BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS040F03

Length=591
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009616694.1|  PREDICTED: phosphoethanolamine N-methyltrans...    260   9e-81   Nicotiana tomentosiformis
ref|XP_009757363.1|  PREDICTED: phosphoethanolamine N-methyltrans...    259   3e-80   Nicotiana sylvestris
ref|XP_011084235.1|  PREDICTED: phosphoethanolamine N-methyltrans...    258   5e-80   Sesamum indicum [beniseed]
ref|XP_009614862.1|  PREDICTED: phosphoethanolamine N-methyltrans...    258   8e-80   Nicotiana tomentosiformis
ref|XP_002282182.1|  PREDICTED: phosphomethylethanolamine N-methy...    258   1e-79   Vitis vinifera
ref|XP_007209941.1|  hypothetical protein PRUPE_ppa004742mg             255   5e-79   
ref|NP_001234549.1|  phosphoethanolamine N-methyltransferase            255   6e-79   Solanum lycopersicum
ref|XP_006341528.1|  PREDICTED: phosphoethanolamine N-methyltrans...    254   1e-78   Solanum tuberosum [potatoes]
emb|CAN64744.1|  hypothetical protein VITISV_041321                     254   2e-78   Vitis vinifera
ref|XP_007209942.1|  hypothetical protein PRUPE_ppa004742mg             254   2e-78   Prunus persica
ref|XP_007209943.1|  hypothetical protein PRUPE_ppa004742mg             254   2e-78   
ref|XP_010533969.1|  PREDICTED: phosphomethylethanolamine N-methy...    253   3e-78   Tarenaya hassleriana [spider flower]
ref|XP_011072995.1|  PREDICTED: phosphoethanolamine N-methyltrans...    253   5e-78   Sesamum indicum [beniseed]
ref|XP_010097563.1|  hypothetical protein L484_017373                   253   7e-78   
ref|XP_011084227.1|  PREDICTED: phosphoethanolamine N-methyltrans...    252   1e-77   Sesamum indicum [beniseed]
ref|XP_002532097.1|  phosphoethanolamine n-methyltransferase, put...    252   1e-77   Ricinus communis
ref|XP_010519218.1|  PREDICTED: phosphoethanolamine N-methyltrans...    252   2e-77   Tarenaya hassleriana [spider flower]
gb|KJB30121.1|  hypothetical protein B456_005G132000                    249   2e-77   Gossypium raimondii
ref|XP_008240154.1|  PREDICTED: phosphoethanolamine N-methyltrans...    251   2e-77   
gb|KJB30119.1|  hypothetical protein B456_005G132000                    249   3e-77   Gossypium raimondii
ref|XP_010033717.1|  PREDICTED: phosphoethanolamine N-methyltrans...    251   4e-77   Eucalyptus grandis [rose gum]
ref|XP_010519219.1|  PREDICTED: phosphoethanolamine N-methyltrans...    251   4e-77   Tarenaya hassleriana [spider flower]
ref|XP_008240152.1|  PREDICTED: phosphoethanolamine N-methyltrans...    250   5e-77   Prunus mume [ume]
gb|KJB30123.1|  hypothetical protein B456_005G132000                    249   6e-77   Gossypium raimondii
gb|ABX10444.1|  phosphoethanolamine N-methyltransferase                 249   7e-77   Gossypium hirsutum [American cotton]
gb|AAP83582.1|  phosphoethanolamine N-methyltransferase                 250   8e-77   Brassica napus [oilseed rape]
gb|KHG16117.1|  Phosphoethanolamine N-methyltransferase 1 -like p...    249   9e-77   Gossypium arboreum [tree cotton]
ref|XP_009145948.1|  PREDICTED: phosphoethanolamine N-methyltrans...    249   1e-76   Brassica rapa
ref|XP_004299531.1|  PREDICTED: phosphomethylethanolamine N-methy...    249   2e-76   Fragaria vesca subsp. vesca
ref|XP_010487710.1|  PREDICTED: phosphoethanolamine N-methyltrans...    249   2e-76   Camelina sativa [gold-of-pleasure]
ref|XP_004252273.1|  PREDICTED: phosphomethylethanolamine N-methy...    249   2e-76   Solanum lycopersicum
ref|XP_007036802.1|  S-adenosyl-L-methionine-dependent methyltran...    249   3e-76   
ref|XP_007036803.1|  S-adenosyl-L-methionine-dependent methyltran...    249   3e-76   
gb|KJB30117.1|  hypothetical protein B456_005G132000                    249   3e-76   Gossypium raimondii
ref|XP_010506242.1|  PREDICTED: phosphoethanolamine N-methyltrans...    248   3e-76   Camelina sativa [gold-of-pleasure]
ref|XP_008364653.1|  PREDICTED: phosphoethanolamine N-methyltrans...    248   3e-76   
gb|EYU33965.1|  hypothetical protein MIMGU_mgv1a005263mg                248   4e-76   Erythranthe guttata [common monkey flower]
gb|KJB30122.1|  hypothetical protein B456_005G132000                    248   4e-76   Gossypium raimondii
gb|KDP23922.1|  hypothetical protein JCGZ_27082                         248   7e-76   Jatropha curcas
ref|XP_009776424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    248   9e-76   Nicotiana sylvestris
ref|XP_002883100.1|  N-methyltransferase 1                              247   9e-76   
ref|XP_008360927.1|  PREDICTED: phosphoethanolamine N-methyltrans...    247   1e-75   
emb|CDO98349.1|  unnamed protein product                                246   2e-75   Coffea canephora [robusta coffee]
ref|XP_006346642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    247   2e-75   Solanum tuberosum [potatoes]
ref|XP_010263678.1|  PREDICTED: phosphoethanolamine N-methyltrans...    246   2e-75   Nelumbo nucifera [Indian lotus]
ref|XP_010487709.1|  PREDICTED: phosphoethanolamine N-methyltrans...    246   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_006406666.1|  hypothetical protein EUTSA_v10020595mg             246   2e-75   Eutrema salsugineum [saltwater cress]
ref|NP_188427.2|  phosphoethanolamine N-methyltransferase 1             246   2e-75   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02720.1|  methyl transferase-like protein                        246   2e-75   Arabidopsis thaliana [mouse-ear cress]
gb|AAM13092.1|  unknown protein                                         246   3e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891445.1|  hypothetical protein ARALYDRAFT_473996             246   3e-75   
ref|XP_010465872.1|  PREDICTED: phosphoethanolamine N-methyltrans...    246   3e-75   Camelina sativa [gold-of-pleasure]
dbj|BAD80838.1|  phosphoethanolamine N-methyltransferase                246   3e-75   Atriplex nummularia
ref|NP_973993.1|  phosphoethanolamine N-methyltransferase 2             246   4e-75   Arabidopsis thaliana [mouse-ear cress]
gb|KDO63824.1|  hypothetical protein CISIN_1g043471mg                   245   4e-75   Citrus sinensis [apfelsine]
ref|XP_010506234.1|  PREDICTED: phosphoethanolamine N-methyltrans...    246   4e-75   Camelina sativa [gold-of-pleasure]
ref|XP_009356042.1|  PREDICTED: phosphoethanolamine N-methyltrans...    245   4e-75   Pyrus x bretschneideri [bai li]
gb|AFW83641.1|  hypothetical protein ZEAMMB73_560974                    238   5e-75   
ref|XP_009360079.1|  PREDICTED: phosphoethanolamine N-methyltrans...    245   6e-75   Pyrus x bretschneideri [bai li]
ref|XP_008393424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    245   7e-75   
ref|XP_006490771.1|  PREDICTED: phosphoethanolamine N-methyltrans...    245   7e-75   
gb|AGI56231.1|  phosphoethanolamine N-methyltransferase                 245   9e-75   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_006451624.1|  hypothetical protein CICLE_v10010749mg             244   9e-75   Citrus clementina [clementine]
ref|XP_006297517.1|  hypothetical protein CARUB_v10013541mg             244   9e-75   Capsella rubella
gb|EPS65842.1|  hypothetical protein M569_08933                         244   1e-74   Genlisea aurea
dbj|BAD93609.1|  hypothetical protein                                   236   1e-74   Cucumis melo [Oriental melon]
ref|XP_010097561.1|  Phosphoethanolamine N-methyltransferase 1          244   2e-74   
gb|AFK34653.1|  unknown                                                 234   2e-74   Lotus japonicus
gb|KFK36082.1|  hypothetical protein AALP_AA4G075100                    244   2e-74   Arabis alpina [alpine rockcress]
gb|AEY75253.1|  phosphoethanolamine N-methyltransferase                 243   2e-74   Atriplex canescens [shadscale]
ref|XP_003528975.2|  PREDICTED: phosphoethanolamine N-methyltrans...    244   2e-74   
gb|KFK39125.1|  hypothetical protein AALP_AA3G204100                    243   2e-74   Arabis alpina [alpine rockcress]
gb|AER10512.1|  phosphoethanolamine N-methyltransferase                 243   3e-74   Pyrus betulifolia
ref|XP_009782224.1|  PREDICTED: phosphoethanolamine N-methyltrans...    243   4e-74   Nicotiana sylvestris
ref|XP_011039130.1|  PREDICTED: phosphomethylethanolamine N-methy...    242   7e-74   Populus euphratica
ref|XP_011014101.1|  PREDICTED: phosphomethylethanolamine N-methy...    242   7e-74   Populus euphratica
ref|XP_006303987.1|  hypothetical protein CARUB_v10008968mg             242   8e-74   Capsella rubella
gb|KDP23923.1|  hypothetical protein JCGZ_27083                         242   8e-74   Jatropha curcas
ref|XP_008799221.1|  PREDICTED: phosphomethylethanolamine N-methy...    242   1e-73   Phoenix dactylifera
ref|XP_009147956.1|  PREDICTED: phosphomethylethanolamine N-methy...    242   1e-73   Brassica rapa
gb|EYU24136.1|  hypothetical protein MIMGU_mgv1a005261mg                241   1e-73   Erythranthe guttata [common monkey flower]
sp|Q9M571.1|PEAMT_SPIOL  RecName: Full=Phosphoethanolamine N-meth...    241   2e-73   Spinacia oleracea
dbj|BAE07178.1|  phosphoethanolamine N-methyltransferase                241   2e-73   Beta vulgaris [beet]
ref|XP_010686587.1|  PREDICTED: phosphoethanolamine N-methyltrans...    241   2e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010461683.1|  PREDICTED: phosphomethylethanolamine N-methy...    241   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_008799219.1|  PREDICTED: phosphomethylethanolamine N-methy...    241   2e-73   Phoenix dactylifera
dbj|BAC57960.1|  phosphoethanolamine N-methyltransferase                241   3e-73   Tripolium pannonicum [sea starwort]
ref|XP_009104804.1|  PREDICTED: phosphoethanolamine N-methyltrans...    240   5e-73   Brassica rapa
ref|XP_010274723.1|  PREDICTED: phosphomethylethanolamine N-methy...    240   6e-73   Nelumbo nucifera [Indian lotus]
emb|CDX68222.1|  BnaA07g22620D                                          240   6e-73   
gb|EMT21187.1|  Phosphoethanolamine N-methyltransferase 1               240   6e-73   
gb|EMS54147.1|  Phosphoethanolamine N-methyltransferase 1               240   8e-73   Triticum urartu
emb|CDM83845.1|  unnamed protein product                                240   8e-73   Triticum aestivum [Canadian hard winter wheat]
gb|ACV89824.1|  S-adenosyl-L-methionine:phosphoethanolamine N-met...    240   8e-73   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003569614.1|  PREDICTED: phosphoethanolamine N-methyltrans...    240   8e-73   Brachypodium distachyon [annual false brome]
ref|XP_006644536.1|  PREDICTED: phosphoethanolamine N-methyltrans...    239   1e-72   Oryza brachyantha
ref|XP_010461752.1|  PREDICTED: phosphomethylethanolamine N-methy...    239   1e-72   Camelina sativa [gold-of-pleasure]
ref|XP_009595958.1|  PREDICTED: phosphoethanolamine N-methyltrans...    239   1e-72   Nicotiana tomentosiformis
ref|XP_008799258.1|  PREDICTED: phosphomethylethanolamine N-methy...    238   1e-72   
ref|XP_010678114.1|  PREDICTED: phosphoethanolamine N-methyltrans...    239   1e-72   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAH01482.1|  unnamed protein product                                239   2e-72   Oryza sativa Japonica Group [Japonica rice]
pir||H96762  hypothetical protein F6D5.1 [imported] - Arabidopsis...    240   2e-72
ref|XP_004503268.1|  PREDICTED: phosphoethanolamine N-methyltrans...    238   2e-72   Cicer arietinum [garbanzo]
ref|XP_011008809.1|  PREDICTED: phosphomethylethanolamine N-methy...    238   3e-72   Populus euphratica
ref|XP_004161835.1|  PREDICTED: phosphoethanolamine N-methyltrans...    239   3e-72   
gb|ACJ83326.1|  unknown                                                 229   3e-72   Medicago truncatula
ref|XP_011008808.1|  PREDICTED: phosphomethylethanolamine N-methy...    238   3e-72   Populus euphratica
emb|CDY11100.1|  BnaC06g23520D                                          238   4e-72   Brassica napus [oilseed rape]
gb|KEH21430.1|  phosphoethanolamine N-methyltransferase                 237   4e-72   Medicago truncatula
gb|KEH21429.1|  phosphoethanolamine N-methyltransferase                 237   5e-72   Medicago truncatula
dbj|BAJ97525.1|  predicted protein                                      238   6e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002322102.2|  hypothetical protein POPTR_0015s04540g             238   6e-72   
ref|XP_008464197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    237   6e-72   Cucumis melo [Oriental melon]
ref|NP_001148925.1|  LOC100282545                                       238   6e-72   Zea mays [maize]
ref|XP_007152684.1|  hypothetical protein PHAVU_004G150500g             237   7e-72   Phaseolus vulgaris [French bean]
ref|XP_004137500.1|  PREDICTED: phosphoethanolamine N-methyltrans...    237   1e-71   Cucumis sativus [cucumbers]
ref|XP_002456194.1|  hypothetical protein SORBIDRAFT_03g031950          237   1e-71   Sorghum bicolor [broomcorn]
gb|AAS57723.1|  phosphoethanolamine N-methyltransferase                 236   1e-71   Oryza sativa [red rice]
ref|XP_003631125.1|  Phosphoethanolamine N-methyltransferase            236   1e-71   
ref|NP_001043957.1|  Os01g0695100                                       236   1e-71   
gb|EEE55232.1|  hypothetical protein OsJ_03109                          236   2e-71   Oryza sativa Japonica Group [Japonica rice]
gb|AET05600.2|  phosphoethanolamine N-methyltransferase                 236   2e-71   Medicago truncatula
ref|XP_003631124.1|  Phosphoethanolamine N-methyltransferase            236   2e-71   
ref|XP_004969638.1|  PREDICTED: phosphoethanolamine N-methyltrans...    236   2e-71   Setaria italica
gb|AFW83642.1|  phosphoethanolamine N-methyltransferase                 236   2e-71   
ref|XP_010921161.1|  PREDICTED: phosphoethanolamine N-methyltrans...    236   2e-71   Elaeis guineensis
ref|XP_006365411.1|  PREDICTED: phosphoethanolamine N-methyltrans...    236   3e-71   Solanum tuberosum [potatoes]
ref|XP_004166029.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoethan...    236   3e-71   
ref|XP_004137341.1|  PREDICTED: phosphoethanolamine N-methyltrans...    236   3e-71   Cucumis sativus [cucumbers]
gb|AAM97038.1|  phosphoethanolamine N-methyltransferase, putative       232   4e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009385384.1|  PREDICTED: phosphoethanolamine N-methyltrans...    235   6e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006843796.1|  hypothetical protein AMTR_s00007p00250490          234   6e-71   Amborella trichopoda
ref|NP_177501.2|  putative phosphoethanolamine N-methyltransferase 3    234   7e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79704.1|AC020889_12  T1N15.22                                     224   9e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003567962.1|  PREDICTED: phosphomethylethanolamine N-methy...    234   1e-70   Brachypodium distachyon [annual false brome]
ref|XP_006655550.1|  PREDICTED: phosphoethanolamine N-methyltrans...    234   1e-70   Oryza brachyantha
ref|XP_006390538.1|  hypothetical protein EUTSA_v10018431mg             234   2e-70   Eutrema salsugineum [saltwater cress]
ref|XP_006376718.1|  hypothetical protein POPTR_0012s044902g            222   2e-70   
ref|XP_003534138.1|  PREDICTED: phosphoethanolamine N-methyltrans...    233   2e-70   
ref|XP_008453479.1|  PREDICTED: phosphoethanolamine N-methyltrans...    233   2e-70   Cucumis melo [Oriental melon]
ref|XP_004512744.1|  PREDICTED: phosphoethanolamine N-methyltrans...    233   3e-70   Cicer arietinum [garbanzo]
ref|XP_004961340.1|  PREDICTED: phosphoethanolamine N-methyltrans...    233   3e-70   Setaria italica
ref|XP_010416170.1|  PREDICTED: phosphoethanolamine N-methyltrans...    233   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_009404071.1|  PREDICTED: phosphomethylethanolamine N-methy...    233   4e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010428286.1|  PREDICTED: phosphoethanolamine N-methyltrans...    232   5e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010921197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    232   6e-70   Elaeis guineensis
ref|XP_008799222.1|  PREDICTED: phosphomethylethanolamine N-methy...    231   7e-70   
gb|AFW04224.1|  phosphoethanolamine N-methyl transferase                231   1e-69   Suaeda maritima
dbj|BAC57432.1|  phosphoethanolamine N-methyltransferase                231   1e-69   Suaeda japonica
ref|XP_004241642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    231   1e-69   Solanum lycopersicum
ref|XP_010921188.1|  PREDICTED: phosphoethanolamine N-methyltrans...    232   2e-69   
ref|XP_002887491.1|  predicted protein                                  231   2e-69   
ref|NP_974139.2|  putative phosphoethanolamine N-methyltransferase 3    231   2e-69   Arabidopsis thaliana [mouse-ear cress]
gb|ABK42071.1|  phosphoethanolamine N-methyltransferase                 231   2e-69   Suaeda liaotungensis
gb|KFK41794.1|  hypothetical protein AALP_AA2G173000                    231   2e-69   Arabis alpina [alpine rockcress]
ref|XP_002441466.1|  hypothetical protein SORBIDRAFT_09g027360          231   2e-69   Sorghum bicolor [broomcorn]
ref|XP_004512745.1|  PREDICTED: phosphoethanolamine N-methyltrans...    230   3e-69   Cicer arietinum [garbanzo]
ref|XP_006302164.1|  hypothetical protein CARUB_v10020173mg             231   3e-69   Capsella rubella
ref|NP_001169597.1|  uncharacterized LOC100383478                       230   3e-69   Zea mays [maize]
ref|XP_004969637.1|  PREDICTED: phosphoethanolamine N-methyltrans...    230   4e-69   Setaria italica
ref|XP_010471422.1|  PREDICTED: phosphoethanolamine N-methyltrans...    229   5e-69   Camelina sativa [gold-of-pleasure]
ref|XP_006393388.1|  hypothetical protein EUTSA_v10012068mg             222   7e-69   
dbj|BAE99185.1|  putative phosphoethanolamine N-methyltransferase       229   9e-69   Arabidopsis thaliana [mouse-ear cress]
dbj|BAG50404.1|  methyltransferase                                      218   1e-68   Cardamine sp. SIM-2007
gb|ABG57185.1|  phosphoethanolamine N-methyltransferase                 228   2e-68   Salicornia europaea [chicken-claws]
ref|XP_010471421.1|  PREDICTED: phosphoethanolamine N-methyltrans...    228   2e-68   Camelina sativa [gold-of-pleasure]
ref|XP_003619836.1|  Phosphoethanolamine N-methyltransferase            228   2e-68   Medicago truncatula
ref|XP_010428285.1|  PREDICTED: phosphoethanolamine N-methyltrans...    228   3e-68   Camelina sativa [gold-of-pleasure]
ref|NP_175293.1|  phosphoethanolamine N-methyltransferase 2             224   5e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007160543.1|  hypothetical protein PHAVU_002G330400g             225   5e-67   Phaseolus vulgaris [French bean]
ref|XP_007160542.1|  hypothetical protein PHAVU_002G330400g             224   5e-67   Phaseolus vulgaris [French bean]
ref|XP_003525185.1|  PREDICTED: phosphoethanolamine N-methyltrans...    224   7e-67   
ref|XP_002456193.1|  hypothetical protein SORBIDRAFT_03g031940          224   8e-67   Sorghum bicolor [broomcorn]
ref|XP_008675146.1|  PREDICTED: phosphoethanolamine N-methyltrans...    223   1e-66   Zea mays [maize]
ref|XP_006393387.1|  hypothetical protein EUTSA_v10011451mg             223   2e-66   
emb|CDX93681.1|  BnaA06g03670D                                          223   2e-66   
emb|CDY40594.1|  BnaC06g02100D                                          223   2e-66   Brassica napus [oilseed rape]
ref|XP_008675144.1|  PREDICTED: phosphoethanolamine N-methyltrans...    223   2e-66   
gb|AAV67950.1|  putative phosphoethanolamine N-methyltransferase        223   2e-66   Zea mays [maize]
tpg|DAA57997.1|  TPA: putative phosphoethanolamine N-methyltransf...    223   2e-66   
ref|XP_010461685.1|  PREDICTED: phosphomethylethanolamine N-methy...    214   4e-66   Camelina sativa [gold-of-pleasure]
gb|AFZ78648.1|  methyl transferase                                      221   5e-66   Populus tomentosa [Chinese white poplar]
gb|AAL40895.1|  phosphoethanolamine methyltransferase                   221   2e-65   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010500398.1|  PREDICTED: phosphomethylethanolamine N-methy...    216   5e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010921205.1|  PREDICTED: phosphoethanolamine N-methyltrans...    214   2e-63   
ref|XP_002317875.2|  Phosphoethanolamine N-methyltransferase 1 fa...    203   4e-63   
ref|XP_002284594.1|  PREDICTED: phosphoethanolamine N-methyltrans...    214   4e-63   Vitis vinifera
gb|KJB53041.1|  hypothetical protein B456_008G289900                    213   6e-63   Gossypium raimondii
gb|KJB53038.1|  hypothetical protein B456_008G289900                    212   2e-62   Gossypium raimondii
gb|KJB53040.1|  hypothetical protein B456_008G289900                    212   2e-62   Gossypium raimondii
gb|KJB53039.1|  hypothetical protein B456_008G289900                    212   2e-62   Gossypium raimondii
emb|CDX92181.1|  BnaA05g22260D                                          211   5e-62   
gb|KJB30120.1|  hypothetical protein B456_005G132000                    210   6e-62   Gossypium raimondii
ref|XP_001763293.1|  predicted protein                                  209   2e-61   
gb|EEC79642.1|  hypothetical protein OsI_20868                          209   7e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_010655650.1|  PREDICTED: phosphomethylethanolamine N-methy...    208   8e-61   Vitis vinifera
ref|XP_006306318.1|  hypothetical protein CARUB_v10012188mg             199   9e-59   
emb|CDX95799.1|  BnaC05g35500D                                          201   2e-58   
gb|ABK24808.1|  unknown                                                 200   8e-58   Picea sitchensis
ref|XP_001768934.1|  predicted protein                                  197   4e-57   
ref|XP_002454522.1|  hypothetical protein SORBIDRAFT_04g032625          188   4e-57   
ref|XP_002969650.1|  hypothetical protein SELMODRAFT_146547             196   4e-56   Selaginella moellendorffii
ref|XP_002970912.1|  hypothetical protein SELMODRAFT_270875             196   4e-56   Selaginella moellendorffii
emb|CBI26879.3|  unnamed protein product                                192   8e-55   Vitis vinifera
gb|KHN10536.1|  Phosphoethanolamine N-methyltransferase                 192   8e-55   Glycine soja [wild soybean]
gb|AGO59019.1|  heat responsive transcription factor protein            190   4e-54   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010540184.1|  PREDICTED: phosphoethanolamine N-methyltrans...    188   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_006303561.1|  hypothetical protein CARUB_v10011038mg             188   3e-53   
gb|KDD75565.1|  hypothetical protein H632_c615p0                        178   2e-51   Helicosporidium sp. ATCC 50920
gb|KIZ00652.1|  hypothetical protein MNEG_7307                          170   1e-48   Monoraphidium neglectum
gb|EAY75471.1|  hypothetical protein OsI_03371                          175   2e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_004166030.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoethan...    175   2e-48   
ref|XP_004137342.1|  PREDICTED: phosphoethanolamine N-methyltrans...    175   2e-48   Cucumis sativus [cucumbers]
ref|XP_011399976.1|  Phosphoethanolamine N-methyltransferase            174   6e-48   Auxenochlorella protothecoides
ref|XP_010231068.1|  PREDICTED: phosphomethylethanolamine N-methy...    174   7e-48   Brachypodium distachyon [annual false brome]
ref|XP_002730517.1|  PREDICTED: phosphoethanolamine N-methyltrans...    164   1e-47   Saccoglossus kowalevskii
ref|XP_002594091.1|  hypothetical protein BRAFLDRAFT_68467              166   5e-47   Branchiostoma floridae
gb|EPS69227.1|  hypothetical protein M569_05544                         166   4e-46   Genlisea aurea
ref|XP_002594077.1|  hypothetical protein BRAFLDRAFT_68483              161   4e-45   Branchiostoma floridae
ref|XP_002594089.1|  hypothetical protein BRAFLDRAFT_118790             167   6e-45   Branchiostoma floridae
ref|XP_009011308.1|  hypothetical protein HELRODRAFT_71964              159   8e-45   Helobdella robusta
ref|XP_008324913.1|  PREDICTED: phosphoethanolamine N-methyltrans...    160   1e-42   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008324912.1|  PREDICTED: phosphoethanolamine N-methyltrans...    160   1e-42   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008324914.1|  PREDICTED: phosphoethanolamine N-methyltrans...    160   1e-42   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008453688.1|  PREDICTED: phosphoethanolamine N-methyltrans...    152   2e-42   Cucumis melo [Oriental melon]
ref|XP_008418601.1|  PREDICTED: phosphoethanolamine N-methyltrans...    159   3e-42   Poecilia reticulata
