG  E+SGSPTEKAIL +  KLG+ FD IRSES+I
Sbjct  527  HPKLVALISEGVAQNTTGNIFHPKDGGEVEISGSPTEKAILSWAYKLGMKFDTIRSESAI  586

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAFPFNSEKKRGGVAV + DSE FI+
Sbjct  587  IHAFPFNSEKKRGGVAVLRGDSEVFIH  613



>ref|XP_008663567.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Zea mays]
 gb|AFW59362.1| hypothetical protein ZEAMMB73_703991 [Zea mays]
Length=1090

 Score =   261 bits (667),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 165/207 (80%), Gaps = 6/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTGHT +P     +  G   VG  I G +KIFT+AVTIVVVAVPEGLPLAVTLTLA+S
Sbjct  396  RYFTGHTYNPDGSVQYVKGNMGVGQTIRGIVKIFTVAVTIVVVAVPEGLPLAVTLTLAFS  455

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMM DKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY GGK+++ PD+   L
Sbjct  456  MRKMMKDKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYFGGKKMDSPDNAQML  515

Query  373  PQKVIPLLLEGIAQNTTGSVFVPE--GGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESS  546
               V  L++EGIAQNT+GS+F PE  G  PEV+GSPTEKAIL +G+KLG+ F   RS+SS
Sbjct  516  SADVTSLIVEGIAQNTSGSIFEPEQGGQEPEVTGSPTEKAILSWGLKLGMKFSETRSKSS  575

Query  547  IIHAFPFNSEKKRGGVAVKLDSEFIYI  627
            I+H FPFNSEKKRGGVAV L    ++I
Sbjct  576  ILHVFPFNSEKKRGGVAVYLAGSEVHI  602



>ref|XP_006296870.1| hypothetical protein CARUB_v10012867mg [Capsella rubella]
 gb|EOA29768.1| hypothetical protein CARUB_v10012867mg [Capsella rubella]
Length=1088

 Score =   261 bits (667),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 170/207 (82%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG T+D      F  GKT + D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  409  RYFTGTTQDTSGETQFIKGKTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  468

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG +++  D+ S L
Sbjct  469  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGL  528

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K++ L+ EG+AQNTTG++F P +GG  E+SGSPTEKAIL +  KLG+ F+ IRSES+I
Sbjct  529  HPKLVALISEGVAQNTTGNIFHPKDGGEVEISGSPTEKAILSWAYKLGMKFETIRSESAI  588

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAFPFNSEKKRGGVAV + DSE FI+
Sbjct  589  IHAFPFNSEKKRGGVAVLRGDSEVFIH  615



>dbj|BAB01709.1| Ca2+-transporting ATPase [Arabidopsis thaliana]
Length=1073

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 170/207 (82%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG T+D +    F  G T + D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  394  RYFTGTTQDTNGATQFIKGTTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  453

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG +++  D+ S L
Sbjct  454  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGL  513

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K++ L+ EG+AQNTTG++F P +GG  E+SGSPTEKAIL +  KLG+ FD IRSES+I
Sbjct  514  HPKLVALISEGVAQNTTGNIFHPKDGGEVEISGSPTEKAILSWAYKLGMKFDTIRSESAI  573

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAFPFNSEKKRGGVAV + DSE FI+
Sbjct  574  IHAFPFNSEKKRGGVAVLRGDSEVFIH  600



>ref|XP_006342864.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Solanum tuberosum]
Length=1074

 Score =   260 bits (665),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 167/208 (80%), Gaps = 5/208 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL+ RFFTGH+K+P     F  G+T V   +DG + I T AVTIVVVAVPEGLPLAV
Sbjct  387  VLIVLLSRFFTGHSKNPDGTTQFVRGQTSVSKTMDGVVHIITAAVTIVVVAVPEGLPLAV  446

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G +++N 
Sbjct  447  TLTLAYSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGERKLNS  506

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQFGVKLGLNFDA  528
            P+D SQL   V  LL EGI QNT+GSVF  + G   EVSGSPTEKAIL +GVK+G+ FD 
Sbjct  507  PEDGSQLHSAVSSLLDEGITQNTSGSVFTSKDGKGTEVSGSPTEKAILSWGVKIGMKFDV  566

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDS  612
            +RS+S ++H  PFNS KKRGGVAV+  S
Sbjct  567  VRSQSIVLHVSPFNSTKKRGGVAVREQS  594



>emb|CDY32412.1| BnaC03g41960D [Brassica napus]
Length=1090

 Score =   260 bits (664),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 170/207 (82%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG ++D +    F  G T + D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  410  RYFTGTSQDSNGATQFIKGTTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  469

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG +++  D+ S L
Sbjct  470  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGL  529

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K++ L+ EG+AQNTTG++F P +GG  E+SGSPTEKAIL +  KLG+ FD IRSES+I
Sbjct  530  HPKLVALISEGVAQNTTGNIFHPKDGGEVEISGSPTEKAILSWAYKLGMKFDTIRSESAI  589

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAFPFNSEKKRGGVAV + DSE FI+
Sbjct  590  IHAFPFNSEKKRGGVAVLRGDSEVFIH  616



>emb|CDX82212.1| BnaA03g36090D [Brassica napus]
Length=1090

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 170/207 (82%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG ++D +    F  G T + D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  410  RYFTGTSQDSNGATQFIKGTTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  469

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG +++  D+ S L
Sbjct  470  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGL  529

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K++ L+ EG+AQNTTG++F P +GG  E+SGSPTEKAIL +  KLG+ FD IRSES+I
Sbjct  530  HPKLVALISEGVAQNTTGNIFHPKDGGEVEISGSPTEKAILSWAYKLGMKFDTIRSESAI  589

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAFPFNSEKKRGGVAV + DSE FI+
Sbjct  590  IHAFPFNSEKKRGGVAVLRGDSEVFIH  616



>dbj|BAD09972.1| putative calcium-transporting ATPase 8, plasma membrane-type 
[Oryza sativa Japonica Group]
 dbj|BAD09994.1| putative calcium-transporting ATPase 8, plasma membrane-type 
[Oryza sativa Japonica Group]
Length=1096

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 169/214 (79%), Gaps = 11/214 (5%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL IR+FTGHTKDP     F AG T+      GAI+I TIAVTIVVVAVPEGLPLAV
Sbjct  400  VLVVLWIRYFTGHTKDPDGTTQFVAGTTRAKKGFMGAIRILTIAVTIVVVAVPEGLPLAV  459

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLAYSMRKMM DKALVRRLS+CETMGSATTICSDKTGTLTLN+MTVV AY GG  ++P
Sbjct  460  TLTLAYSMRKMMRDKALVRRLSSCETMGSATTICSDKTGTLTLNKMTVVQAYFGGTMLDP  519

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVK------L  510
             DD   +      LL+EGIAQNTTG++FVPE GG  E+SGSPTEKAIL +G+K      +
Sbjct  520  CDDIRAVSCGATELLIEGIAQNTTGTIFVPEDGGDAELSGSPTEKAILSWGLKFFHFEQI  579

Query  511  GLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDS  612
            G++F+  RS+S I+H FPFNSEKKRGGVAV+ D+
Sbjct  580  GMDFNDARSKSQILHVFPFNSEKKRGGVAVQSDA  613



>emb|CDY27537.1| BnaC01g32200D [Brassica napus]
Length=1092

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 168/207 (81%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG T+D      F  G T + D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  412  RYFTGTTQDSSGATQFVKGTTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  471

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG +++  D+ S L
Sbjct  472  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGL  531

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K++ L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL +  KLG+ FD IRSES+I
Sbjct  532  HPKLVALISEGVAQNTTGNVFHPKDGGEVEISGSPTEKAILSWAYKLGMKFDTIRSESAI  591

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAF FNSEKKRGGVAV + DSE FI+
Sbjct  592  IHAFTFNSEKKRGGVAVLRGDSEVFIH  618



>ref|XP_009135736.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X2 [Brassica rapa]
Length=1090

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 170/207 (82%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG ++D +    F  G T + D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  410  RYFTGTSQDSNGATQFIKGTTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  469

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG +++  D+ S L
Sbjct  470  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGL  529