ref|XP_008418600.1|  PREDICTED: phosphoethanolamine N-methyltrans...    159   4e-42   Poecilia reticulata
gb|EMT23240.1|  Phosphoethanolamine N-methyltransferase 1               159   4e-42   
ref|XP_007550439.1|  PREDICTED: phosphoethanolamine N-methyltrans...    158   4e-42   Poecilia formosa
ref|XP_005096334.1|  PREDICTED: phosphoethanolamine N-methyltrans...    158   6e-42   Aplysia californica
ref|XP_005643867.1|  S-adenosyl-L-methionine-dependent methyltran...    157   1e-41   Coccomyxa subellipsoidea C-169
gb|ETM43048.1|  hypothetical protein L914_11412                         152   1e-41   Phytophthora parasitica
ref|XP_010864863.1|  PREDICTED: phosphoethanolamine N-methyltrans...    157   1e-41   Esox lucius
ref|XP_005806845.1|  PREDICTED: phosphoethanolamine N-methyltrans...    157   1e-41   Xiphophorus maculatus
ref|NP_001096276.2|  phosphoethanolamine methyltransferase              157   2e-41   Xenopus tropicalis [western clawed frog]
ref|XP_006003521.1|  PREDICTED: phosphoethanolamine N-methyltrans...    152   2e-41   
ref|XP_005723169.1|  PREDICTED: phosphoethanolamine N-methyltrans...    156   2e-41   Pundamilia nyererei
ref|XP_005723168.1|  PREDICTED: phosphoethanolamine N-methyltrans...    156   2e-41   
ref|XP_005723167.1|  PREDICTED: phosphoethanolamine N-methyltrans...    156   3e-41   Pundamilia nyererei
gb|ETK83171.1|  hypothetical protein L915_11577                         149   4e-41   Phytophthora parasitica
gb|AHY01341.1|  phosphoethanolamine methyltransferase                   148   5e-41   Carassius gibelio [gibel carp]
ref|XP_006781399.1|  PREDICTED: phosphoethanolamine N-methyltrans...    155   6e-41   Neolamprologus brichardi [lyretail cichlid]
ref|NP_001167350.1|  phosphoethanolamine N-methyltransferase 3          155   7e-41   Salmo salar
ref|XP_005913451.1|  PREDICTED: phosphoethanolamine N-methyltrans...    154   9e-41   Haplochromis burtoni
ref|XP_005467629.1|  PREDICTED: phosphoethanolamine N-methyltrans...    154   1e-40   Oreochromis niloticus
ref|XP_004545581.1|  PREDICTED: phosphoethanolamine N-methyltrans...    154   1e-40   
ref|XP_004545582.1|  PREDICTED: phosphoethanolamine N-methyltrans...    154   1e-40   
ref|XP_005467627.1|  PREDICTED: phosphoethanolamine N-methyltrans...    154   1e-40   Oreochromis niloticus
ref|XP_003444639.1|  PREDICTED: phosphoethanolamine N-methyltrans...    154   1e-40   Oreochromis niloticus
ref|XP_005913450.1|  PREDICTED: phosphoethanolamine N-methyltrans...    154   1e-40   Haplochromis burtoni
gb|ETL36539.1|  hypothetical protein L916_11495                         149   1e-40   Phytophthora parasitica
ref|XP_005096335.1|  PREDICTED: phosphoethanolamine N-methyltrans...    154   2e-40   Aplysia californica
gb|EWM27854.1|  phosphoethanolamine n-methyltransferase                 154   3e-40   Nannochloropsis gaditana
gb|KDO18851.1|  hypothetical protein SPRG_15850                         153   3e-40   Saprolegnia parasitica CBS 223.65
gb|AAI35513.1|  LOC100124841 protein                                    153   4e-40   Xenopus tropicalis [western clawed frog]
ref|NP_001070105.1|  phosphoethanolamine methyltransferase              153   4e-40   Danio rerio [leopard danio]
ref|XP_008620239.1|  hypothetical protein SDRG_15833                    153   4e-40   Saprolegnia diclina VS20
ref|XP_002898137.1|  phosphoethanolamine N-methyltransferase, put...    153   4e-40   Phytophthora infestans T30-4
ref|XP_008278559.1|  PREDICTED: phosphoethanolamine N-methyltrans...    152   8e-40   Stegastes partitus
ref|XP_008278560.1|  PREDICTED: phosphoethanolamine N-methyltrans...    152   8e-40   Stegastes partitus
ref|XP_008872791.1|  hypothetical protein H310_08714                    152   8e-40   Aphanomyces invadans
gb|EMT23241.1|  Phosphoethanolamine N-methyltransferase 1               152   9e-40   
ref|XP_009061459.1|  hypothetical protein LOTGIDRAFT_219756             152   1e-39   Lottia gigantea
ref|XP_005855505.1|  phosphoethanolamine n-methyltransferase            151   2e-39   Nannochloropsis gaditana CCMP526
ref|XP_009832411.1|  hypothetical protein H257_08283                    151   2e-39   Aphanomyces astaci
ref|XP_010655490.1|  PREDICTED: phosphomethylethanolamine N-methy...    150   2e-39   Vitis vinifera
emb|CBI26877.3|  unnamed protein product                                150   2e-39   Vitis vinifera
ref|NP_001087172.1|  phosphoethanolamine methyltransferase              150   3e-39   Xenopus laevis [clawed frog]
gb|EMT23242.1|  Putative phosphoethanolamine N-methyltransferase 2      147   4e-39   
ref|XP_010730440.1|  PREDICTED: phosphomethylethanolamine N-methy...    149   1e-38   
ref|XP_010730439.1|  PREDICTED: phosphomethylethanolamine N-methy...    149   1e-38   
emb|CAN75113.1|  hypothetical protein VITISV_043577                     148   1e-38   Vitis vinifera
ref|XP_004073222.1|  PREDICTED: phosphoethanolamine N-methyltrans...    148   2e-38   
gb|ETI43103.1|  hypothetical protein F443_11871                         142   2e-38   Phytophthora parasitica P1569
ref|XP_007440631.1|  PREDICTED: phosphomethylethanolamine N-methy...    147   4e-38   
gb|ETP40954.1|  hypothetical protein F442_11792                         143   5e-38   Phytophthora parasitica P10297
gb|ETP27600.1|  hypothetical protein F442_23122                         143   5e-38   Phytophthora parasitica P10297
ref|XP_003970259.1|  PREDICTED: phosphoethanolamine N-methyltrans...    145   2e-37   
gb|ELU13998.1|  hypothetical protein CAPTEDRAFT_140071                  138   3e-37   Capitella teleta
gb|ETL89752.1|  hypothetical protein L917_11366                         142   4e-37   
gb|ETK83144.1|  hypothetical protein L915_11579                         142   6e-37   
emb|CAG09731.1|  unnamed protein product                                144   8e-37   
gb|ELU02022.1|  hypothetical protein CAPTEDRAFT_91785                   137   2e-36   
ref|XP_009525377.1|  hypothetical protein PHYSODRAFT_354467             140   2e-36   
emb|CCI39434.1|  unnamed protein product                                141   6e-36   
ref|XP_002898136.1|  phosphoethanolamine N-methyltransferase            140   1e-35   
ref|XP_009525359.1|  hypothetical protein PHYSODRAFT_345888             139   3e-35   
emb|CCA16454.1|  phosphoethanolamine Nmethyltransferase putative        139   5e-35   
gb|ELT87122.1|  hypothetical protein CAPTEDRAFT_189076                  137   2e-34   
ref|XP_010677350.1|  PREDICTED: phosphoethanolamine N-methyltrans...    131   2e-32   
ref|XP_011453570.1|  PREDICTED: phosphoethanolamine N-methyltrans...    131   2e-32   
ref|XP_011453569.1|  PREDICTED: phosphoethanolamine N-methyltrans...    131   3e-32   
ref|XP_011453571.1|  PREDICTED: phosphoethanolamine N-methyltrans...    130   4e-32   
gb|EFX73213.1|  hypothetical protein DAPPUDRAFT_58148                   129   8e-32   
gb|KFM80232.1|  Phosphoethanolamine N-methyltransferase                 124   3e-31   
gb|EYC44164.1|  hypothetical protein Y032_0470g2031                     128   3e-31   
emb|CDJ81011.1|  Methyltransferase type 11 domain containing protein    128   3e-31   
gb|ETN83758.1|  methyltransferase domain protein                        127   3e-31   
ref|NP_494991.1|  Protein PMT-1, isoform b                              126   1e-30   
ref|XP_009862400.1|  PREDICTED: phosphoethanolamine N-methyltrans...    122   1e-30   
ref|XP_003108788.1|  CRE-PMT-1 protein                                  125   3e-30   
ref|NP_494990.2|  Protein PMT-1, isoform a                              125   3e-30   
ref|XP_006824126.1|  PREDICTED: phosphoethanolamine N-methyltrans...    120   4e-30   
ref|NP_871998.1|  Protein PMT-1, isoform d                              124   5e-30   
gb|EGT50464.1|  hypothetical protein CAEBREN_10892                      124   9e-30   
gb|EGT32041.1|  hypothetical protein CAEBREN_18341                      124   9e-30   
ref|XP_002630685.1|  C. briggsae CBR-PMT-1 protein                      123   1e-29   
pdb|4KRG|A  Chain A, Semet Haemonchus Contortus Phosphoethanolami...    119   6e-28   
emb|CDQ92053.1|  unnamed protein product                                112   9e-28   
gb|ERG79882.1|  phosphoethanolamine n-methyltransferase                 115   7e-27   
emb|CDM83854.1|  unnamed protein product                                114   2e-26   
gb|EKE08147.1|  Phosphoethanolamine N-methyltransferase                 110   2e-26   
ref|XP_010481025.1|  PREDICTED: phosphomethylethanolamine N-methy...    113   4e-26   
gb|ETO35874.1|  phosphoethanolamine N-methyltransferase 2 (NMT2)        107   1e-24   
emb|CDX74572.1|  BnaA04g08170D                                          102   4e-22   
ref|WP_027370305.1|  hypothetical protein                             96.3    8e-21   
emb|CDY35847.1|  BnaC09g37790D                                        96.3    3e-20   
emb|CDY07952.1|  BnaC03g35710D                                        96.7    3e-20   
ref|XP_011403472.1|  PREDICTED: phosphoethanolamine N-methyltrans...  94.7    3e-19   
emb|CEF71262.1|  Protein of unknown function DUF858, methyltransf...  94.7    4e-19   
ref|XP_794381.2|  PREDICTED: phosphoethanolamine N-methyltransfer...  93.2    1e-18   
ref|XP_008908105.1|  hypothetical protein PPTG_12690                  88.2    2e-18   
gb|ETO71745.1|  hypothetical protein F444_11961                       88.6    3e-18   
gb|ETO07474.1|  hypothetical protein RFI_29918                        88.2    4e-18   
gb|ETO01952.1|  hypothetical protein RFI_35487                        87.0    4e-18   
ref|WP_020209191.1|  hypothetical protein                             89.0    3e-17   
ref|XP_007228349.1|  PREDICTED: phosphoethanolamine N-methyltrans...  88.2    9e-17   
ref|XP_010774827.1|  PREDICTED: phosphoethanolamine N-methyltrans...  86.7    2e-16   
ref|WP_013610264.1|  Putative SAM-dependent methyltransferase         84.0    2e-16   
ref|XP_010314226.1|  PREDICTED: phosphoethanolamine N-methyltrans...  83.2    2e-15   
gb|KHJ94304.1|  hypothetical protein OESDEN_05765                     80.5    1e-14   
emb|CEF71482.1|  Protein of unknown function DUF858, methyltransf...  79.0    1e-13   
gb|AFK40181.1|  unknown                                               71.2    4e-13   
gb|AFW78992.1|  hypothetical protein ZEAMMB73_932976                  72.0    7e-13   
gb|ETO71769.1|  hypothetical protein F444_11956                       68.9    5e-12   
gb|ETP40963.1|  hypothetical protein F442_11783                       68.6    6e-12   
gb|KFG31924.1|  methyltransferase domain-containing protein           73.6    7e-12   
gb|EMT23239.1|  hypothetical protein F775_30181                       68.2    7e-12   
emb|CAJ20397.1|  hypothetical protein TgIa.1450                       73.6    8e-12   
ref|XP_002370184.1|  calpain, putative                                73.6    8e-12   
gb|KFH03254.1|  methyltransferase domain-containing protein           73.6    8e-12   
gb|KFG59470.1|  methyltransferase domain-containing protein           73.2    8e-12   
ref|XP_008884763.1|  methyltransferase domain-containing protein      69.7    1e-10   
ref|WP_038474864.1|  hypothetical protein                             63.2    5e-09   
gb|AFK44813.1|  unknown                                               60.5    1e-08   
ref|WP_017004055.1|  hypothetical protein                             60.1    8e-08   
ref|WP_016959600.1|  hypothetical protein                             60.1    8e-08   
ref|WP_038589229.1|  methyltransferase type 11                        59.7    8e-08   
ref|WP_030923479.1|  hypothetical protein                             60.1    9e-08   
ref|WP_042231279.1|  methyltransferase type 11                        59.3    1e-07   
ref|WP_029535633.1|  methyltransferase type 11                        58.9    1e-07   
ref|WP_028552340.1|  methyltransferase type 11                        58.5    2e-07   
gb|ETL89780.1|  hypothetical protein L917_11359                       55.5    2e-07   
gb|KIH63696.1|  hypothetical protein ANCDUO_06001                     55.5    4e-07   
ref|WP_002137162.1|  methyltransferase                                58.2    4e-07   
ref|WP_043801196.1|  malonyl-CoA O-methyltransferase                  56.2    4e-07   
ref|WP_042175094.1|  methyltransferase type 11                        57.8    4e-07   
ref|WP_020674224.1|  hypothetical protein                             57.4    5e-07   
gb|KCZ72303.1|  methyltransferase family protein                      57.4    8e-07   
gb|KJF71268.1|  SAM-dependent methyltransferase                       57.0    1e-06   
ref|WP_025592905.1|  SAM-dependent methyltransferase                  57.0    1e-06   
ref|WP_013635800.1|  methyltransferase                                57.0    1e-06   
ref|WP_019565359.1|  methyltransferase                                56.6    1e-06   
ref|WP_015850956.1|  SAM-dependent methyltransferase                  56.6    1e-06   
ref|WP_043281533.1|  hypothetical protein                             54.7    1e-06   
ref|WP_022493475.1|  phosphoethanolamine Nmethyltransferase putative  56.2    1e-06   
ref|WP_028971893.1|  methyltransferase type 11                        56.6    1e-06   
ref|WP_035218037.1|  SAM-dependent methyltransferase                  56.6    1e-06   
gb|EQB28536.1|  methylase involved in ubiquinone/menaquinone bios...  56.2    2e-06   
ref|WP_039871819.1|  methyltransferase type 11                        56.2    2e-06   
gb|KIH53398.1|  hypothetical protein ANCDUO_16477                     53.5    2e-06   
ref|WP_041268184.1|  hypothetical protein                             54.7    2e-06   
ref|WP_030320182.1|  ubiquinone biosynthesis methyltransferase UbiE   56.2    2e-06   
ref|WP_038490461.1|  SAM-dependent methyltransferase                  55.8    2e-06   
ref|WP_043778158.1|  methyltransferase type 11                        55.5    2e-06   
ref|WP_043330844.1|  ubiquinone biosynthesis protein                  54.7    3e-06   
ref|WP_038205258.1|  biotin synthase                                  55.8    3e-06   
gb|KJF69443.1|  SAM-dependent methyltransferase                       55.5    3e-06   
gb|KFM98367.1|  methyltransferase small domain protein                55.5    4e-06   
ref|WP_036343328.1|  ubiquinone biosynthesis protein                  54.7    4e-06   
ref|WP_036624290.1|  rRNA adenine methyltransferase                   55.8    4e-06   
gb|ABZ87545.1|  methyltransferase type 11                             54.7    4e-06   
ref|WP_009675881.1|  MULTISPECIES: methyltransferase type 11          55.1    4e-06   
ref|WP_040217132.1|  hypothetical protein                             55.5    4e-06   
gb|EWM66995.1|  methyltransferase                                     55.1    4e-06   
ref|WP_022555903.1|  Methyltransferase                                55.1    4e-06   
ref|WP_003512256.1|  methyltransferase                                55.1    4e-06   
ref|WP_006311543.1|  methyltransferase                                55.1    4e-06   
ref|WP_003501956.1|  methyltransferase                                55.1    5e-06   
ref|WP_009548140.1|  methylase involved in ubiquinone/menaquinone...  54.7    5e-06   
ref|WP_038675258.1|  methyltransferase type 11                        55.1    5e-06   
ref|WP_034729509.1|  SAM-dependent methyltransferase                  55.1    5e-06   
ref|WP_000655494.1|  ubiquinone biosynthesis methlytransferase UbiE   54.7    5e-06   
gb|EEL81767.1|  Methyltransferase type 11                             54.7    5e-06   
ref|WP_044458759.1|  SAM-dependent methyltransferase                  55.1    5e-06   
gb|AIF52542.1|  Methyltransferase type 11                             55.1    5e-06   
ref|WP_035210160.1|  SAM-dependent methyltransferase                  54.7    6e-06   
ref|WP_015365730.1|  Methyltransferase type 11                        54.7    6e-06   
gb|ETB50522.1|  methyltransferase type 11                             53.5    6e-06   
ref|WP_010971351.1|  MULTISPECIES: methyltransferase                  54.7    6e-06   
ref|WP_035015125.1|  hypothetical protein                             55.1    7e-06   
ref|WP_001987073.1|  Non-ribosomal peptide synthase, putative         55.5    7e-06   
ref|WP_042475209.1|  hypothetical protein                             55.5    7e-06   
ref|WP_037088919.1|  SAM-dependent methyltransferase                  54.3    9e-06   
ref|WP_016087553.1|  ubiquinone/menaquinone biosynthesis methyltr...  54.3    9e-06   
ref|WP_016134694.1|  ubiquinone/menaquinone biosynthesis methyltr...  54.3    9e-06   
gb|ETB43218.1|  methyltransferase type 11                             52.8    1e-05   
ref|WP_031167243.1|  hypothetical protein                             54.3    1e-05   
ref|WP_010899034.1|  methyltransferase type 11                        54.3    1e-05   
ref|WP_009589920.1|  methyltransferase type 11                        53.9    1e-05   
ref|WP_007154813.1|  biotin biosynthesis protein BioC                 54.3    1e-05   
ref|WP_025027294.1|  methyltransferase type 11                        54.3    1e-05   
ref|WP_032758401.1|  MULTISPECIES: hypothetical protein               53.9    1e-05   
ref|WP_002649363.1|  SAM-dependent methyltransferase                  53.9    1e-05   
ref|WP_018718509.1|  hypothetical protein                             53.9    1e-05   
ref|WP_009954416.1|  MULTISPECIES: methyltransferase type 11          53.9    1e-05   
ref|WP_014381807.1|  methyltransferase type 11                        53.9    1e-05   
ref|WP_036809035.1|  ubiquinone biosynthesis methyltransferase UbiE   53.5    1e-05   
ref|WP_014941284.1|  methyltransferase type 11                        53.9    1e-05   
ref|WP_014379131.1|  methyltransferase type 11                        53.9    2e-05   
ref|WP_003496924.1|  methyltransferase                                53.5    2e-05   
ref|WP_003190381.1|  methyltransferase                                53.5    2e-05   
ref|WP_032712033.1|  SAM-dependent methyltransferase                  53.5    2e-05   
ref|WP_004440929.1|  methyltransferase                                53.5    2e-05   
ref|WP_016129882.1|  hypothetical protein                             53.5    2e-05   
ref|WP_030171158.1|  ubiquinone biosynthesis methyltransferase UbiE   53.5    2e-05   
gb|AFM41472.1|  methylase involved in ubiquinone/menaquinone bios...  52.8    2e-05   
ref|WP_002066207.1|  methyltransferase                                53.5    2e-05   
ref|WP_021509832.1|  hypothetical protein                             53.1    2e-05   
ref|WP_014041811.1|  fibrillarin-like rRNA methylase                  52.8    2e-05   
ref|WP_002128087.1|  MULTISPECIES: methyltransferase                  53.5    2e-05   
ref|WP_032708748.1|  SAM-dependent methyltransferase                  53.1    2e-05   
ref|WP_006699398.1|  methyltransferase                                53.1    2e-05   
ref|WP_018213222.1|  methyltransferase type 11                        53.1    2e-05   
ref|WP_028608495.1|  methyltransferase type 11                        53.1    2e-05   
ref|WP_024732549.1|  hypothetical protein                             53.1    2e-05   
ref|WP_022595273.1|  putative Biotin biosynthesis protein BioC        53.1    2e-05   
ref|WP_016101074.1|  hypothetical protein                             53.1    2e-05   
gb|EMS98141.1|  methyltransferase                                     53.1    2e-05   
ref|WP_002033133.1|  MULTISPECIES: methyltransferase                  53.1    2e-05   
ref|WP_026932721.1|  methyltransferase type 11                        52.4    3e-05   
ref|WP_035237741.1|  SAM-dependent methyltransferase                  53.1    3e-05   
ref|WP_002142407.1|  MULTISPECIES: methyltransferase                  53.1    3e-05   
ref|WP_009366385.1|  S-adenosylmethionine-dependent methyltransfe...  52.8    3e-05   
ref|WP_020009542.1|  MULTISPECIES: methyltransferase                  52.8    3e-05   
ref|WP_034829698.1|  methyltransferase type 11                        52.8    3e-05   
ref|WP_020078296.1|  SAM-dependent methyltransferase                  52.8    3e-05   
ref|WP_028164399.1|  SAM-dependent methyltransferase                  52.8    3e-05   
gb|ELP57482.1|  hypothetical protein F502_19446                       52.8    3e-05   
ref|WP_032714967.1|  SAM-dependent methyltransferase                  52.8    3e-05   
ref|WP_028025295.1|  biotin synthase                                  53.1    3e-05   
ref|WP_026682185.1|  ubiquinone biosynthesis methyltransferase UbiE   52.8    3e-05   
ref|WP_035774675.1|  hypothetical protein                             53.1    3e-05   
ref|WP_008253539.1|  methyltransferase-UbiE family protein            52.8    3e-05   
ref|WP_005707515.1|  hypothetical protein                             52.8    3e-05   
ref|WP_036547124.1|  hypothetical protein                             52.8    3e-05   
ref|WP_001968674.1|  methyltransferase                                52.8    4e-05   
dbj|GAF27217.1|  methylase                                            52.4    4e-05   
ref|WP_000812695.1|  methyltransferase                                52.8    4e-05   
ref|WP_038256373.1|  SAM-dependent methyltransferase                  52.4    4e-05   
ref|WP_010178217.1|  Biotin biosynthesis protein BioC                 52.8    4e-05   
ref|WP_040903760.1|  SAM-dependent methyltransferase                  52.4    4e-05   
ref|WP_009792281.1|  MULTISPECIES: ubiquinone biosynthesis methyl...  52.4    4e-05   
ref|WP_028544807.1|  methyltransferase type 11                        52.4    4e-05   
ref|WP_023866537.1|  methyltransferase type 11                        52.8    4e-05   
ref|WP_039983829.1|  biotin synthase                                  52.4    4e-05   
ref|WP_033711115.1|  MULTISPECIES: methyltransferase type 11          52.4    4e-05   
gb|EHM45042.1|  methyltransferase domain protein                      52.4    4e-05   
dbj|GAK84382.1|  biotin synthesis protein BioC                        52.0    5e-05   
ref|WP_002787593.1|  type 11 methyltransferase                        52.8    5e-05   
ref|WP_014710950.1|  MULTISPECIES: methyltransferase type 11          52.4    5e-05   
gb|AAS02988.1|  hypothetical protein MAP_0671                         52.8    5e-05   
ref|WP_007981656.1|  S-adenosylmethionine-dependent methyltransfe...  52.0    6e-05   
ref|WP_009974977.1|  methyltransferase type 11                        52.0    6e-05   
gb|ELP47551.1|  hypothetical protein D522_03959                       52.4    6e-05   
ref|WP_019733079.1|  methyltransferase type 11                        52.0    6e-05   
ref|WP_023394424.1|  N-methyltransferase-like protein                 52.0    6e-05   
ref|WP_022604334.1|  putative Biotin biosynthesis protein BioC        52.0    6e-05   
ref|WP_004406035.1|  biotin synthase                                  52.0    6e-05   
ref|WP_003873068.1|  methyltransferase type 11                        52.0    6e-05   
ref|WP_017249948.1|  methyltransferase type 11                        51.6    7e-05   
ref|WP_000812399.1|  methyltransferase                                52.0    7e-05   
ref|WP_003452268.1|  Methyltransferase type 11                        52.0    7e-05   
ref|WP_022551161.1|  putative Biotin biosynthesis protein BioC        52.0    7e-05   
ref|WP_013433494.1|  fibrillarin-like rRNA methylase                  51.2    8e-05   
ref|WP_025147982.1|  methyltransferase                                51.6    8e-05   
ref|WP_011322316.1|  S-adenosylmethionine-dependent methyltransfe...  51.6    8e-05   
gb|EFC74027.1|  methyltransferase domain protein                      51.6    8e-05   
ref|WP_036885867.1|  methyltransferase type 12                        51.6    8e-05   
ref|WP_000655497.1|  ubiquinone biosynthesis methyltransferase UbiE   51.6    8e-05   
ref|WP_023505824.1|  methylase involved in ubiquinone/menaquinone...  51.6    9e-05   
ref|WP_021061842.1|  methylase involved in ubiquinone/menaquinone...  51.6    9e-05   
ref|WP_000655484.1|  ubiquinone biosynthesis methlytransferase UbiE   51.2    9e-05   
ref|WP_015323802.1|  methylase involved in ubiquinone/menaquinone...  51.2    9e-05   
gb|ACM13068.1|  methylase                                             51.2    9e-05   
ref|WP_034771182.1|  SAM-dependent methyltransferase                  51.6    9e-05   
gb|AAS41742.1|  methylase                                             51.2    1e-04   
ref|WP_023869752.1|  methyltransferase type 11                        51.6    1e-04   
ref|WP_005378220.1|  biotin synthase                                  51.6    1e-04   
dbj|GAK14959.1|  biotin synthesis protein BioC                        51.6    1e-04   



>ref|XP_009616694.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=491

 Score =   260 bits (664),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA  G+EREVQKSYW+EH++ELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAATSGQEREVQKSYWMEHTAELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELA+KAGQ+IA+DFIE  IKKNE+INGH  N+KFMCADVTS DLNFS ES+
Sbjct  61   GAGIGRFTGELAKKAGQLIALDFIEGAIKKNESINGHHKNVKFMCADVTSPDLNFSPESV  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD EV+ L  RMVKWLK
Sbjct  121  DLIFSNWLLMYLSDGEVQYLVERMVKWLK  149



>ref|XP_009757363.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=491

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA  G+EREVQKSYW+EH++ELTVEAMMLDSKAADLDKEERPEV+S+LP YEGKSVLEL
Sbjct  1    MAATSGQEREVQKSYWMEHTAELTVEAMMLDSKAADLDKEERPEVVSLLPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELA+KAGQ+IA+DFIE  IKKNE+INGH  N+KFMCADVTS DLNFS ES+
Sbjct  61   GAGIGRFTGELAKKAGQLIALDFIEGAIKKNESINGHHKNVKFMCADVTSPDLNFSPESV  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD EV+ L  RMVKWLK
Sbjct  121  DLIFSNWLLMYLSDGEVQDLVERMVKWLK  149



>ref|XP_011084235.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Sesamum indicum]
Length=491

 Score =   258 bits (659),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA Q +EREVQKSYWIEHS +LT+EAMMLDSKA+DLDKEERPEVLS+LP YEGKS+LEL
Sbjct  1    MAAIQEQEREVQKSYWIEHSVDLTLEAMMLDSKASDLDKEERPEVLSLLPPYEGKSILEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELA+K+GQ+IA+DFIE+VIKKNETINGH  N+KF+CADVTS+DLNFS+ S+
Sbjct  61   GAGIGRFTGELAKKSGQLIALDFIETVIKKNETINGHHKNVKFLCADVTSRDLNFSEGSL  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE+L  RMV+WLK
Sbjct  121  DLIFSNWLLMYLSDEEVENLVERMVRWLK  149



>ref|XP_009614862.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=499

 Score =   258 bits (659),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +3

Query  123  TAIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYE  302
              ++ +A  A  G+ER+VQK+YWIEH+SELTVEAMMLDSKAADLDKEERPEVLS+LP+YE
Sbjct  2    APVISAATTASSGQERDVQKNYWIEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPSYE  61

Query  303  GKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDL  482
            GKSVLELGAGIGRFTGELA+ AGQ+IA+DFIES IKKNE+IN H  N+KFMCADVTS DL
Sbjct  62   GKSVLELGAGIGRFTGELAKNAGQLIALDFIESAIKKNESINRHHKNVKFMCADVTSPDL  121

Query  483  NFSDESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
             FS ES+DLIFSNWLLMYLSD+EV+SL  RMVKWLK
Sbjct  122  KFSPESVDLIFSNWLLMYLSDEEVQSLVERMVKWLK  157



>ref|XP_002282182.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Vitis 
vinifera]
 emb|CBI15568.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA  G+ERE+QK+YW EHS++LTVEAMMLDSKAADLDKEERPEVLS+LP +EGKSVLEL
Sbjct  1    MAAQVGQEREIQKNYWAEHSADLTVEAMMLDSKAADLDKEERPEVLSLLPPFEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAGQVI++DFIESVIKKNE+INGH  N+KFMCADV S +LNFS ES+
Sbjct  61   GAGIGRFTGELAQKAGQVISLDFIESVIKKNESINGHYKNVKFMCADVASPELNFSAESV  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  RMVKWLK
Sbjct  121  DLIFSNWLLMYLSDKEVEELVERMVKWLK  149



>ref|XP_007209941.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11140.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=463

 Score =   255 bits (651),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLEL
Sbjct  1    MAAPNGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTGELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            D+IFSNWLLMYLSD+EVE+L  RM+ WLK
Sbjct  121  DMIFSNWLLMYLSDKEVENLVERMMGWLK  149



>ref|NP_001234549.1| phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
 gb|AAG59894.1|AF328858_1 phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=491

 Score =   255 bits (652),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA  G+EREVQKSYWIEH++ELTVEAMMLDSKAADLDKEERPEVLS+LP YEGK+VLEL
Sbjct  1    MAAASGQEREVQKSYWIEHTAELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKTVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAGQ+IA+DFIE  IKKNE INGH  N+KFMCADVTS +L FS ES+
Sbjct  61   GAGIGRFTGELAQKAGQLIALDFIEGAIKKNENINGHYKNVKFMCADVTSPNLIFSPESV  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EV++L  RMV WLK
Sbjct  121  DLIFSNWLLMYLSDEEVKALVERMVIWLK  149



>ref|XP_006341528.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006341529.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Solanum tuberosum]
Length=491

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            M A  G+EREVQKSYWIEH++ELTVEAMMLDSKAADLDKEERPEVLS+LP YEGK+VLEL
Sbjct  1    MDAASGQEREVQKSYWIEHTAELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKTVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELA KAGQ+IA+DFIE  IKKNE ING+  N+KFMCADVTS +LNFS ES+
Sbjct  61   GAGIGRFTGELANKAGQLIALDFIEGAIKKNENINGYHKNVKFMCADVTSPNLNFSPESV  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EV++L  RMVKWLK
Sbjct  121  DLIFSNWLLMYLSDEEVKALVERMVKWLK  149



>emb|CAN64744.1| hypothetical protein VITISV_041321 [Vitis vinifera]
Length=490

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 137/149 (92%), Gaps = 1/149 (1%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA QG+ERE+QK+YW EHS++LTVEAMMLDSKAADLDKEERPEVLS+LP +EGKSVLEL
Sbjct  1    MAA-QGQEREIQKNYWAEHSADLTVEAMMLDSKAADLDKEERPEVLSLLPPFEGKSVLEL  59

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFT ELAQKAGQVI++DFIESVIKKNE+INGH  N+KFMCADV S +LNFS ES+
Sbjct  60   GAGIGRFTXELAQKAGQVISLDFIESVIKKNESINGHYKNVKFMCADVASPELNFSAESV  119

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  RMVKWLK
Sbjct  120  DLIFSNWLLMYLSDKEVEELVERMVKWLK  148



>ref|XP_007209942.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11141.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=491

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLEL
Sbjct  1    MAAPNGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTGELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            D+IFSNWLLMYLSD+EVE+L  RM+ WLK
Sbjct  121  DMIFSNWLLMYLSDKEVENLVERMMGWLK  149



>ref|XP_007209943.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11142.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=493

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLEL
Sbjct  1    MAAPNGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTGELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            D+IFSNWLLMYLSD+EVE+L  RM+ WLK
Sbjct  121  DMIFSNWLLMYLSDKEVENLVERMMGWLK  149



>ref|XP_010533969.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Tarenaya 
hassleriana]
Length=491

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MA+  GEERE+QKSYW+EHS++LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MASSYGEEREIQKSYWMEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAG+VIA+DFIES IKKNE++NGH  N+KFMC DVTS DL  +DESI
Sbjct  61   GAGIGRFTGELAQKAGEVIAIDFIESAIKKNESVNGHYKNVKFMCMDVTSPDLKITDESI  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DL+FSNWLLMYLSD+EVE L  RM++W+K
Sbjct  121  DLLFSNWLLMYLSDKEVEHLAERMLRWVK  149



>ref|XP_011072995.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Sesamum 
indicum]
Length=491

 Score =   253 bits (646),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA Q +EREVQKSYW+EHS +LT+EAMMLDS A DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAANQEQEREVQKSYWMEHSVDLTLEAMMLDSNACDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELA+KAG+++A+DFIESVIKKNETINGH  N+KFMCADVTS DLNF + S+
Sbjct  61   GAGIGRFTGELAKKAGELVALDFIESVIKKNETINGHNKNVKFMCADVTSPDLNFPEGSL  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  RMVKWLK
Sbjct  121  DLIFSNWLLMYLSDKEVEDLAQRMVKWLK  149



>ref|XP_010097563.1| hypothetical protein L484_017373 [Morus notabilis]
 gb|EXB69095.1| hypothetical protein L484_017373 [Morus notabilis]
Length=503

 Score =   253 bits (646),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +3

Query  129  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  308
            +  +A     G+ERE QK YW++HS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK
Sbjct  1    MADAATVNANGQEREKQKIYWMQHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGK  60

Query  309  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  488
            SVLELGAGIGRFT ELAQKAGQ++AMDFIESVIKKNE+INGH  N+KFMCADVTS DLN 
Sbjct  61   SVLELGAGIGRFTSELAQKAGQLVAMDFIESVIKKNESINGHYKNVKFMCADVTSPDLNI  120

Query  489  SDESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            S++S+DLIFSNWLLMYLSD+EVE+L  RMVKWLK
Sbjct  121  SEDSVDLIFSNWLLMYLSDKEVENLAERMVKWLK  154



>ref|XP_011084227.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Sesamum indicum]
Length=494

 Score =   252 bits (644),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  153  FQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAG  332
            F  +EREVQKSYWIEHS +LT+EAMMLDSKA+DLDKEERPEVLS+LP YEGKS+LELGAG
Sbjct  7    FVEQEREVQKSYWIEHSVDLTLEAMMLDSKASDLDKEERPEVLSLLPPYEGKSILELGAG  66