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K++ L+ EG+AQNTTG++F P +GG  E+SGSPTE+AIL +  KLG+ FD IRSES+I
Sbjct  530  HPKLVALISEGVAQNTTGNIFHPKDGGEVEISGSPTERAILSWAYKLGMKFDTIRSESAI  589

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAFPFNSEKKRGGVAV + DSE FI+
Sbjct  590  IHAFPFNSEKKRGGVAVLRGDSEVFIH  616



>ref|XP_010488101.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Camelina sativa]
 ref|XP_010488102.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Camelina sativa]
Length=1087

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 170/207 (82%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG T+D +    F  G T + D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  408  RYFTGTTQDTNGATQFIKGTTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  467

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG +++  D+ S L
Sbjct  468  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGL  527

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K++ L+ EG+AQNTTG++F P +GG  E+SGSPTEKAIL +  KLG+ F+ IRSES+I
Sbjct  528  HPKLVALISEGVAQNTTGNIFHPKDGGEVEISGSPTEKAILSWAYKLGMKFETIRSESAI  587

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAFPFNSEKKRGGVAV + DSE FI+
Sbjct  588  IHAFPFNSEKKRGGVAVLRGDSEVFIH  614



>ref|XP_009135735.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X1 [Brassica rapa]
Length=1092

 Score =   258 bits (660),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 170/207 (82%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG ++D +    F  G T + D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  412  RYFTGTSQDSNGATQFIKGTTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  471

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG +++  D+ S L
Sbjct  472  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGL  531

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K++ L+ EG+AQNTTG++F P +GG  E+SGSPTE+AIL +  KLG+ FD IRSES+I
Sbjct  532  HPKLVALISEGVAQNTTGNIFHPKDGGEVEISGSPTERAILSWAYKLGMKFDTIRSESAI  591

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAFPFNSEKKRGGVAV + DSE FI+
Sbjct  592  IHAFPFNSEKKRGGVAVLRGDSEVFIH  618



>ref|XP_010466338.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Camelina sativa]
 ref|XP_010466339.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Camelina sativa]
 ref|XP_010466340.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Camelina sativa]
Length=1087

 Score =   258 bits (660),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 170/207 (82%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG T+D +    F  G T + D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  408  RYFTGTTQDTNGATQFIKGTTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  467

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG +++  D+ S L
Sbjct  468  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGL  527

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K++ L+ EG+AQNTTG++F P +GG  E+SGSPTEKAIL +  KLG+ F+ IRSES+I
Sbjct  528  HPKLVDLISEGVAQNTTGNIFHPKDGGEVEISGSPTEKAILSWAYKLGMKFETIRSESAI  587

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAFPFNSEKKRGGVAV + DSE FI+
Sbjct  588  IHAFPFNSEKKRGGVAVLRGDSEVFIH  614



>ref|XP_010509827.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Camelina sativa]
 ref|XP_010509835.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Camelina sativa]
Length=1087

 Score =   258 bits (660),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 170/207 (82%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDPH----FKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG T+D +    F  G T + D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  408  RYFTGTTQDTNGATQFIKGTTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  467

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG +++  D+ S L
Sbjct  468  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGL  527

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
              K++ L+ EG+AQNTTG++F P +GG  E+SGSPTEKAIL +  KLG+ F+ IRSES+I
Sbjct  528  HPKLVDLISEGVAQNTTGNIFHPKDGGEVEISGSPTEKAILSWAYKLGMKFETIRSESAI  587

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAFPFNSEKKRGGVAV + DSE FI+
Sbjct  588  IHAFPFNSEKKRGGVAVLRGDSEVFIH  614



>gb|KFK39423.1| hypothetical protein AALP_AA3G243100 [Arabis alpina]
Length=1087

 Score =   258 bits (659),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 167/207 (81%), Gaps = 7/207 (3%)
 Frame = +1

Query  25   RFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAVTLTLAYS  192
            R+FTG T+D      F  G T V D +D  +KIFTIAVTIVVVAVPEGLPLAVTLTLAYS
Sbjct  408  RYFTGTTQDSSGATQFIKGTTSVSDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYS  467

Query  193  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINPPDDKSQL  372
            MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+ Y GG ++   D+ S L
Sbjct  468  MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVETYAGGAKMEVADNPSGL  527

Query  373  PQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGVKLGLNFDAIRSESSI  549
               ++ L+ EG+AQNTTG++F P +GG  E+SGSPTEKAIL +  KLG+ FD IRSES+I
Sbjct  528  HPNLVHLISEGVAQNTTGNIFHPKDGGEVEISGSPTEKAILSWAYKLGMKFDTIRSESAI  587

Query  550  IHAFPFNSEKKRGGVAV-KLDSE-FIY  624
            IHAFPFNSEKKRGGVAV + DSE FI+
Sbjct  588  IHAFPFNSEKKRGGVAVLRGDSEVFIH  614



>ref|XP_010318441.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X3 [Solanum lycopersicum]
Length=975

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 166/208 (80%), Gaps = 5/208 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL+ RFFTGH+K+P     F  G+T VG  +DG + I T AVTIVVVAVPEGLPLAV
Sbjct  378  VLIVLLSRFFTGHSKNPDGTTQFVHGQTSVGKTMDGVVHIITAAVTIVVVAVPEGLPLAV  437

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLA SM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+++ 
Sbjct  438  TLTLACSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGKKKLDS  497

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQFGVKLGLNFDA  528
            P+D SQL   V  LL EGI QNT+GSVF  + G   EVSGSPTEKAIL +GVK+G+ FD 
Sbjct  498  PEDGSQLHSAVSSLLDEGITQNTSGSVFTSKDGKGTEVSGSPTEKAILSWGVKIGMKFDV  557

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDS  612
            +RS+S ++H  PFNS KKRGGV V+  S
Sbjct  558  VRSQSIVLHVSPFNSTKKRGGVVVREQS  585



>ref|XP_010318439.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X2 [Solanum lycopersicum]
Length=1047

 Score =   256 bits (654),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 166/208 (80%), Gaps = 5/208 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL+ RFFTGH+K+P     F  G+T VG  +DG + I T AVTIVVVAVPEGLPLAV
Sbjct  378  VLIVLLSRFFTGHSKNPDGTTQFVHGQTSVGKTMDGVVHIITAAVTIVVVAVPEGLPLAV  437

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLA SM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+++ 
Sbjct  438  TLTLACSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGKKKLDS  497

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQFGVKLGLNFDA  528
            P+D SQL   V  LL EGI QNT+GSVF  + G   EVSGSPTEKAIL +GVK+G+ FD 
Sbjct  498  PEDGSQLHSAVSSLLDEGITQNTSGSVFTSKDGKGTEVSGSPTEKAILSWGVKIGMKFDV  557

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDS  612
            +RS+S ++H  PFNS KKRGGV V+  S
Sbjct  558  VRSQSIVLHVSPFNSTKKRGGVVVREQS  585



>ref|XP_004235507.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X1 [Solanum lycopersicum]
Length=1061

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 166/208 (80%), Gaps = 5/208 (2%)
 Frame = +1

Query  4    VLLVLMIRFFTGHTKDP----HFKAGKTKVGDAIDGAIKIFtiavtivvvavPEGLPLAV  171
            VL+VL+ RFFTGH+K+P     F  G+T VG  +DG + I T AVTIVVVAVPEGLPLAV
Sbjct  378  VLIVLLSRFFTGHSKNPDGTTQFVHGQTSVGKTMDGVVHIITAAVTIVVVAVPEGLPLAV  437

Query  172  TLTLAYSMRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVDAYIGGKRINP  351
            TLTLA SM+KMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVV+AY+G K+++ 
Sbjct  438  TLTLACSMKKMMADKALVRRLSACETMGSATTICSDKTGTLTLNQMTVVEAYVGKKKLDS  497

Query  352  PDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQFGVKLGLNFDA  528
            P+D SQL   V  LL EGI QNT+GSVF  + G   EVSGSPTEKAIL +GVK+G+ FD 
Sbjct  498  PEDGSQLHSAVSSLLDEGITQNTSGSVFTSKDGKGTEVSGSPTEKAILSWGVKIGMKFDV  557

Query  529  IRSESSIIHAFPFNSEKKRGGVAVKLDS  612
            +RS+S ++H  PFNS KKRGGV V+  S
Sbjct  558  VRSQSIVLHVSPFNSTKKRGGVVVREQS  585



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250