Query  333  IGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLI  512
            IGRFTGELA+K+GQ+IA+DFIE+VIKKNETINGH  N+KF+CADVTS+DLNFS+ S+DLI
Sbjct  67   IGRFTGELAKKSGQLIALDFIETVIKKNETINGHHKNVKFLCADVTSRDLNFSEGSLDLI  126

Query  513  FSNWLLMYLSDQEVESLXXRMVKWLK  590
            FSNWLLMYLSD+EVE+L  RMV+WLK
Sbjct  127  FSNWLLMYLSDEEVENLVERMVRWLK  152



>ref|XP_002532097.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
 gb|EEF30287.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
Length=492

 Score =   252 bits (644),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 137/150 (91%), Gaps = 1/150 (1%)
 Frame = +3

Query  144  MAAFQG-EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  320
            MAA Q  EEREVQK+YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLS+LP+YEGKSVLE
Sbjct  1    MAAAQNVEEREVQKNYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSLLPSYEGKSVLE  60

Query  321  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  500
             GAGIGRFTGELAQKAGQ++A+DFIESVIKKNE INGH  N+KFMCADVTS+ L FS+ES
Sbjct  61   FGAGIGRFTGELAQKAGQLVAVDFIESVIKKNENINGHHKNVKFMCADVTSQGLKFSEES  120

Query  501  IDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            +DLIFSNWLLMYLSD+EV +L  RMVKWLK
Sbjct  121  VDLIFSNWLLMYLSDEEVVNLAERMVKWLK  150



>ref|XP_010519218.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Tarenaya hassleriana]
Length=510

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +3

Query  132  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  311
            + S+++   GEERE+QKSYW EHS +L+VEAMMLDSKAADLDKEERPE+LS+LP YEGKS
Sbjct  7    ISSSLSKHNGEEREIQKSYWTEHSVDLSVEAMMLDSKAADLDKEERPEILSILPPYEGKS  66

Query  312  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  491
            VLE GAGIGRFTGE A KAGQVIA+DFI+SVIKKNE INGH  N+KFMCADVTS +L FS
Sbjct  67   VLEFGAGIGRFTGEFALKAGQVIAVDFIDSVIKKNENINGHHKNVKFMCADVTSPELKFS  126

Query  492  DESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DES+DLIFSNWLLMYLSD+EVE L  RM++WLK
Sbjct  127  DESVDLIFSNWLLMYLSDKEVEDLARRMLQWLK  159



>gb|KJB30121.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=422

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  141  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  320
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  321  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  500
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  501  IDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            +DLIFSNWLLMYLSD+EVE+L  RM+KWLK
Sbjct  122  LDLIFSNWLLMYLSDKEVENLAERMLKWLK  151



>ref|XP_008240154.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Prunus mume]
Length=485

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAANGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFT ELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTAELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            D+IFSNWLLMYLSD+EVE+L  RM+ WLK
Sbjct  121  DMIFSNWLLMYLSDKEVENLVERMMGWLK  149



>gb|KJB30119.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=443

 Score =   249 bits (637),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  141  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  320
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  321  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  500
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  501  IDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            +DLIFSNWLLMYLSD+EVE+L  RM+KWLK
Sbjct  122  LDLIFSNWLLMYLSDKEVENLAERMLKWLK  151



>ref|XP_010033717.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Eucalyptus 
grandis]
 gb|KCW84063.1| hypothetical protein EUGRSUZ_B00946 [Eucalyptus grandis]
Length=491

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA QG+ER VQKSYW EHS+ LTVEAMMLDSKA+DLDKEERPE+LS+LP YEGK+VLEL
Sbjct  1    MAAAQGDERHVQKSYWAEHSASLTVEAMMLDSKASDLDKEERPEILSLLPPYEGKTVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAGQ++A+DFI+  IKKNE+INGH  N+KF CADVTS DLN ++ES+
Sbjct  61   GAGIGRFTGELAQKAGQLLALDFIDGAIKKNESINGHHKNVKFQCADVTSPDLNIAEESV  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD EVE+L  RM KWLK
Sbjct  121  DLIFSNWLLMYLSDTEVENLAERMTKWLK  149



>ref|XP_010519219.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Tarenaya hassleriana]
Length=499

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 134/149 (90%), Gaps = 1/149 (1%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA+ GEERE+QKSYW EHS +L+VEAMMLDSKAADLDKEERPE+LS+LP YEGKSVLE 
Sbjct  1    MAAY-GEEREIQKSYWTEHSVDLSVEAMMLDSKAADLDKEERPEILSILPPYEGKSVLEF  59

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGE A KAGQVIA+DFI+SVIKKNE INGH  N+KFMCADVTS +L FSDES+
Sbjct  60   GAGIGRFTGEFALKAGQVIAVDFIDSVIKKNENINGHHKNVKFMCADVTSPELKFSDESV  119

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  RM++WLK
Sbjct  120  DLIFSNWLLMYLSDKEVEDLARRMLQWLK  148



>ref|XP_008240152.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Prunus mume]
Length=491

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAANGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFT ELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTAELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            D+IFSNWLLMYLSD+EVE+L  RM+ WLK
Sbjct  121  DMIFSNWLLMYLSDKEVENLVERMMGWLK  149



>gb|KJB30123.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=464

 Score =   249 bits (637),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  141  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  320
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  321  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  500
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  501  IDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            +DLIFSNWLLMYLSD+EVE+L  RM+KWLK
Sbjct  122  LDLIFSNWLLMYLSDKEVENLAERMLKWLK  151



>gb|ABX10444.1| phosphoethanolamine N-methyltransferase [Gossypium hirsutum]
Length=475

 Score =   249 bits (637),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  141  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  320
            A   F G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGFVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  321  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  500
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  501  IDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            +DLIFSNWLLMYLSD+EVE+L  RM+KWLK
Sbjct  122  LDLIFSNWLLMYLSDKEVENLAERMLKWLK  151



>gb|AAP83582.1| phosphoethanolamine N-methyltransferase [Brassica napus]
Length=491

 Score =   250 bits (638),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA    ER+VQK+YWIEHS++LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEAERDVQKNYWIEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DLN +D SI
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLNITDGSI  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  RMV W+K
Sbjct  121  DLIFSNWLLMYLSDKEVELLVERMVGWIK  149



>gb|KHG16117.1| Phosphoethanolamine N-methyltransferase 1 -like protein [Gossypium 
arboreum]
Length=486

 Score =   249 bits (637),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  141  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  320
            A   F G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGFVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  321  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  500
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  501  IDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            +DLIFSNWLLMYLSD+EVE+L  RM+KWLK
Sbjct  122  LDLIFSNWLLMYLSDKEVENLAERMLKWLK  151



>ref|XP_009145948.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Brassica 
rapa]
Length=492

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 137/150 (91%), Gaps = 1/150 (1%)
 Frame = +3

Query  141  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  320
            A A+F+ E R+VQK+YWIEHS++LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLE
Sbjct  2    AAASFEAE-RDVQKNYWIEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLE  60

Query  321  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  500
            LGAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DLN +D S
Sbjct  61   LGAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLNITDGS  120

Query  501  IDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            IDLIFSNWLLMYLSD+EVE L  RMV W+K
Sbjct  121  IDLIFSNWLLMYLSDKEVELLVERMVGWIK  150



>ref|XP_004299531.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Fragaria vesca subsp. vesca]
Length=500

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +3

Query  135  QSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSV  314
            ++A A   G+ERE+QKSYW E+S+ELTVE+MMLDSKA+DLDKEERPEVL+MLP YEGKSV
Sbjct  7    RTATANGSGKEREIQKSYWEENSTELTVESMMLDSKASDLDKEERPEVLAMLPPYEGKSV  66

Query  315  LELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSD  494
            LELGAGIGRFTGELAQKAGQ+IAMDFIE+VIKKNE+ING+  N+KFMCADVTS DL  S+
Sbjct  67   LELGAGIGRFTGELAQKAGQLIAMDFIENVIKKNESINGNHKNVKFMCADVTSPDLKISE  126

Query  495  ESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            ES+DLIFSNWLLMYL D+EVE+L  RM+KWLK
Sbjct  127  ESVDLIFSNWLLMYLCDKEVENLAARMMKWLK  158



>ref|XP_010487710.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Camelina sativa]
Length=491

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLEL
Sbjct  1    MAATYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  RMV W+K
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMVGWIK  149



>ref|XP_004252273.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Solanum lycopersicum]
Length=500

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  138  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  317
            +   A  G+ER++QK+YW+EH+SELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVL
Sbjct  8    AGAGAKSGQERDIQKNYWMEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVL  67

Query  318  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  497
            ELGAGIGRFT ELA+ AGQ+IA+DFIES IKKNE+IN H  N+KFMCADVTS DL FS E
Sbjct  68   ELGAGIGRFTSELAKNAGQLIALDFIESAIKKNESINKHHKNVKFMCADVTSPDLKFSPE  127

Query  498  SIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            S+DLIFSNWLLMYLSD+EV+SL  RMVKWLK
Sbjct  128  SVDLIFSNWLLMYLSDEEVQSLVERMVKWLK  158



>ref|XP_007036802.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY21303.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=493

 Score =   249 bits (635),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +EREVQK YW+EHS +LTVEAMMLDSKAADLDKEERPEVLS+LP YEGKS+LELGAGIGR
Sbjct  9    DEREVQKDYWMEHSLDLTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSILELGAGIGR  68

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELAQKAG VIA+DFIESVIKKNE+INGH  N KF+CADVTS DL FS+ S+DLIFSN
Sbjct  69   FTGELAQKAGHVIALDFIESVIKKNESINGHYKNAKFLCADVTSPDLKFSEGSLDLIFSN  128

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+E+E+L  RMVKWLK
Sbjct  129  WLLMYLSDKEIENLAERMVKWLK  151



>ref|XP_007036803.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY21304.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=494

 Score =   249 bits (635),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +EREVQK YW+EHS +LTVEAMMLDSKAADLDKEERPEVLS+LP YEGKS+LELGAGIGR
Sbjct  9    DEREVQKDYWMEHSLDLTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSILELGAGIGR  68

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELAQKAG VIA+DFIESVIKKNE+INGH  N KF+CADVTS DL FS+ S+DLIFSN
Sbjct  69   FTGELAQKAGHVIALDFIESVIKKNESINGHYKNAKFLCADVTSPDLKFSEGSLDLIFSN  128

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+E+E+L  RMVKWLK
Sbjct  129  WLLMYLSDKEIENLAERMVKWLK  151



>gb|KJB30117.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=494

 Score =   249 bits (635),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  141  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  320
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  321  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  500
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  501  IDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            +DLIFSNWLLMYLSD+EVE+L  RM+KWLK
Sbjct  122  LDLIFSNWLLMYLSDKEVENLAERMLKWLK  151



>ref|XP_010506242.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Camelina sativa]
Length=491

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAATYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  RMV W+K
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMVGWIK  149



>ref|XP_008364653.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 136/150 (91%), Gaps = 1/150 (1%)
 Frame = +3

Query  144  MAAF-QGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  320
            MAAF  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+E
Sbjct  1    MAAFANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVVE  60

Query  321  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  500
            LGAGIGRFTGELA+KAGQ+ A+DFI+SVIKKNE+INGH  N+KFMCADVTS DL  S+ S
Sbjct  61   LGAGIGRFTGELAEKAGQLFALDFIDSVIKKNESINGHHKNVKFMCADVTSPDLKISENS  120

Query  501  IDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            +DL+FSNWLLMYLSD EVE+L  RM+ WLK
Sbjct  121  VDLVFSNWLLMYLSDXEVENLVERMMGWLK  150



>gb|EYU33965.1| hypothetical protein MIMGU_mgv1a005263mg [Erythranthe guttata]
Length=491

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA Q EERE+QKSYW+EHS +LT+E+MMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAVQDEEREMQKSYWVEHSVDLTLESMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELA+KAGQ++A+DFIE  IKKNE INGH  N+KFMCADVTS  L+F D S 
Sbjct  61   GAGIGRFTGELAKKAGQLVALDFIEGSIKKNEIINGHHKNVKFMCADVTSPSLSFPDGSF  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE+L  RMVKWLK
Sbjct  121  DLIFSNWLLMYLSDKEVENLAQRMVKWLK  149



>gb|KJB30122.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=491

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 137/149 (92%), Gaps = 1/149 (1%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA  G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LEL
Sbjct  1    MAA-NGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILEL  59

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S+
Sbjct  60   GAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGSL  119

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE+L  RM+KWLK
Sbjct  120  DLIFSNWLLMYLSDKEVENLAERMLKWLK  148



>gb|KDP23922.1| hypothetical protein JCGZ_27082 [Jatropha curcas]
Length=510

 Score =   248 bits (633),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EERE+Q++YW+EHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP+YEGKSVLE GAGIGR
Sbjct  26   EEREIQRNYWMEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPSYEGKSVLEFGAGIGR  85

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGE+AQ AGQ++A+DFI+SVIKKNE+INGH  N+KF+CADVTS+DL FS+ S+DLIFSN
Sbjct  86   FTGEIAQNAGQLVALDFIDSVIKKNESINGHYKNVKFICADVTSQDLKFSEGSVDLIFSN  145

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE+L  RMVKWLK
Sbjct  146  WLLMYLSDKEVENLVERMVKWLK  168



>ref|XP_009776424.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
sylvestris]
Length=499

 Score =   248 bits (632),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +ER+VQK+YWIEH+SELTVEAMMLDSKAADLDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  15   QERDVQKNYWIEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPSYEGKSVLELGAGIGR  74

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FT ELA+ AGQ++A+DFIES IKKNE+IN H  N+KFMCADVTS DL FS ES+DLIFSN
Sbjct  75   FTSELAKNAGQLLALDFIESAIKKNESINSHHKNVKFMCADVTSPDLKFSPESVDLIFSN  134

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EV+SL  RMVKWLK
Sbjct  135  WLLMYLSDEEVQSLVERMVKWLK  157



>ref|XP_002883100.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59359.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=491

 Score =   247 bits (631),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  RMV W+K
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMVGWIK  149



>ref|XP_008360927.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Malus domestica]
Length=492

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  326
            A+  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEG+SV+ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGQSVVELG  62

Query  327  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  506
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADVTS DL  S+ S+D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVTSPDLKISEGSVD  122

Query  507  LIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            LIFSNWLLMYLSD+EVE L  RM+ WLK
Sbjct  123  LIFSNWLLMYLSDKEVEKLVERMMGWLK  150



>emb|CDO98349.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA +G+EREVQKSYWIEH+++LTVEAMMLDS AADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAVEGQEREVQKSYWIEHTADLTVEAMMLDSMAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELA+KAGQ++A+DFIE  IKKNE+ING+L N KF+CADVTS +L+FS ES+
Sbjct  61   GAGIGRFTGELAKKAGQIVALDFIEGAIKKNESINGNLKNTKFICADVTSPELHFSAESM  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EV +L  +MV WLK
Sbjct  121  DLIFSNWLLMYLSDEEVVTLAKKMVGWLK  149



>ref|XP_006346642.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Solanum 
tuberosum]
Length=500

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  159  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  338
            GEER++QK+YW+EH+SELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLELGAGIG
Sbjct  15   GEERDIQKNYWMEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLELGAGIG  74

Query  339  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  518
            RFT ELA+ AGQ+IA+DFI+S IKKN++IN H  N+KFMCADVTS DL FS ES+DLIFS
Sbjct  75   RFTSELAKNAGQLIALDFIDSAIKKNKSINKHHKNVKFMCADVTSPDLKFSPESVDLIFS  134

Query  519  NWLLMYLSDQEVESLXXRMVKWLK  590
            NWLLMYLSD+EV+SL  RMVKWLK
Sbjct  135  NWLLMYLSDEEVQSLVERMVKWLK  158



>ref|XP_010263678.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nelumbo 
nucifera]
Length=489

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA QG ERE+QKSYWIEHS +LTVEAMMLDSKA+DLDKEERPEVLS+LP ++GKSVLEL
Sbjct  1    MAA-QGGEREIQKSYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSLLPPFKGKSVLEL  59

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELA++AGQV+A+DFIE+VIKKNE+INGH  N+KF+CADVTS DL  + ES+
Sbjct  60   GAGIGRFTGELAKEAGQVLALDFIENVIKKNESINGHHKNVKFLCADVTSPDLQIASESV  119

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE+L  RM KWLK
Sbjct  120  DLIFSNWLLMYLSDKEVENLAERMAKWLK  148



>ref|XP_010487709.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Camelina sativa]
Length=494

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  10   EERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLELGAGIGR  69

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS DL  +D S+DLIFSN
Sbjct  70   FTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPDLKITDGSLDLIFSN  129

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE L  RMV W+K
Sbjct  130  WLLMYLSDKEVELLAERMVGWIK  152



>ref|XP_006406666.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
 gb|ESQ48119.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
Length=491

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP +EGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPFEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DL  +D SI
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLKITDGSI  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  RMV W+K
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMVGWIK  149



>ref|NP_188427.2| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
 sp|Q9FR44.1|PEAM1_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 1; Short=AtNMT1; 
Short=PEAMT 1; AltName: Full=Protein XIPOTL 1 [Arabidopsis 
thaliana]
 gb|AAG41121.1|AF197940_1 SAM:phospho-ethanolamine N-methyltransferase [Arabidopsis thaliana]
 gb|AAK32886.1|AF367299_1 AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAL25589.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAM10282.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AEE76033.1| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
Length=491

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAG++IA+DFI++VIKKNE+INGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDNVIKKNESINGHYKNVKFMCADVTSPDLKITDGSL  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  RMV W+K
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMVGWIK  149



>dbj|BAB02720.1| methyl transferase-like protein [Arabidopsis thaliana]
Length=498

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAG++IA+DFI++VIKKNE+INGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDNVIKKNESINGHYKNVKFMCADVTSPDLKITDGSL  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  RMV W+K
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMVGWIK  149



>gb|AAM13092.1| unknown protein [Arabidopsis thaliana]
Length=491

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAG++IA+DFI++VIKKNE+INGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDNVIKKNESINGHYKNVKFMCADVTSPDLKITDGSL  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  RMV W+K
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMVGWIK  149



>ref|XP_002891445.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67704.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MA    +ER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLEL
Sbjct  1    MATPYKKERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAG+VIA+DFIES IKKNE++NGH  NIKFMCADVTS DL  +D SI
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIKKNESVNGHYKNIKFMCADVTSPDLKIADGSI  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE +  RM+ W+K
Sbjct  121  DLIFSNWLLMYLSDKEVELMAERMIGWIK  149



>ref|XP_010465872.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Camelina 
sativa]
Length=491

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLEL
Sbjct  1    MAATYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAG++IA+DFI+SVI+KNET+NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIEKNETVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  RM+ W+K
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMLGWIK  149



>dbj|BAD80838.1| phosphoethanolamine N-methyltransferase [Atriplex nummularia]
Length=503

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 131/151 (87%), Gaps = 2/151 (1%)
 Frame = +3

Query  138  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  317
            SAM     EEREV K YW+EHS +LTVEAMMLDS+A+DLDKEERPEVLSMLP YEGKSVL
Sbjct  4    SAMGV--NEEREVFKKYWVEHSVDLTVEAMMLDSQASDLDKEERPEVLSMLPPYEGKSVL  61

Query  318  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  497
            ELGAGIGRFTGELA+KAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS  LN S  
Sbjct  62   ELGAGIGRFTGELAEKAGQVIALDFIESVIKKNECINGHYKNVKFMCADVTSPSLNISPN  121

Query  498  SIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            S+D+IFSNWLLMYLSD+EVE L  RM+KWLK
Sbjct  122  SVDIIFSNWLLMYLSDEEVERLVERMLKWLK  152



>ref|NP_973993.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 sp|Q944H0.2|PEAM2_ARATH RecName: Full=Phosphomethylethanolamine N-methyltransferase; 
Short=AtPMEAMT; AltName: Full=Phosphoethanolamine N-methyltransferase 
2 [Arabidopsis thaliana]
 gb|AEE32323.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=491

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MA    EER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLEL
Sbjct  1    MATPYKEERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAG+VIA+DFIES I+KNE++NGH  NIKFMCADVTS DL   D SI
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIQKNESVNGHYKNIKFMCADVTSPDLKIKDGSI  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE +  RM+ W+K
Sbjct  121  DLIFSNWLLMYLSDKEVELMAERMIGWVK  149



>gb|KDO63824.1| hypothetical protein CISIN_1g043471mg [Citrus sinensis]
Length=485

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            ERE+QK+YW+EHS+ LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK+VLE GAGIGRF
Sbjct  9    EREIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGAGIGRF  68

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  524
            TGELA+KAG VIA+DFI+SVIKKNE +NGH  N+KFMCADVTS DL FS++S+D++FSNW
Sbjct  69   TGELAKKAGHVIALDFIDSVIKKNEEVNGHFENVKFMCADVTSPDLTFSEDSVDMMFSNW  128

Query  525  LLMYLSDQEVESLXXRMVKWLK  590
            LLMYLSD+EVE L  RMVKWLK
Sbjct  129  LLMYLSDKEVEKLAERMVKWLK  150



>ref|XP_010506234.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Camelina sativa]
Length=494

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLELGAGIGR
Sbjct  10   EERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLELGAGIGR  69

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS DL  +D S+DLIFSN
Sbjct  70   FTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPDLKITDGSLDLIFSN  129

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE L  RMV W+K
Sbjct  130  WLLMYLSDKEVELLAERMVGWIK  152



>ref|XP_009356042.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 136/150 (91%), Gaps = 1/150 (1%)
 Frame = +3

Query  144  MAAF-QGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  320
            MAAF  GEER VQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+E
Sbjct  1    MAAFANGEERAVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVVE  60

Query  321  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  500
            LGAGIGRFTGELA+KAGQ+ A+DFI+SVIKKNE+INGH  N+KF+CADVTS DL  S+ S
Sbjct  61   LGAGIGRFTGELAEKAGQLFALDFIDSVIKKNESINGHHKNVKFICADVTSPDLKISENS  120

Query  501  IDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            +DL+FSNWLLMYLSD+EVE+L  RM+ WLK
Sbjct  121  VDLVFSNWLLMYLSDKEVENLVERMMGWLK  150



>gb|AFW83641.1| hypothetical protein ZEAMMB73_560974 [Zea mays]
Length=244

 Score =   238 bits (606),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +3

Query  159  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  338
             EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP+YEGKSVLELGAGIG
Sbjct  18   AEERKAQKSYWEEHSKNLTVEAMMLDSRAADLDKEERPEVLSLLPSYEGKSVLELGAGIG  77

Query  339  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  518
            RFTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL     SIDLIFS
Sbjct  78   RFTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSQDLVLQANSIDLIFS  137

Query  519  NWLLMYLSDQEVESLXXRMVKWLK  590
            NWLLMYLSD+EVE L  RMVKWLK
Sbjct  138  NWLLMYLSDEEVEQLVQRMVKWLK  161



>ref|XP_009360079.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  326
            A+  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEG+SV+ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGQSVVELG  62

Query  327  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  506
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADV S DL  S+ S+D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVASPDLKISEGSVD  122

Query  507  LIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            LIFSNWLLMYLSD+EVE L  RM  WLK
Sbjct  123  LIFSNWLLMYLSDKEVEKLVERMTGWLK  150



>ref|XP_008393424.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   245 bits (625),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  326
            A+  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEG+S +ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGQSXVELG  62

Query  327  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  506
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADVTS DL  S+ S+D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVTSPDLKISEGSVD  122

Query  507  LIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            LIFSNWLLMYLSD+EVE L  RM+ WLK
Sbjct  123  LIFSNWLLMYLSDKEVEKLVERMMGWLK  150



>ref|XP_006490771.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Citrus sinensis]
Length=489

 Score =   245 bits (625),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 133/147 (90%), Gaps = 1/147 (1%)
 Frame = +3

Query  150  AFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGA  329
            A QGE RE+QK+YW+EHS+ LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK+VLE GA
Sbjct  2    AGQGE-REIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGA  60

Query  330  GIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDL  509
            GIGRFTGELA+KAG VIA+DFI+SVIKKNE +NGH  N+KFMCADVTS DL FS++S+D+
Sbjct  61   GIGRFTGELAKKAGHVIALDFIDSVIKKNEEVNGHFENVKFMCADVTSPDLTFSEDSVDM  120

Query  510  IFSNWLLMYLSDQEVESLXXRMVKWLK  590
            +FSNWLLMYLSD+EVE L  RMVKWLK
Sbjct  121  MFSNWLLMYLSDKEVEKLAERMVKWLK  147



>gb|AGI56231.1| phosphoethanolamine N-methyltransferase [Lycium barbarum]
Length=498

 Score =   245 bits (625),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +ER++QK+YWIEH+SELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLELGAGIGR
Sbjct  15   QERDIQKNYWIEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLELGAGIGR  74

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FT ELA+ AGQ+IA+DFIES IKKNE+IN H  N+KFMCADVTS DL  S ES+DLIFSN
Sbjct  75   FTSELAKNAGQLIALDFIESAIKKNESINKHHKNVKFMCADVTSPDLKISPESVDLIFSN  134

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EV+SL  RMVKWLK
Sbjct  135  WLLMYLSDEEVQSLVQRMVKWLK  157



>ref|XP_006451624.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
 ref|XP_006490770.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Citrus sinensis]
 gb|ESR64864.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
Length=492

 Score =   244 bits (624),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            ERE+QK+YW+EHS+ LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK+VLE GAGIGRF
Sbjct  9    EREIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGAGIGRF  68

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  524
            TGELA+KAG VIA+DFI+SVIKKNE +NGH  N+KFMCADVTS DL FS++S+D++FSNW
Sbjct  69   TGELAKKAGHVIALDFIDSVIKKNEEVNGHFENVKFMCADVTSPDLTFSEDSVDMMFSNW  128

Query  525  LLMYLSDQEVESLXXRMVKWLK  590
            LLMYLSD+EVE L  RMVKWLK
Sbjct  129  LLMYLSDKEVEKLAERMVKWLK  150



>ref|XP_006297517.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
 gb|EOA30415.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
Length=491

 Score =   244 bits (624),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE+INGH  N+KF+CADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESINGHYKNVKFLCADVTSPDLKITDGSL  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  RM+ W+K
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMLGWIK  149



>gb|EPS65842.1| hypothetical protein M569_08933, partial [Genlisea aurea]
Length=487

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +EREVQKSYWIEHS +LTVEAMMLDSKA++LDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  2    QEREVQKSYWIEHSGDLTVEAMMLDSKASELDKEERPEVLSLLPSYEGKSVLELGAGIGR  61

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGE+A+KA QV+A+DFIESVIKKNE INGH  N+KFMCADVTS DL+F + S+DLIFSN
Sbjct  62   FTGEIAKKADQVVALDFIESVIKKNEIINGHHKNVKFMCADVTSSDLSFPEGSLDLIFSN  121

Query  522  WLLMYLSDQEVESLXXRMVKWL  587
            WLLMYLSD+EVE+L  RM+KWL
Sbjct  122  WLLMYLSDEEVENLAERMIKWL  143



>dbj|BAD93609.1| hypothetical protein [Cucumis melo]
Length=211

 Score =   236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +3

Query  132  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  311
              +   A   +ER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKS
Sbjct  3    TPTPAPALNDDERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKS  62

Query  312  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  491
            VLELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS +L  S
Sbjct  63   VLELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTSPELKIS  122

Query  492  DESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            + S+DLIFSNWLLMYLSD EV++L  RMVKWL+
Sbjct  123  ENSVDLIFSNWLLMYLSDIEVKNLAERMVKWLR  155



>ref|XP_010097561.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
 gb|EXB69093.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
Length=519

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  159  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  338
            GEERE+QK+YW E+S++LT+E+MMLDSKA+DLDKEERPEVLS+LP +EGKSVLELGAGIG
Sbjct  11   GEEREIQKTYWTENSADLTIESMMLDSKASDLDKEERPEVLSVLPPFEGKSVLELGAGIG  70

Query  339  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  518
            RFTGELAQKAGQV+A+DFIESVIKKNE INGH  N+KFMCADVTS +L  S+ S+DLIFS
Sbjct  71   RFTGELAQKAGQVLALDFIESVIKKNEEINGHYENVKFMCADVTSPELKISEGSVDLIFS  130

Query  519  NWLLMYLSDQEVESLXXRMVKWLK  590
            NWLLMYLSD+EVE+L  RMVKWLK
Sbjct  131  NWLLMYLSDKEVENLAERMVKWLK  154



>gb|AFK34653.1| unknown [Lotus japonicus]
Length=198

 Score =   234 bits (598),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EEREVQKSYWIEHSS+L++E+MMLDS A++LDKEERPEVLS+LPA E KSV+ELGAGIGR
Sbjct  15   EEREVQKSYWIEHSSDLSMESMMLDSNASNLDKEERPEVLSLLPAIESKSVIELGAGIGR  74

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA+K+GQ++A+DFIES IKKNE+INGH  N+KFMCADVTS +L+ S+ S+DLIFSN
Sbjct  75   FTGELAKKSGQLLAVDFIESAIKKNESINGHHKNVKFMCADVTSPNLHVSEGSVDLIFSN  134

Query  522  WLLMYLSDQEVESLXXRMVKWL  587
            WLLMYLSDQEVE+L  R++KWL
Sbjct  135  WLLMYLSDQEVENLAERVIKWL  156



>gb|KFK36082.1| hypothetical protein AALP_AA4G075100 [Arabis alpina]
Length=492

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK+VLELGAGIGR
Sbjct  8    EERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKTVLELGAGIGR  67

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELAQKAG+VIA+DFIES IKKNE+ NGH  N+KFMCADVTS DL  +D SIDLIFSN
Sbjct  68   FTGELAQKAGEVIALDFIESAIKKNESDNGHYKNVKFMCADVTSPDLKITDGSIDLIFSN  127

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE L  RMV W+K
Sbjct  128  WLLMYLSDKEVELLAERMVGWVK  150



>gb|AEY75253.1| phosphoethanolamine N-methyltransferase [Atriplex canescens]
Length=494

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            EREV K YW+EHS +LTVEAMMLDS+A+DLDKEERPEVLSMLP YEGKSVLELGAGIGRF
Sbjct  11   EREVFKKYWVEHSVDLTVEAMMLDSQASDLDKEERPEVLSMLPPYEGKSVLELGAGIGRF  70

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  524
            TGELA+KAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS  LN S  S+D+IFSNW
Sbjct  71   TGELAEKAGQVIALDFIESVIKKNECINGHYKNVKFMCADVTSPSLNISPNSVDIIFSNW  130

Query  525  LLMYLSDQEVESLXXRMVKWLK  590
            LLMYLSD+EVE L  RM+KWLK
Sbjct  131  LLMYLSDEEVERLVERMLKWLK  152



>ref|XP_003528975.2| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN44632.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=531

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 142/161 (88%), Gaps = 2/161 (1%)
 Frame = +3

Query  114  YLFTAIVQSAMAAFQG--EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSM  287
            +LF++  Q  MA+     +ER VQ+SYWIEH+++L+VE+MMLDS A+DLDKEERPEVLS+
Sbjct  30   FLFSSFCQPYMASLATVQDERCVQRSYWIEHTTDLSVESMMLDSNASDLDKEERPEVLSL  89

Query  288  LPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADV  467
            LPAYEGKSV+ELGAGIGRFTGELA+KAGQ++A+DFIES IKKNE+INGH  N+KFMCADV
Sbjct  90   LPAYEGKSVVELGAGIGRFTGELAKKAGQLLAVDFIESAIKKNESINGHHKNVKFMCADV  149

Query  468  TSKDLNFSDESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            TS +L+ S+ S+DL+FSNWLLMYLSD+EVE+L  RM+KWLK
Sbjct  150  TSPNLHISEGSVDLMFSNWLLMYLSDKEVENLAARMIKWLK  190



>gb|KFK39125.1| hypothetical protein AALP_AA3G204100 [Arabis alpina]
Length=491

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA   EER++QK+YWIEHS +LTVE+MMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSVDLTVESMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAG++IA+DFI+SVI KNE++NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVINKNESVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  RMV W+K
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMVGWIK  149



>gb|AER10512.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
 gb|AER10513.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
Length=492

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  326
            A+  GEEREVQK+YW+EHS++LTVEAMMLDS A+DLDKEERPEVLSMLP YEG+SV+ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSNASDLDKEERPEVLSMLPPYEGQSVVELG  62

Query  327  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  506
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADV S DL  S+ S+D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVASPDLKISEGSVD  122

Query  507  LIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            LIFSNWLLMYLSD+EVE L  RM+ WLK
Sbjct  123  LIFSNWLLMYLSDKEVEKLVERMMGWLK  150



>ref|XP_009782224.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=496

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            +AA   +ERE+QKSYW+E ++ELT+EAMMLDS+A+DLDKE+RPEVLS+LP+YEGKSVLEL
Sbjct  6    IAAAPEQEREIQKSYWMEQAAELTLEAMMLDSEASDLDKEDRPEVLSLLPSYEGKSVLEL  65

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTG+LA+KAGQ+ A+DF+E VIKKNE+INGH  N+KFMCADVTS DL FS ES+
Sbjct  66   GAGIGRFTGDLAEKAGQLTALDFVEGVIKKNESINGHHKNVKFMCADVTSPDLTFSPESV  125

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EV+ L  RMVKWLK
Sbjct  126  DLIFSNWLLMYLSDKEVQDLAERMVKWLK  154



>ref|XP_011039130.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Populus 
euphratica]
Length=490

 Score =   242 bits (618),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 134/149 (90%), Gaps = 1/149 (1%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA Q EERE+QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLEL
Sbjct  1    MAA-QVEEREIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLEL  59

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKA QV+A+DFIES IKKNE INGH  N+KFMCADVTS DLNFS+ S+
Sbjct  60   GAGIGRFTGELAQKASQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNFSEGSV  119

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE+L  RMVKWLK
Sbjct  120  DLIFSNWLLMYLSDKEVENLVERMVKWLK  148



>ref|XP_011014101.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Populus euphratica]
Length=490

 Score =   242 bits (618),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 134/149 (90%), Gaps = 1/149 (1%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA Q EERE+QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLEL
Sbjct  1    MAA-QVEEREIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLEL  59

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKA QV+A+DFIES IKKNE INGH  N+KFMCADVTS DLNFS+ S+
Sbjct  60   GAGIGRFTGELAQKASQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNFSEGSV  119

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE+L  RMVKWLK
Sbjct  120  DLIFSNWLLMYLSDKEVENLVERMVKWLK  148



>ref|XP_006303987.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
 gb|EOA36885.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
Length=491

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MA    EER +QKSYW+EHSS+LTVEAMMLDSKA DLDKEERPEVLS++P YEGK+VLEL
Sbjct  1    MATPYKEERHIQKSYWMEHSSDLTVEAMMLDSKATDLDKEERPEVLSLIPPYEGKTVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPDLKIADGSV  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE +  RM+ W+K
Sbjct  121  DLIFSNWLLMYLSDKEVELMAERMLGWVK  149



>gb|KDP23923.1| hypothetical protein JCGZ_27083 [Jatropha curcas]
Length=491

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA   EERE+QK+YWIE+S  LTVEAMMLDS A+ LDKEERPEVLSMLP YEGKSVLE 
Sbjct  1    MAAAHVEEREIQKNYWIENSDGLTVEAMMLDSNASLLDKEERPEVLSMLPPYEGKSVLEF  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGE+AQ AGQ++A+DFI++VIKKNE INGH  N+KF+CADVTS+DL FS+ES+
Sbjct  61   GAGIGRFTGEIAQNAGQLVAVDFIDNVIKKNERINGHHKNVKFICADVTSEDLKFSEESV  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+E+E+L  RMVKWLK
Sbjct  121  DLIFSNWLLMYLSDKEIENLAERMVKWLK  149



>ref|XP_008799221.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Phoenix dactylifera]
Length=492

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 130/150 (87%), Gaps = 1/150 (1%)
 Frame = +3

Query  144  MAAFQGEE-REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  320
            MAAF GEE R VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKSVLE
Sbjct  1    MAAFSGEEERMVQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSVLE  60

Query  321  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  500
            LGAGIGRFTGELA++AG V+AMDFI++VIKKNE+INGH  N  FMC DVTS DL    ES
Sbjct  61   LGAGIGRFTGELAKEAGHVLAMDFIKNVIKKNESINGHFKNTSFMCTDVTSPDLMIEAES  120

Query  501  IDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            +DLIFSNWLLMYLSD EVE L  RMVKWLK
Sbjct  121  VDLIFSNWLLMYLSDNEVEGLAQRMVKWLK  150



>ref|XP_009147956.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Brassica 
rapa]
Length=489

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MA     ER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK VLEL
Sbjct  1    MATPYKAERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKKVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELAQKAG+VIA+DFIES IKKNE++NGH  N+KFMCADVTS DL   D S+
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIKKNESVNGHYKNVKFMCADVTSPDLKIEDGSV  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  RM+ W+K
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMLGWVK  149



>gb|EYU24136.1| hypothetical protein MIMGU_mgv1a005261mg [Erythranthe guttata]
Length=491

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA   +EREVQK+YW+EHS  LT+E MMLDSKA+DLDKEERPEVL+MLP YEGKS+LEL
Sbjct  1    MAAITEQEREVQKNYWVEHSVNLTLEDMMLDSKASDLDKEERPEVLAMLPPYEGKSILEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELA+KAG V A+DFIESVIKKNE IN H  N++FMCADVTS DLNF + S+
Sbjct  61   GAGIGRFTGELAKKAGHVTALDFIESVIKKNEAINKHHKNVEFMCADVTSPDLNFPEGSL  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            D+IFSNWLLMYLSD EVE L  RMVKWLK
Sbjct  121  DMIFSNWLLMYLSDAEVEKLAQRMVKWLK  149



>sp|Q9M571.1|PEAMT_SPIOL RecName: Full=Phosphoethanolamine N-methyltransferase [Spinacia 
oleracea]
 gb|AAF61950.1|AF237633_1 phosphoethanolamine N-methyltransferase [Spinacia oleracea]
Length=494

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 130/151 (86%), Gaps = 2/151 (1%)
 Frame = +3

Query  138  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  317
            SAM   Q  EREV K YWIEHS +LTVEAMMLDS+A+DLDK ERPEVLSMLP YEGKSVL
Sbjct  4    SAMGVLQ--EREVFKKYWIEHSVDLTVEAMMLDSQASDLDKVERPEVLSMLPPYEGKSVL  61

Query  318  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  497
            ELGAGIGRFTGELA+KA QVIA+DFIESVIKKNE+INGH  N+KFMCADVTS  LN S  
Sbjct  62   ELGAGIGRFTGELAEKASQVIALDFIESVIKKNESINGHYKNVKFMCADVTSPSLNISPN  121

Query  498  SIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            S+D+IFSNWLLMYLSD+EVE L  RM+KWLK
Sbjct  122  SVDIIFSNWLLMYLSDEEVERLVERMLKWLK  152



>dbj|BAE07178.1| phosphoethanolamine N-methyltransferase [Beta vulgaris]
Length=494

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +EREV K YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLELGAGIGR
Sbjct  10   QEREVFKKYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLELGAGIGR  69

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTG+LA+KAGQVIA+DFIES IKKNE +NGH  N+KFMCADVTS  LN S  S+D+IFSN
Sbjct  70   FTGDLAKKAGQVIALDFIESAIKKNECVNGHYKNVKFMCADVTSPSLNISPNSVDIIFSN  129

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EV+ L  RM+KWLK
Sbjct  130  WLLMYLSDEEVQRLVERMLKWLK  152



>ref|XP_010686587.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +EREV K YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLELGAGIGR
Sbjct  10   QEREVFKKYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLELGAGIGR  69

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTG+LA+KAGQVIA+DFIES IKKNE +NGH  N+KFMCADVTS  LN S  S+D+IFSN
Sbjct  70   FTGDLAKKAGQVIALDFIESAIKKNECVNGHYKNVKFMCADVTSPSLNISPNSVDIIFSN  129

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EV+ L  RM+KWLK
Sbjct  130  WLLMYLSDEEVQRLVERMLKWLK  152



>ref|XP_010461683.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=492

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER +QKSYW+EHSS+LTVEAMMLDSKA+DLD+EERPEVLS++P YEGKSVLELGAGIGR
Sbjct  8    EERHIQKSYWMEHSSDLTVEAMMLDSKASDLDREERPEVLSLIPPYEGKSVLELGAGIGR  67

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELAQKAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS DL  +  SIDLIFSN
Sbjct  68   FTGELAQKAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPDLKIAVGSIDLIFSN  127

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE +  RM+KW+K
Sbjct  128  WLLMYLSDKEVELMAERMLKWVK  150



>ref|XP_008799219.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Phoenix dactylifera]
Length=494

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 130/152 (86%), Gaps = 3/152 (2%)
 Frame = +3

Query  144  MAAFQG---EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSV  314
            MAAF G   EER VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKSV
Sbjct  1    MAAFSGAGEEERMVQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSV  60

Query  315  LELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSD  494
            LELGAGIGRFTGELA++AG V+AMDFI++VIKKNE+INGH  N  FMC DVTS DL    
Sbjct  61   LELGAGIGRFTGELAKEAGHVLAMDFIKNVIKKNESINGHFKNTSFMCTDVTSPDLMIEA  120

Query  495  ESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            ES+DLIFSNWLLMYLSD EVE L  RMVKWLK
Sbjct  121  ESVDLIFSNWLLMYLSDNEVEGLAQRMVKWLK  152



>dbj|BAC57960.1| phosphoethanolamine N-methyltransferase [Aster tripolium]
Length=493

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  326
                G+ERE+QK+YW+EHS +LTVE+MMLDS A+DLDKEERPEVLS+LP+YEGK VLELG
Sbjct  3    GVINGDEREIQKNYWVEHSVDLTVESMMLDSMASDLDKEERPEVLSLLPSYEGKRVLELG  62

Query  327  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  506
            AGIGRFTGELA+ AG+VIA+DFIESV+KKNE+INGH  N+KFMCADVTS DL F  ESID
Sbjct  63   AGIGRFTGELAKTAGEVIALDFIESVVKKNESINGHCKNVKFMCADVTSPDLRFPAESID  122

Query  507  LIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            LIFSNWLLMYLSD+EVE +  R +KW+K
Sbjct  123  LIFSNWLLMYLSDKEVEDIAERFLKWVK  150



>ref|XP_009104804.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 [Brassica 
rapa]
Length=506

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  129  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  308
            I  S   ++ GEERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EG+
Sbjct  10   ISPSFPNSYSGEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGE  69

Query  309  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  488
            +VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS D+ F
Sbjct  70   TVLEFGAGIGRFTSELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFMCADVTSPDMKF  129

Query  489  SDESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            S+ES+DLIFSNWLLMYLSD+EVE L  +M++W K
Sbjct  130  SNESMDLIFSNWLLMYLSDKEVEDLAKKMLQWTK  163



>ref|XP_010274723.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Nelumbo nucifera]
Length=489

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 131/149 (88%), Gaps = 1/149 (1%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA Q EEREVQKSYWIEHSSELT+EAMMLDSKAADLDKEERPEVLS+LP ++GK VLEL
Sbjct  1    MAA-QVEEREVQKSYWIEHSSELTIEAMMLDSKAADLDKEERPEVLSLLPPFKGKDVLEL  59

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFT E A++A QV+A+DFIESVIKKNE++NGH  N+KF+CADVTS DL  + ES+
Sbjct  60   GAGIGRFTSEFAKEANQVLALDFIESVIKKNESVNGHFKNVKFLCADVTSPDLKIAPESV  119

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  RM  WLK
Sbjct  120  DLIFSNWLLMYLSDKEVEKLAERMAIWLK  148



>emb|CDX68222.1| BnaA07g22620D [Brassica napus]
Length=506

 Score =   240 bits (613),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  129  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  308
            I  S   ++ GEERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EG+
Sbjct  10   ISPSFPNSYSGEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGE  69

Query  309  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  488
            +VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS D+ F
Sbjct  70   TVLEFGAGIGRFTSELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFMCADVTSPDMKF  129

Query  489  SDESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            S+ES+DLIFSNWLLMYLSD+EVE L  +M++W K
Sbjct  130  SNESMDLIFSNWLLMYLSDKEVEDLAKKMLQWTK  163



>gb|EMT21187.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=503

 Score =   240 bits (613),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  20   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  79

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  80   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  139

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD EVE L  RMVKWLK
Sbjct  140  WLLMYLSDAEVEKLVERMVKWLK  162



>gb|EMS54147.1| Phosphoethanolamine N-methyltransferase 1 [Triticum urartu]
Length=504

 Score =   240 bits (612),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  21   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  80

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  81   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  140

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD EVE L  RMVKWLK
Sbjct  141  WLLMYLSDAEVEKLVERMVKWLK  163



>emb|CDM83845.1| unnamed protein product [Triticum aestivum]
Length=504

 Score =   240 bits (612),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  21   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  80

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  81   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  140

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD EVE L  RMVKWLK
Sbjct  141  WLLMYLSDAEVEKLVERMVKWLK  163



>gb|ACV89824.1| S-adenosyl-L-methionine:phosphoethanolamine N-methyltransferase 
[Triticum aestivum]
Length=505

 Score =   240 bits (612),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  22   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  81

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  82   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  141

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD EVE L  RMVKWLK
Sbjct  142  WLLMYLSDAEVEKLVERMVKWLK  164



>ref|XP_003569614.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Brachypodium 
distachyon]
Length=502

 Score =   240 bits (612),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EERE QK YW EHS +LTVEAMMLDS AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  19   EEREAQKKYWEEHSRDLTVEAMMLDSHAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  78

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  79   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  138

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE L  RMVKWLK
Sbjct  139  WLLMYLSDEEVEKLVKRMVKWLK  161



>ref|XP_006644536.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=499

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER+ QKSYW EHS +LTVEAMMLDS+A DLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRATDLDKEERPEILSLLPSYEGKSVLELGAGIGR  75

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  76   FTGELAKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTSPDLMIEDNSIDLIFSN  135

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE L  RMVKWLK
Sbjct  136  WLLMYLSDEEVEKLVKRMVKWLK  158



>ref|XP_010461752.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Camelina 
sativa]
Length=492

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER +QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLELGAGIGR
Sbjct  8    EERHIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGR  67

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELAQKAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS DL  +  SIDLIFSN
Sbjct  68   FTGELAQKAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPDLKIAVGSIDLIFSN  127

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE +  RM+ W+K
Sbjct  128  WLLMYLSDKEVELMAERMLGWVK  150



>ref|XP_009595958.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=496

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            +AA   +ERE+QKSYWIE ++ELT++AMMLDS+A+DLDKE+RPEVLS+LP YEGKSVLEL
Sbjct  6    IAAAPEQEREIQKSYWIEQAAELTLKAMMLDSEASDLDKEDRPEVLSLLPPYEGKSVLEL  65

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTG LA+KAGQ+  +DF+E VIKKNE+INGH  N+KFMCADVTS DL FS ES+
Sbjct  66   GAGIGRFTGGLAEKAGQLTTLDFVEDVIKKNESINGHHKNVKFMCADVTSPDLTFSPESV  125

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EV+ L  RMVKWLK
Sbjct  126  DLIFSNWLLMYLSDKEVQDLAERMVKWLK  154



>ref|XP_008799258.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Phoenix dactylifera]
Length=447

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 131/153 (86%), Gaps = 4/153 (3%)
 Frame = +3

Query  144  MAAFQG----EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  311
            MAA  G    EER VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS
Sbjct  1    MAAINGGGGEEERMVQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKS  60

Query  312  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  491
            VLELGAGIGRFTGELA++AG V+A+DFIE+VIKKNE+ NGHL NI F+CADVTS DL   
Sbjct  61   VLELGAGIGRFTGELAKEAGHVLALDFIENVIKKNESANGHLKNISFVCADVTSPDLMIE  120

Query  492  DESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
             ES+DLIFSNWLLMYLSD EVE L  R+VKWLK
Sbjct  121  AESVDLIFSNWLLMYLSDNEVEKLAERLVKWLK  153



>ref|XP_010678114.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EEREV K YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLELGAGIGR
Sbjct  10   EEREVFKKYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLELGAGIGR  69

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTG+LA KA QVIA+DFIES IKKNE +NGH  N+KFMCADVTS  LN S  S+D+IFSN
Sbjct  70   FTGDLANKADQVIALDFIESAIKKNECVNGHYKNVKFMCADVTSPSLNISPNSVDIIFSN  129

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EV+ L  RM+KWLK
Sbjct  130  WLLMYLSDEEVQHLVERMLKWLK  152



>dbj|BAH01482.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64589.1| hypothetical protein OsJ_19441 [Oryza sativa Japonica Group]
Length=495

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            ER+ Q+SYW EHS +LTVEAMMLDS+AADLDKEERPEVLS+LP+Y+GKSVLELGAGIGRF
Sbjct  13   ERKAQRSYWEEHSKDLTVEAMMLDSRAADLDKEERPEVLSVLPSYKGKSVLELGAGIGRF  72

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  524
            TGELA++AG V+A+DFIESVIKKNE INGH  NI FMCADVTS DL   D SIDLIFSNW
Sbjct  73   TGELAKEAGHVLALDFIESVIKKNENINGHHKNITFMCADVTSPDLTIEDNSIDLIFSNW  132

Query  525  LLMYLSDQEVESLXXRMVKWLK  590
            LLMYLSD+EVE L  RMVKWLK
Sbjct  133  LLMYLSDEEVEKLVGRMVKWLK  154



>pir||H96762 hypothetical protein F6D5.1 [imported] - Arabidopsis thaliana
 gb|AAG51806.1|AC079676_1 phosphoethanolamine N-methyltransferase, putative; 6854-3993 
[Arabidopsis thaliana]
Length=555

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = +3

Query  72   FSV-RIAFPGFLDFFYLFTAIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAA  248
            FS+ R  +P      +LF ++    MA++ GEERE+QK+YW EHS  L+VEAMMLDSKA+
Sbjct  41   FSIHRFHYPREKIVSFLFPSVFSRIMASY-GEEREIQKNYWKEHSVGLSVEAMMLDSKAS  99

Query  249  DLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETIN  428
            DLDKEERPE+L+ LP  EG +VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE IN
Sbjct  100  DLDKEERPEILAFLPPIEGTTVLEFGAGIGRFTTELAQKAGQVIAVDFIESVIKKNENIN  159

Query  429  GHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            GH  N+KF+CADVTS ++NF +ES+DLIFSNWLLMYLSDQEVE L  +M++W K
Sbjct  160  GHYKNVKFLCADVTSPNMNFPNESMDLIFSNWLLMYLSDQEVEDLAKKMLQWTK  213



>ref|XP_004503268.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cicer 
arietinum]
Length=490

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +ERE+QKSYW++H ++L+VEAMMLDSKA+DLDKEERPEVLS+LPAYEGKSV+ELGAGIGR
Sbjct  6    DEREIQKSYWVQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPAYEGKSVIELGAGIGR  65

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS ++  S+ S+D+IFSN
Sbjct  66   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPNMKVSEGSVDVIFSN  125

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD EVE+L  RM+KWLK
Sbjct  126  WLLMYLSDNEVENLAERMMKWLK  148



>ref|XP_011008809.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X2 [Populus euphratica]
Length=490

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER++QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  6    EERDIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  65

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELAQKAGQV+A+DFIES IKKNE INGH  N+KFMCADVTS DLN S+ S+DLIFSN
Sbjct  66   FTGELAQKAGQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNISEGSVDLIFSN  125

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE+L  RMVKW+K
Sbjct  126  WLLMYLSDKEVENLVERMVKWVK  148



>ref|XP_004161835.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
1 [Cucumis sativus]
Length=527

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  153  FQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAG  332
            F G+EREVQK+YWIEH+++LTVEAMMLDS+A+ LDKEERPEVLS+LP  +GK+VLELGAG
Sbjct  40   FTGQEREVQKNYWIEHTADLTVEAMMLDSQASYLDKEERPEVLSLLPPCDGKTVLELGAG  99

Query  333  IGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLI  512
            IGRFTGELAQKAG VIA+DFIE+ IKKNE+ N H  N+KF+CADVTS +L  SDESIDLI
Sbjct  100  IGRFTGELAQKAGNVIALDFIENAIKKNESTNSHHKNVKFVCADVTSSELKISDESIDLI  159

Query  513  FSNWLLMYLSDQEVESLXXRMVKWLK  590
            FSNWLLMYLSD+EVESL  R++KWLK
Sbjct  160  FSNWLLMYLSDKEVESLAARIIKWLK  185



>gb|ACJ83326.1| unknown [Medicago truncatula]
Length=221

 Score =   229 bits (585),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  141  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  320
            AM     +EREVQ+SYW EH   L+VE+MMLDS A+ LDKEERPEVLS+LP+YEGKSVLE
Sbjct  6    AMKQGGEDEREVQRSYWKEHCVNLSVESMMLDSNASHLDKEERPEVLSLLPSYEGKSVLE  65

Query  321  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  500
            LGAGIGRFT ELAQKAGQ++A+DFIES IKKNE  NGH  N+KFMCADVTS +L+ S+ S
Sbjct  66   LGAGIGRFTAELAQKAGQLLAVDFIESAIKKNENTNGHHKNVKFMCADVTSPNLHISEGS  125

Query  501  IDLIFSNWLLMYLSDQEVESLXXRMVKWL  587
            +DLIFSNWLLMYLSD+EV++L  RMVKWL
Sbjct  126  VDLIFSNWLLMYLSDEEVKNLAERMVKWL  154



>ref|XP_011008808.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Populus euphratica]
Length=506

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER++QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  22   EERDIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  81

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELAQKAGQV+A+DFIES IKKNE INGH  N+KFMCADVTS DLN S+ S+DLIFSN
Sbjct  82   FTGELAQKAGQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNISEGSVDLIFSN  141

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE+L  RMVKW+K
Sbjct  142  WLLMYLSDKEVENLVERMVKWVK  164



>emb|CDY11100.1| BnaC06g23520D [Brassica napus]
Length=506

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +3

Query  129  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  308
            I  S   ++ GEERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EG+
Sbjct  10   ISPSFPNSYSGEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGE  69

Query  309  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  488
             VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS D+ F
Sbjct  70   KVLEFGAGIGRFTSELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFMCADVTSPDMKF  129

Query  489  SDESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            S ES+DL+FSNWLLMYLSD+EVE L  +M++W K
Sbjct  130  SSESMDLVFSNWLLMYLSDKEVEDLAKKMLQWTK  163



>gb|KEH21430.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=456

 Score =   237 bits (604),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  130

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD EVE+L  RM+KWLK
Sbjct  131  WLLMYLSDNEVENLAKRMMKWLK  153



>gb|KEH21429.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=469

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  130

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD EVE+L  RM+KWLK
Sbjct  131  WLLMYLSDNEVENLAKRMMKWLK  153



>dbj|BAJ97525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  25   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  84

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA+ AG V+AMDFI SVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  85   FTGELAKTAGHVLAMDFIGSVIKKNESINGHYENASFMCADVTSPDLVIEDNSIDLIFSN  144

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE L  RMVKWLK
Sbjct  145  WLLMYLSDEEVEKLVERMVKWLK  167



>ref|XP_002322102.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
 gb|EEF06229.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
Length=516

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER++QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  22   EERDIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  81

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELAQKAGQV+A+DFIES IKKNE INGH  N+KFMCADVTS DLN S+ S+DLIFSN
Sbjct  82   FTGELAQKAGQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNISEGSVDLIFSN  141

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE+L  RMVKW+K
Sbjct  142  WLLMYLSDKEVENLVERMVKWVK  164



>ref|XP_008464197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=493

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +3

Query  159  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  338
            G+EREVQK+YWIEH+++LTVEAMMLDS+A+ LDKEERPE+LS+LP Y+GK+VLELGAGIG
Sbjct  8    GQEREVQKNYWIEHTADLTVEAMMLDSQASYLDKEERPEILSLLPPYDGKTVLELGAGIG  67

Query  339  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  518
            RFTGELAQKAG VIA+DFIE+ IKKNE IN H  N+KF+CADVTS +L  SDES+DLIFS
Sbjct  68   RFTGELAQKAGNVIALDFIENAIKKNERINSHHKNVKFVCADVTSSELKISDESVDLIFS  127

Query  519  NWLLMYLSDQEVESLXXRMVKWLK  590
            NWLLMYLSD+EVE+   R++KWLK
Sbjct  128  NWLLMYLSDKEVENFAARIIKWLK  151



>ref|NP_001148925.1| LOC100282545 [Zea mays]
 gb|ACG33501.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  126  AIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  305
            A V S       EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP+YEG
Sbjct  7    ATVVSLNGKMGAEERKAQKSYWEEHSKNLTVEAMMLDSRAADLDKEERPEVLSLLPSYEG  66

Query  306  KSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLN  485
            KSVLELGAGIGRFTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL 
Sbjct  67   KSVLELGAGIGRFTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSQDLV  126

Query  486  FSDESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
                SIDLIFSNWLLMYLSD+EVE L  RMVKWLK
Sbjct  127  LQANSIDLIFSNWLLMYLSDEEVEQLVQRMVKWLK  161



>ref|XP_007152684.1| hypothetical protein PHAVU_004G150500g [Phaseolus vulgaris]
 gb|ESW24678.1| hypothetical protein PHAVU_004G150500g [Phaseolus vulgaris]
Length=497

 Score =   237 bits (605),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 136/154 (88%), Gaps = 3/154 (2%)
 Frame = +3

Query  138  SAMAAFQG---EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  308
            +++A  QG   +ER VQKSYWIEH++EL+VE+MMLDS A+ LDKEERPEVLS+LPAYEGK
Sbjct  2    ASLAMVQGGGVDERCVQKSYWIEHTTELSVESMMLDSNASHLDKEERPEVLSLLPAYEGK  61

Query  309  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  488
            SVLELGAGIGRFTGELA+KAGQ++A+DFIES IKKNE INGH  N+KFMCADVTS +L  
Sbjct  62   SVLELGAGIGRFTGELAKKAGQLLAVDFIESAIKKNENINGHHKNVKFMCADVTSPNLQI  121

Query  489  SDESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            S+ S+DLIFSNWLLMYLSD+EVE+L  +M+KWLK
Sbjct  122  SEGSVDLIFSNWLLMYLSDKEVENLAGKMMKWLK  155



>ref|XP_004137500.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004161836.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
2 [Cucumis sativus]
 gb|KGN64173.1| hypothetical protein Csa_1G042800 [Cucumis sativus]
Length=493

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +3

Query  159  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  338
            G+EREVQK+YWIEH+++LTVEAMMLDS+A+ LDKEERPEVLS+LP  +GK+VLELGAGIG
Sbjct  8    GQEREVQKNYWIEHTADLTVEAMMLDSQASYLDKEERPEVLSLLPPCDGKTVLELGAGIG  67

Query  339  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  518
            RFTGELAQKAG VIA+DFIE+ IKKNE+ N H  N+KF+CADVTS +L  SDESIDLIFS
Sbjct  68   RFTGELAQKAGNVIALDFIENAIKKNESTNSHHKNVKFVCADVTSSELKISDESIDLIFS  127

Query  519  NWLLMYLSDQEVESLXXRMVKWLK  590
            NWLLMYLSD+EVESL  R++KWLK
Sbjct  128  NWLLMYLSDKEVESLAARIIKWLK  151



>ref|XP_002456194.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
 gb|EES01314.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
Length=501

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = +3

Query  123  TAIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYE  302
            TA V S       EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP++E
Sbjct  5    TAAVVSVNGKMGVEERQAQKSYWEEHSRNLTVEAMMLDSRAADLDKEERPEVLSLLPSFE  64

Query  303  GKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDL  482
            GKSVLELGAGIGRFTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL
Sbjct  65   GKSVLELGAGIGRFTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSEDL  124

Query  483  NFSDESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
                 SIDLIFSNWLLMYLSD+EVE L  RMVKWLK
Sbjct  125  VLPASSIDLIFSNWLLMYLSDEEVEQLVQRMVKWLK  160



>gb|AAS57723.1| phosphoethanolamine N-methyltransferase [Oryza sativa]
Length=499

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGR  75

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGEL + AG V+AMDFIESVIKKNE+INGH  N  FMCADVT  DL   D SIDLIFSN
Sbjct  76   FTGELVKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTCPDLMIEDNSIDLIFSN  135

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE L  RMV+WLK
Sbjct  136  WLLMYLSDEEVEKLVKRMVRWLK  158



>ref|XP_003631125.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AET05601.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=488

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  5    DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  64

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  65   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  124

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD EVE+L  RM+KWLK
Sbjct  125  WLLMYLSDNEVENLAKRMMKWLK  147



>ref|NP_001043957.1| Os01g0695100 [Oryza sativa Japonica Group]
 dbj|BAF05871.1| Os01g0695100 [Oryza sativa Japonica Group]
Length=499

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGR  75

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGEL + AG V+AMDFIESVIKKNE+INGH  N  FMCADVT  DL   D SIDLIFSN
Sbjct  76   FTGELVKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTCPDLMIEDNSIDLIFSN  135

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE L  RMV+WLK
Sbjct  136  WLLMYLSDEEVEKLVKRMVRWLK  158



>gb|EEE55232.1| hypothetical protein OsJ_03109 [Oryza sativa Japonica Group]
Length=509

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGR  75

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGEL + AG V+AMDFIESVIKKNE+INGH  N  FMCADVT  DL   D SIDLIFSN
Sbjct  76   FTGELVKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTCPDLMIEDNSIDLIFSN  135

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE L  RMV+WLK
Sbjct  136  WLLMYLSDEEVEKLVKRMVRWLK  158



>gb|AET05600.2| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=494

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  130

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD EVE+L  RM+KWLK
Sbjct  131  WLLMYLSDNEVENLAKRMMKWLK  153



>ref|XP_003631124.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=495

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  130

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD EVE+L  RM+KWLK
Sbjct  131  WLLMYLSDNEVENLAKRMMKWLK  153



>ref|XP_004969638.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLELGAGIGR
Sbjct  16   EERQAQKSYWEEHSRDLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLELGAGIGR  75

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL     SID+IFSN
Sbjct  76   FTGELAKTAGNVLALDFIESAIKKNESINGHFKNASFMCADVTSQDLVIQANSIDMIFSN  135

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE L  RMVKWLK
Sbjct  136  WLLMYLSDEEVEQLVQRMVKWLK  158



>gb|AFW83642.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  19   EERKAQKSYWEEHSKNLTVEAMMLDSRAADLDKEERPEVLSLLPSYEGKSVLELGAGIGR  78

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL     SIDLIFSN
Sbjct  79   FTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSQDLVLQANSIDLIFSN  138

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE L  RMVKWLK
Sbjct  139  WLLMYLSDEEVEQLVQRMVKWLK  161



>ref|XP_010921161.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Elaeis 
guineensis]
Length=494

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 129/152 (85%), Gaps = 3/152 (2%)
 Frame = +3

Query  144  MAAFQG---EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSV  314
            MAA  G   EER VQKSYW+EHS +LTV AMMLDS+A +LDKEERPEVLS+LP Y+GKSV
Sbjct  1    MAAVSGAGEEERMVQKSYWMEHSKDLTVAAMMLDSRATNLDKEERPEVLSLLPPYKGKSV  60

Query  315  LELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSD  494
            LELGAGIGRFTGELA++AG V+A+DFIE+VIKKNE+INGH  N  FMCADVTS DL   +
Sbjct  61   LELGAGIGRFTGELAKEAGHVLALDFIENVIKKNESINGHFTNTSFMCADVTSPDLLIEE  120

Query  495  ESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            ES+DLIFSNWLLMYLSD EVE L  RMVKWLK
Sbjct  121  ESVDLIFSNWLLMYLSDNEVERLAERMVKWLK  152



>ref|XP_006365411.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Solanum 
tuberosum]
Length=494

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  138  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  317
            +A+A   G+ERE+QKSYW+E ++EL +EAMMLDS A+DLDKE+RPEVLS+LP+YEGKSVL
Sbjct  2    AAIAPGVGQEREIQKSYWMEQTTELNLEAMMLDSAASDLDKEDRPEVLSLLPSYEGKSVL  61

Query  318  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  497
            ELGAGIGRFTG++A+KAG+++ +DFIE VIKKNE+INGH  N+KF+CADVTS DL F  E
Sbjct  62   ELGAGIGRFTGDIAEKAGELVTVDFIEEVIKKNESINGHHKNVKFVCADVTSPDLTFLPE  121

Query  498  SIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            S+DLIFSNWLLMYLSD+EV+ L  RM+KWLK
Sbjct  122  SVDLIFSNWLLMYLSDEEVQDLAERMIKWLK  152



>ref|XP_004166029.1| PREDICTED: LOW QUALITY PROTEIN: phosphoethanolamine N-methyltransferase-like 
[Cucumis sativus]
Length=500

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +3

Query  138  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  317
            +   A   EER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKSVL
Sbjct  5    TPAPALNDEERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKSVL  64

Query  318  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  497
            ELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS +L  S+ 
Sbjct  65   ELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTSPELKISEN  124

Query  498  SIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            S+DLIFSNWLLMYLSD EV++L  RMVKWLK
Sbjct  125  SVDLIFSNWLLMYLSDIEVKNLAERMVKWLK  155



>ref|XP_004137341.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cucumis 
sativus]
Length=500

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +3

Query  138  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  317
            +   A   EER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKSVL
Sbjct  5    TPAPALNDEERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKSVL  64

Query  318  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  497
            ELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS +L  S+ 
Sbjct  65   ELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTSPELKISEN  124

Query  498  SIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            S+DLIFSNWLLMYLSD EV++L  RMVKWLK
Sbjct  125  SVDLIFSNWLLMYLSDIEVKNLAERMVKWLK  155



>gb|AAM97038.1| phosphoethanolamine N-methyltransferase, putative [Arabidopsis 
thaliana]
Length=376

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG +VLE GAGIGR
Sbjct  20   EEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTVLEFGAGIGR  79

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS ++NF +ES+DLIFSN
Sbjct  80   FTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPNMNFPNESMDLIFSN  139

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSDQEVE L  +M++W K
Sbjct  140  WLLMYLSDQEVEDLAKKMLQWTK  162



>ref|XP_009385384.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Musa 
acuminata subsp. malaccensis]
Length=497

 Score =   235 bits (599),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +3

Query  159  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  338
            GEEREVQK YWIEHS ELTVEAMMLDS A++LDKEERPEVLS+LP Y+GKSVLELGAGIG
Sbjct  12   GEEREVQKIYWIEHSKELTVEAMMLDSHASELDKEERPEVLSLLPPYKGKSVLELGAGIG  71

Query  339  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  518
            RFTGELA++AG V+A+DFIESVI+KNE++NGH  N  FMCADV+S DL+   +S DLIFS
Sbjct  72   RFTGELAKEAGHVLALDFIESVIEKNESLNGHYKNTSFMCADVSSPDLSIEADSFDLIFS  131

Query  519  NWLLMYLSDQEVESLXXRMVKWLK  590
            NWLLMYLSD+EVE L  RMVKWLK
Sbjct  132  NWLLMYLSDKEVEKLVERMVKWLK  155



>ref|XP_006843796.1| hypothetical protein AMTR_s00007p00250490 [Amborella trichopoda]
 gb|ERN05471.1| hypothetical protein AMTR_s00007p00250490 [Amborella trichopoda]
Length=489

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 134/149 (90%), Gaps = 2/149 (1%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA QGE RE+QKSYWIEHSS+LTVEAMMLDSKAA+LDKEERPEVLS+LP ++GK+VLEL
Sbjct  1    MAA-QGE-REIQKSYWIEHSSDLTVEAMMLDSKAAELDKEERPEVLSLLPPFKGKNVLEL  58

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFTGELA++AG V A+DFI+SVIKKNE INGH  NIKF+CADVTS +L F+ ES+
Sbjct  59   GAGIGRFTGELAKEAGHVTALDFIKSVIKKNEKINGHYKNIKFVCADVTSPELQFAPESV  118

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DL+FSNWLLMYLSD EVE L  R+++W+K
Sbjct  119  DLLFSNWLLMYLSDAEVEDLAKRILQWVK  147



>ref|NP_177501.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 sp|Q9C6B9.2|PEAM3_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35481.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=490

 Score =   234 bits (598),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 130/149 (87%), Gaps = 1/149 (1%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MA++ GEERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG +VLE 
Sbjct  1    MASY-GEEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTVLEF  59

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS ++NF +ES+
Sbjct  60   GAGIGRFTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPNMNFPNESM  119

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSDQEVE L  +M++W K
Sbjct  120  DLIFSNWLLMYLSDQEVEDLAKKMLQWTK  148



>gb|AAF79704.1|AC020889_12 T1N15.22 [Arabidopsis thaliana]
Length=180

 Score =   224 bits (572),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  192  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  371
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGRFTGELAQKAG  60

Query  372  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  551
            +VIA+DFIES I+KNE++NGH  NIKFMCADVTS DL   D SIDLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIQKNESVNGHYKNIKFMCADVTSPDLKIKDGSIDLIFSNWLLMYLSDKE  120

Query  552  VESLXXRMVKWLK  590
            VE +  RM+ W+K
Sbjct  121  VELMAERMIGWVK  133



>ref|XP_003567962.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Brachypodium distachyon]
Length=501

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = +3

Query  126  AIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  305
            A++      F G ER+VQKSYW EHS +LTVE+MMLDS+A DLDKEERPEVLS+LP+YEG
Sbjct  5    AVIAVVENGFVGVERKVQKSYWEEHSRDLTVESMMLDSRAKDLDKEERPEVLSILPSYEG  64

Query  306  KSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHL-GNIKFMCADVTSKDL  482
            K+VLELGAGIGRFTGELA++AG V+A+DFI+SVIKKNE INGH+  NI FMCADVTS +L
Sbjct  65   KTVLELGAGIGRFTGELAKEAGHVLALDFIDSVIKKNEEINGHIHNNITFMCADVTSPEL  124

Query  483  NFSDESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
               D SIDL+FSNWLLMYLSD+EVE L  R+VKWLK
Sbjct  125  KIEDNSIDLVFSNWLLMYLSDEEVEKLIGRIVKWLK  160



>ref|XP_006655550.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=495

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            ER+ Q+SYW EHS  LTVEAMMLDS+AADLDKEERPE+LS+LP+Y+GKSVLELGAGIGRF
Sbjct  13   ERKAQRSYWEEHSKALTVEAMMLDSRAADLDKEERPEILSVLPSYKGKSVLELGAGIGRF  72

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  524
            TGELA++AG V+A+DFIESVIKKNE  NGH  NI FMCADVTS DL   D SIDLIFSNW
Sbjct  73   TGELAKEAGHVLALDFIESVIKKNENTNGHHKNITFMCADVTSADLKIEDNSIDLIFSNW  132

Query  525  LLMYLSDQEVESLXXRMVKWLK  590
            LLMYLSD+EV+ L  RMVKWLK
Sbjct  133  LLMYLSDEEVKKLVGRMVKWLK  154



>ref|XP_006390538.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
 gb|ESQ27824.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
Length=504

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = +3

Query  132  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  311
            + S+ +    EERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+L++LP  +G++
Sbjct  10   IASSFSKNSWEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILALLPPIDGRT  69

Query  312  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  491
            VLE GAGIGRFT ELAQKAG+VIA+DFI+SVIKKNE INGH  N++FMCADVTS D+NFS
Sbjct  70   VLEFGAGIGRFTSELAQKAGKVIAVDFIDSVIKKNENINGHYKNVEFMCADVTSPDMNFS  129

Query  492  DESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DES+DLIFSNWLLMYLSD+EVE L  +M++W K
Sbjct  130  DESMDLIFSNWLLMYLSDKEVEDLAKKMLQWTK  162



>ref|XP_006376718.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
 ref|XP_006376719.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
 gb|ERP54515.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
 gb|ERP54516.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
Length=135

 Score =   222 bits (566),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EERE+QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  6    EEREIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  65

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELAQKA QV+A+DFIES IKKNE INGH  N+KFMCADVTS DLNFS+ S+DLIFSN
Sbjct  66   FTGELAQKASQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNFSEGSVDLIFSN  125

Query  522  WLLMYLSDQE  551
            WLLMYLSD+E
Sbjct  126  WLLMYLSDKE  135



>ref|XP_003534138.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN43631.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=490

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MA  Q +ER VQKSYWIEH+++L+VE+MMLDS A+DLDKEERPEVLS+LP YEGKSV+EL
Sbjct  1    MAMVQ-DERCVQKSYWIEHTTDLSVESMMLDSNASDLDKEERPEVLSLLPPYEGKSVVEL  59

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFT ELA+KAGQ++A+DFIES IKKNE+INGH  N+KFMCADVTS +L  S+ S+
Sbjct  60   GAGIGRFTVELAKKAGQLLAVDFIESAIKKNESINGHHKNVKFMCADVTSPNLYISEGSV  119

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE+L  RM+KWLK
Sbjct  120  DLIFSNWLLMYLSDKEVENLAARMIKWLK  148



>ref|XP_008453479.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=500

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +3

Query  138  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  317
            +   A   +ER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKSVL
Sbjct  5    TPAPALNDDERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKSVL  64

Query  318  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  497
            ELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS +L  S+ 
Sbjct  65   ELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTSPELKISEN  124

Query  498  SIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            S+DLIFSNWLLMYLSD EV++L  RMVKWL+
Sbjct  125  SVDLIFSNWLLMYLSDIEVKNLAERMVKWLR  155



>ref|XP_004512744.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = +3

Query  141  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  320
            AM   + +EREVQ++YW EH + L+VE+MMLDS A+ LDKEERPEVLS+LPAYEGKS+LE
Sbjct  6    AMTQVEEDEREVQRNYWREHCANLSVESMMLDSNASHLDKEERPEVLSLLPAYEGKSILE  65

Query  321  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  500
            LGAGIGRFT ELA+KAGQ++A+DFIES IKKNE INGH  N+KFMCADVTS +L+ S+ S
Sbjct  66   LGAGIGRFTSELAKKAGQLLAVDFIESAIKKNENINGHHKNVKFMCADVTSPNLHISEGS  125

Query  501  IDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            +DLIFSNWLLMYLSD+EVE+L  +MVKWLK
Sbjct  126  VDLIFSNWLLMYLSDEEVENLAEKMVKWLK  155



>ref|XP_004961340.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=498

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 131/151 (87%), Gaps = 1/151 (1%)
 Frame = +3

Query  141  AMAAFQGE-EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  317
            A+A   GE ER+VQKSYW EHS  LTVE+MMLDS+AADLDKEERPE+LS+LP+Y+GKSVL
Sbjct  7    AVANGIGEVERKVQKSYWEEHSKSLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVL  66

Query  318  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  497
            ELGAGIGRFTG+LA++AG V+A+DFIESVIKKNE+INGH  NI FMCADVTS +L   D 
Sbjct  67   ELGAGIGRFTGDLAKEAGHVLALDFIESVIKKNESINGHHKNITFMCADVTSPNLKIEDN  126

Query  498  SIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            S DLIFSNWLLMYLSD+EVE L  +MVKWLK
Sbjct  127  SFDLIFSNWLLMYLSDEEVEKLVGKMVKWLK  157



>ref|XP_010416170.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Camelina 
sativa]
Length=490

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 130/149 (87%), Gaps = 1/149 (1%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA+ GEERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE 
Sbjct  1    MAAY-GEEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEF  59

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+
Sbjct  60   GAGIGRFTTELAQKAGQLIAVDFIESVIKKNKNINGHYRNVKFMCADVTSPDMKFPNDSM  119

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  +M++W K
Sbjct  120  DLIFSNWLLMYLSDKEVEDLAKKMLQWTK  148



>ref|XP_009404071.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Musa acuminata subsp. malaccensis]
Length=497

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EEREVQKSYW+EHS +LT+EAMMLDS+A++LDKEERPEVLS+LP Y+GKSVLELGAGIGR
Sbjct  13   EEREVQKSYWMEHSRDLTLEAMMLDSRASELDKEERPEVLSLLPPYKGKSVLELGAGIGR  72

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FT ELA++AG V+A+DFIESVIKKNE++NGH  N  FMCADVTS DL    +S+DLIFSN
Sbjct  73   FTSELAKEAGHVLALDFIESVIKKNESLNGHYKNTSFMCADVTSPDLTIEADSVDLIFSN  132

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE L  RMVKW+K
Sbjct  133  WLLMYLSDKEVEKLVERMVKWVK  155



>ref|XP_010428286.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Camelina sativa]
Length=492

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 130/149 (87%), Gaps = 1/149 (1%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA+ GEERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE 
Sbjct  3    MAAY-GEEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEF  61

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+
Sbjct  62   GAGIGRFTTELAQKAGQLIAVDFIESVIKKNKYINGHYKNVKFMCADVTSPDMKFPNDSM  121

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  +M++W K
Sbjct  122  DLIFSNWLLMYLSDKEVEDLAKKMLQWTK  150



>ref|XP_010921197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Elaeis guineensis]
Length=499

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER VQKS+W+EHS +L VEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS+LELGAGIGR
Sbjct  10   EERTVQKSFWMEHSKDLNVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSILELGAGIGR  69

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA++AG V+A+DFIE VIKKNE++NGH  NI FMCADVTS DL    ES+DLIFSN
Sbjct  70   FTGELAKEAGHVLALDFIEDVIKKNESVNGHFKNISFMCADVTSPDLMIEAESVDLIFSN  129

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD EVE L  RMVKW K
Sbjct  130  WLLMYLSDNEVEKLAERMVKWSK  152



>ref|XP_008799222.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X3 [Phoenix dactylifera]
Length=482

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  174  VQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGE  353
            VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKSVLELGAGIGRFTGE
Sbjct  2    VQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSVLELGAGIGRFTGE  61

Query  354  LAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLM  533
            LA++AG V+AMDFI++VIKKNE+INGH  N  FMC DVTS DL    ES+DLIFSNWLLM
Sbjct  62   LAKEAGHVLAMDFIKNVIKKNESINGHFKNTSFMCTDVTSPDLMIEAESVDLIFSNWLLM  121

Query  534  YLSDQEVESLXXRMVKWLK  590
            YLSD EVE L  RMVKWLK
Sbjct  122  YLSDNEVEGLAQRMVKWLK  140



>gb|AFW04224.1| phosphoethanolamine N-methyl transferase [Suaeda maritima]
Length=494

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +ER+V K YW+EH+ +LT+EAMMLDS+A+DLDKEERPE+LSMLP  EGK +LELGAGIGR
Sbjct  10   QERDVFKKYWVEHTVDLTIEAMMLDSQASDLDKEERPEILSMLPPLEGKCLLELGAGIGR  69

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA+KAGQVIA+DFIES IKKNE INGH  N+KFMCADVTS  L+F   S+D+IFSN
Sbjct  70   FTGELAEKAGQVIALDFIESAIKKNEVINGHYKNVKFMCADVTSPTLSFPPHSLDVIFSN  129

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE L  RM+KWLK
Sbjct  130  WLLMYLSDEEVEDLVERMLKWLK  152



>dbj|BAC57432.1| phosphoethanolamine N-methyltransferase [Suaeda japonica]
Length=494

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +ER+V K YW+EH+ +LT+EAMMLDS+A+DLDKEERPE+LSMLP  EGK +LELGAGIGR
Sbjct  10   QERDVFKKYWVEHTVDLTIEAMMLDSQASDLDKEERPEILSMLPPLEGKCLLELGAGIGR  69

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA+KAGQVIA+DFIES IKKNE INGH  N+KFMCADVTS  L+F   S+D+IFSN
Sbjct  70   FTGELAEKAGQVIALDFIESAIKKNEVINGHYKNVKFMCADVTSPTLSFPPHSLDVIFSN  129

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE+L  RM+KWLK
Sbjct  130  WLLMYLSDEEVENLVERMLKWLK  152



>ref|XP_004241642.1| PREDICTED: phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=494

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  138  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  317
            +A+A   GEERE+QKSYW+E +SEL +EAMM DS A+DLDKE+RPEVLS+LP+YEGKSVL
Sbjct  2    AAIAPEVGEEREIQKSYWMEQTSELNLEAMMRDSAASDLDKEDRPEVLSLLPSYEGKSVL  61

Query  318  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  497
            ELGAGIGRFTG+LA+KAG+++A+DFIE V KKNE+INGH  N+KF+CADVTS DL    E
Sbjct  62   ELGAGIGRFTGDLAEKAGELVAVDFIEEVTKKNESINGHHKNVKFVCADVTSPDLTVLPE  121

Query  498  SIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            S+DLIFSNWLLMYLS++EV+ L  RM+KWLK
Sbjct  122  SVDLIFSNWLLMYLSNEEVQDLAERMIKWLK  152



>ref|XP_010921188.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Elaeis guineensis]
Length=537

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER VQKS+W+EHS +L VEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS+LELGAGIGR
Sbjct  48   EERTVQKSFWMEHSKDLNVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSILELGAGIGR  107

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA++AG V+A+DFIE VIKKNE++NGH  NI FMCADVTS DL    ES+DLIFSN
Sbjct  108  FTGELAKEAGHVLALDFIEDVIKKNESVNGHFKNISFMCADVTSPDLMIEAESVDLIFSN  167

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD EVE L  RMVKW K
Sbjct  168  WLLMYLSDNEVEKLAERMVKWSK  190



>ref|XP_002887491.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63750.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=490

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = +3

Query  150  AFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGA  329
            A  GEERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L++LP  EGK+VLE GA
Sbjct  2    AVYGEEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILALLPPIEGKTVLEFGA  61

Query  330  GIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDL  509
            GIGRFT  LA KAGQ+IA+DFIESVIKKN+ INGH  N+KF+CADVTS D+NF +ES+DL
Sbjct  62   GIGRFTTNLAHKAGQLIAVDFIESVIKKNQNINGHYKNVKFLCADVTSPDMNFPNESMDL  121

Query  510  IFSNWLLMYLSDQEVESLXXRMVKWLK  590
            IFSNWLLMYLSD+EVE L  +M++W K
Sbjct  122  IFSNWLLMYLSDREVEDLAKKMLQWTK  148



>ref|NP_974139.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35480.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=504

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG +VLE GAGIGR
Sbjct  20   EEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTVLEFGAGIGR  79

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS ++NF +ES+DLIFSN
Sbjct  80   FTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPNMNFPNESMDLIFSN  139

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSDQEVE L  +M++W K
Sbjct  140  WLLMYLSDQEVEDLAKKMLQWTK  162



>gb|ABK42071.1| phosphoethanolamine N-methyltransferase [Suaeda liaotungensis]
Length=494

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +ER+V K YW+EH+ +LT+EAMMLDS+A+DLDKEERPE+LSMLP  EGK +LELGAGIGR
Sbjct  10   QERDVFKKYWVEHTVDLTIEAMMLDSQASDLDKEERPEILSMLPPLEGKCLLELGAGIGR  69

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA+KAGQVIA+DFIES IKKNE INGH  N+KFMCADVTS  L+F   S+D+IFSN
Sbjct  70   FTGELAEKAGQVIALDFIESAIKKNEVINGHYKNVKFMCADVTSPTLSFPPHSLDVIFSN  129

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE L  RM+KWLK
Sbjct  130  WLLMYLSDEEVEDLVERMLKWLK  152



>gb|KFK41794.1| hypothetical protein AALP_AA2G173000 [Arabis alpina]
Length=505

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  129  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  308
            ++ S+     GEERE+QK+YW EHS++L+VE+MMLDS+AADLDKEERPE++++LP  EGK
Sbjct  10   MISSSFPKNLGEEREIQKNYWKEHSADLSVESMMLDSQAADLDKEERPEIVALLPPIEGK  69

Query  309  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  488
            +VLE GAGIGRFT ELA+KAG VIA+DFI++ IKKN+ INGH  N+KFMCADVTS D+ F
Sbjct  70   TVLEFGAGIGRFTTELARKAGHVIAVDFIDNAIKKNQNINGHYKNVKFMCADVTSPDMKF  129

Query  489  SDESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            SDES+DLIFSNWLLMYLSD+EVE L  +M++W K
Sbjct  130  SDESMDLIFSNWLLMYLSDKEVEDLAKKMLQWTK  163



>ref|XP_002441466.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
 gb|EES19896.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
Length=510

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            ER+VQKSYW EHS +LTVE+MMLDS+AADLDKEERPE+LS+LP+Y+GKSVLELGAGIGRF
Sbjct  28   ERKVQKSYWEEHSKDLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVLELGAGIGRF  87

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  524
            TG+LA++AG V+A+DFIESVIKKN++INGH  NI F CADVTS +L   D S+DLIFSNW
Sbjct  88   TGDLAKEAGHVLALDFIESVIKKNQSINGHHKNITFKCADVTSPELKIEDNSVDLIFSNW  147

Query  525  LLMYLSDQEVESLXXRMVKWLK  590
            LLMYLSD+EVE L  +MVKWLK
Sbjct  148  LLMYLSDEEVEKLVGKMVKWLK  169



>ref|XP_004512745.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Cicer arietinum]
Length=496

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +EREVQ++YW EH + L+VE+MMLDS A+ LDKEERPEVLS+LPAYEGKS+LELGAGIGR
Sbjct  12   DEREVQRNYWREHCANLSVESMMLDSNASHLDKEERPEVLSLLPAYEGKSILELGAGIGR  71

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FT ELA+KAGQ++A+DFIES IKKNE INGH  N+KFMCADVTS +L+ S+ S+DLIFSN
Sbjct  72   FTSELAKKAGQLLAVDFIESAIKKNENINGHHKNVKFMCADVTSPNLHISEGSVDLIFSN  131

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE+L  +MVKWLK
Sbjct  132  WLLMYLSDEEVENLAEKMVKWLK  154



>ref|XP_006302164.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
 gb|EOA35062.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
Length=503

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+L++LP  EGK+VLE GAGIGR
Sbjct  19   EEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILALLPPIEGKTVLEFGAGIGR  78

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+DLIFSN
Sbjct  79   FTTELAQKAGQLIAVDFIESVIKKNKKINGHYKNVKFMCADVTSPDMKFPNDSVDLIFSN  138

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE L  +M++W K
Sbjct  139  WLLMYLSDKEVEDLAKKMLQWTK  161



>ref|NP_001169597.1| uncharacterized LOC100383478 [Zea mays]
 gb|ABF83429.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
 gb|ACN34220.1| unknown [Zea mays]
 gb|AFW78993.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
Length=501

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 131/151 (87%), Gaps = 1/151 (1%)
 Frame = +3

Query  141  AMAAFQGE-EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  317
            A+A   GE ER+VQKSYW EHS  LTVE+MMLDS+AADLDKEERPE+LS+LP+Y+GKSVL
Sbjct  10   AVANGIGEVERKVQKSYWEEHSKCLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVL  69

Query  318  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  497
            ELGAGIGRFTG+LA++AG V+A+DFIESVIKKN++INGH  NI F CADVTS DL   D 
Sbjct  70   ELGAGIGRFTGDLAKEAGHVLALDFIESVIKKNQSINGHHKNITFRCADVTSNDLKIEDN  129

Query  498  SIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            S+DLIFSNWLLMYLSD+EV+ L  +MVKWLK
Sbjct  130  SVDLIFSNWLLMYLSDEEVQKLVGKMVKWLK  160



>ref|XP_004969637.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER+ Q+SYW EHS +LTVEAMMLDS+AA+LDKE+RPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  16   EERKAQRSYWEEHSRDLTVEAMMLDSRAAELDKEDRPEVLSLLPSYEGKSVLELGAGIGR  75

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA+ AG V A+DFIESVIKKNE+ NGH  N  FMCADVTS DL   + S+DLIFSN
Sbjct  76   FTGELAKTAGHVFALDFIESVIKKNESTNGHYKNTSFMCADVTSPDLIIEENSVDLIFSN  135

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+E++ L  RMVKWLK
Sbjct  136  WLLMYLSDEEIDKLAERMVKWLK  158



>ref|XP_010471422.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Camelina sativa]
Length=490

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 129/149 (87%), Gaps = 1/149 (1%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MAA+  EERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE 
Sbjct  1    MAAYV-EEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEF  59

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIGRFT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+
Sbjct  60   GAGIGRFTTELAQKAGQLIAVDFIESVIKKNKNINGHYKNVKFMCADVTSPDMKFPNDSM  119

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE L  +M++W K
Sbjct  120  DLIFSNWLLMYLSDKEVEDLSKKMLQWTK  148



>ref|XP_006393388.1| hypothetical protein EUTSA_v10012068mg, partial [Eutrema salsugineum]
 gb|ESQ30674.1| hypothetical protein EUTSA_v10012068mg, partial [Eutrema salsugineum]
Length=258

 Score =   222 bits (566),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  323
            MA    EER +QKSY  E+SS+LTVEA+MLDSK +D DKEERPEVLS++P YEGK+VLEL
Sbjct  1    MATPYKEERVIQKSYLKENSSDLTVEAIMLDSKDSDPDKEERPEVLSLIPPYEGKTVLEL  60

Query  324  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  503
            GAGIG FTGELAQKAG+VIA+DFIES IKKN ++NGH  N+KFMCADV S DL  +D SI
Sbjct  61   GAGIGHFTGELAQKAGEVIALDFIESAIKKNASVNGHYKNVKFMCADVRSPDLKITDASI  120

Query  504  DLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            DLIFSNWLLMYLSD+EVE    RM+ W+K
Sbjct  121  DLIFSNWLLMYLSDKEVELFSKRMLGWIK  149



>dbj|BAE99185.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
Length=504

 Score =   229 bits (585),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG + LE GAGIGR
Sbjct  20   EEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTALEFGAGIGR  79

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS ++NF +ES+DLIFSN
Sbjct  80   FTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPNMNFPNESMDLIFSN  139

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSDQEVE L  +M++W K
Sbjct  140  WLLMYLSDQEVEDLAKKMLQWAK  162



>dbj|BAG50404.1| methyltransferase [Cardamine sp. SIM-2007]
Length=148

 Score =   218 bits (555),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  198  HSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQV  377
            HS++LTVEAMMLDS+A+DLDKEERP VLS+LP+YEGKSVLELGAGIGRFT ELAQKAG++
Sbjct  1    HSADLTVEAMMLDSRASDLDKEERPGVLSLLPSYEGKSVLELGAGIGRFTSELAQKAGEL  60

Query  378  IAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVE  557
            IA+DFI+SVIKKNE+INGH  N+KFMCADVTS DL  +D S+DLIFSNWLLMYLSD+EVE
Sbjct  61   IALDFIDSVIKKNESINGHYKNVKFMCADVTSPDLKITDGSLDLIFSNWLLMYLSDKEVE  120

Query  558  SLXXRMVKWLK  590
             L  RMV W+K
Sbjct  121  LLAERMVGWIK  131



>gb|ABG57185.1| phosphoethanolamine N-methyltransferase [Salicornia europaea]
Length=494

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER V K YW+EH+++LTVE+MMLDS+A+DLDKEERPE+LS+LP  EGK VLELGAGIGR
Sbjct  10   EERNVFKKYWVEHTTDLTVESMMLDSQASDLDKEERPEILSLLPNLEGKCVLELGAGIGR  69

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA+KAGQVIA+DFI+  IKKNE I+GH  N+KFMCADVTS  LNF   S+D+IFSN
Sbjct  70   FTGELAEKAGQVIALDFIDKAIKKNEYIDGHYKNVKFMCADVTSPTLNFPPNSLDVIFSN  129

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE L  RM+KWLK
Sbjct  130  WLLMYLSDEEVEHLVERMLKWLK  152



>ref|XP_010471421.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Camelina sativa]
Length=504

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE GAGIGR
Sbjct  20   EEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEFGAGIGR  79

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+DLIFSN
Sbjct  80   FTTELAQKAGQLIAVDFIESVIKKNKNINGHYKNVKFMCADVTSPDMKFPNDSMDLIFSN  139

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE L  +M++W K
Sbjct  140  WLLMYLSDKEVEDLSKKMLQWTK  162



>ref|XP_003619836.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AES76054.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=497

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  141  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  320
            AM     +EREVQ+SYW EH   L+VE+MMLDS A+ LDKEERPEVLS+LP+YEGKSVLE
Sbjct  6    AMKQGGEDEREVQRSYWKEHCVNLSVESMMLDSNASHLDKEERPEVLSLLPSYEGKSVLE  65

Query  321  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  500
            LGAGIGRFT ELAQKAGQ++A+DFIES IKKNE  NGH  N+KFMCADVTS +L+ S+ S
Sbjct  66   LGAGIGRFTAELAQKAGQLLAVDFIESAIKKNENTNGHHKNVKFMCADVTSPNLHISEGS  125

Query  501  IDLIFSNWLLMYLSDQEVESLXXRMVKWL  587
            +DLIFSNWLLMYLSD+EV++L  RMVKWL
Sbjct  126  VDLIFSNWLLMYLSDEEVKNLAERMVKWL  154



>ref|XP_010428285.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Camelina sativa]
Length=504

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE GAGIGR
Sbjct  20   EEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEFGAGIGR  79

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+DLIFSN
Sbjct  80   FTTELAQKAGQLIAVDFIESVIKKNKYINGHYKNVKFMCADVTSPDMKFPNDSMDLIFSN  139

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+EVE L  +M++W K
Sbjct  140  WLLMYLSDKEVEDLAKKMLQWTK  162



>ref|NP_175293.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 gb|AAL16223.1|AF428454_1 At1g48600/T1N15_20 [Arabidopsis thaliana]
 gb|AAL36222.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AAM91745.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AEE32324.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=475

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  192  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  371
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGRFTGELAQKAG  60

Query  372  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  551
            +VIA+DFIES I+KNE++NGH  NIKFMCADVTS DL   D SIDLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIQKNESVNGHYKNIKFMCADVTSPDLKIKDGSIDLIFSNWLLMYLSDKE  120

Query  552  VESLXXRMVKWLK  590
            VE +  RM+ W+K
Sbjct  121  VELMAERMIGWVK  133



>ref|XP_007160543.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
 gb|ESW32537.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
Length=517

 Score =   225 bits (573),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            ER++QK YW++HS++L+VEAMMLDSKAA LDKEERPEVLS+LP  EGKSV+ELGAGIGRF
Sbjct  11   ERDMQKLYWVQHSADLSVEAMMLDSKAAHLDKEERPEVLSLLPPCEGKSVIELGAGIGRF  70

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDL--NFSDESIDLIFS  518
            TGELAQKAGQ++A+DFIES IKKNE+INGH  N+KF+CADVTS ++  + S+ S+D+IFS
Sbjct  71   TGELAQKAGQLLAVDFIESAIKKNESINGHHKNVKFLCADVTSPNMSSSVSEGSVDVIFS  130

Query  519  NWLLMYLSDQEVESLXXRMVKWLK  590
            NWLLMYLSD EVE L  RM+KWLK
Sbjct  131  NWLLMYLSDNEVEKLAERMIKWLK  154



>ref|XP_007160542.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
 gb|ESW32536.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
Length=496

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            ER++QK YW++HS++L+VEAMMLDSKAA LDKEERPEVLS+LP  EGKSV+ELGAGIGRF
Sbjct  11   ERDMQKLYWVQHSADLSVEAMMLDSKAAHLDKEERPEVLSLLPPCEGKSVIELGAGIGRF  70

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDL--NFSDESIDLIFS  518
            TGELAQKAGQ++A+DFIES IKKNE+INGH  N+KF+CADVTS ++  + S+ S+D+IFS
Sbjct  71   TGELAQKAGQLLAVDFIESAIKKNESINGHHKNVKFLCADVTSPNMSSSVSEGSVDVIFS  130

Query  519  NWLLMYLSDQEVESLXXRMVKWLK  590
            NWLLMYLSD EVE L  RM+KWLK
Sbjct  131  NWLLMYLSDNEVEKLAERMIKWLK  154



>ref|XP_003525185.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
Length=488

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +ER +QKSYW++HS++L+VEAMMLDSKAA LDKEERPEVLS+LP +EGKSV+ELGAGIGR
Sbjct  2    DERHIQKSYWLQHSADLSVEAMMLDSKAAHLDKEERPEVLSLLPPFEGKSVIELGAGIGR  61

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDL--NFSDESIDLIF  515
            FTGELA KAGQ++A+DFI++ IKKNETINGH  ++KF+CADVTS ++  N S+ S+D++F
Sbjct  62   FTGELALKAGQLLAVDFIDTAIKKNETINGHHNHVKFLCADVTSPNMSNNVSEGSVDVVF  121

Query  516  SNWLLMYLSDQEVESLXXRMVKWLK  590
            SNWLLMYLSD EVE L  RMV+WLK
Sbjct  122  SNWLLMYLSDIEVEKLAERMVRWLK  146



>ref|XP_002456193.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
 gb|EES01313.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
Length=499

 Score =   224 bits (571),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
             ER+ Q+SYW EHS ELT+EAMMLDS+AA+LDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  16   HERKAQRSYWEEHSGELTLEAMMLDSRAAELDKEERPEVLSLLPSYEGKSVLELGAGIGR  75

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA+ +G V A+DFIES IKKNE+ NGH  N  FMCADVTS +L     SIDLIFSN
Sbjct  76   FTGELAKTSGHVFAVDFIESAIKKNESTNGHYDNTSFMCADVTSPNLMIEANSIDLIFSN  135

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+E++ L  RMVKWLK
Sbjct  136  WLLMYLSDEEIDKLVERMVKWLK  158



>ref|XP_008675146.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Zea mays]
Length=483

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = +3

Query  132  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  311
            V  ++      ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS
Sbjct  8    VNGSLDRLDVHERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKS  67

Query  312  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  491
            +LELGAGIGRFTGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS DL   
Sbjct  68   ILELGAGIGRFTGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSTDLMIE  127

Query  492  DESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
              SIDLIFSNWLLMYLSD+E++ L  RMVKWLK
Sbjct  128  ANSIDLIFSNWLLMYLSDEEIDKLVERMVKWLK  160



>ref|XP_006393387.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
 gb|ESQ30673.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
Length=475

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  192  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  371
            +E+SS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK+VLELGAGIGRFTGELAQKAG
Sbjct  1    MENSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKTVLELGAGIGRFTGELAQKAG  60

Query  372  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  551
            +VIA+DFIES IKKNE++NGH  N+KFMCADVTS+DL  +D SIDLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIKKNESVNGHYKNVKFMCADVTSQDLKITDGSIDLIFSNWLLMYLSDKE  120

Query  552  VESLXXRMVKWLK  590
            VE L  RM+ W+K
Sbjct  121  VELLAERMLGWIK  133



>emb|CDX93681.1| BnaA06g03670D [Brassica napus]
Length=473

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  192  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  371
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK VLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKKVLELGAGIGRFTGELAQKAG  60

Query  372  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  551
            +VIA+DFIES IKKNE++NGH  N+KFMCADVTS DL   D S+DLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIKKNESVNGHYKNVKFMCADVTSPDLKIEDGSVDLIFSNWLLMYLSDKE  120

Query  552  VESLXXRMVKWLK  590
            VE L  RM+ W+K
Sbjct  121  VELLAERMLGWVK  133



>emb|CDY40594.1| BnaC06g02100D [Brassica napus]
Length=473

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  192  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  371
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK VLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKKVLELGAGIGRFTGELAQKAG  60

Query  372  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  551
            +VIA+DFIES IKKNE++NGH  N+KFMCADVTS DL   D S+DLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIKKNESVNGHYKNVKFMCADVTSPDLKIEDGSVDLIFSNWLLMYLSDKE  120

Query  552  VESLXXRMVKWLK  590
            VE L  RM+ W+K
Sbjct  121  VELLAERMLGWVK  133



>ref|XP_008675144.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Zea mays]
 ref|XP_008675145.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Zea mays]
Length=501

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = +3

Query  132  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  311
            V  ++      ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS
Sbjct  8    VNGSLDRLDVHERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKS  67

Query  312  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  491
            +LELGAGIGRFTGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS DL   
Sbjct  68   ILELGAGIGRFTGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSTDLMIE  127

Query  492  DESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
              SIDLIFSNWLLMYLSD+E++ L  RMVKWLK
Sbjct  128  ANSIDLIFSNWLLMYLSDEEIDKLVERMVKWLK  160



>gb|AAV67950.1| putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=495

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
             ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS+LELGAGIGR
Sbjct  12   HERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKSILELGAGIGR  71

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS DL     SIDLIFSN
Sbjct  72   FTGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSPDLMIEANSIDLIFSN  131

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+E++ L  RMVKWLK
Sbjct  132  WLLMYLSDEEIDKLVERMVKWLK  154



>tpg|DAA57997.1| TPA: putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=498

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
             ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS+LELGAGIGR
Sbjct  15   HERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKSILELGAGIGR  74

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS DL     SIDLIFSN
Sbjct  75   FTGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSTDLMIEANSIDLIFSN  134

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYLSD+E++ L  RMVKWLK
Sbjct  135  WLLMYLSDEEIDKLVERMVKWLK  157



>ref|XP_010461685.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
 ref|XP_010461686.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=234

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 120/134 (90%), Gaps = 1/134 (1%)
 Frame = +3

Query  192  IEHSSELTVEAMMLDSKAADLDKEERPE-VLSMLPAYEGKSVLELGAGIGRFTGELAQKA  368
            +EHSS+LTVEAMMLDSKA+DLDKEERPE VLS++P YEGKSVLELGAGIGRFT ELAQKA
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEEVLSLVPPYEGKSVLELGAGIGRFTVELAQKA  60

Query  369  GQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQ  548
            G+VIA+DFIES I+KNE+INGH   +KFMCADVTS DL  +D SIDLIFSNWLLMYLSD+
Sbjct  61   GEVIAVDFIESDIQKNESINGHYKKVKFMCADVTSPDLKIADGSIDLIFSNWLLMYLSDK  120

Query  549  EVESLXXRMVKWLK  590
            EVE +  RM+KW+K
Sbjct  121  EVELMAERMLKWVK  134



>gb|AFZ78648.1| methyl transferase [Populus tomentosa]
Length=485

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  192  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  371
            ++++S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGRFTGELAQKAG
Sbjct  1    MDNTSDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGRFTGELAQKAG  60

Query  372  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  551
            QV+A+DFIES IKKNE INGH  N+KFMCADVTS DLN S+ S+DLIFSNWLLMYLSD+E
Sbjct  61   QVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNISEGSVDLIFSNWLLMYLSDKE  120

Query  552  VESLXXRMVKWLK  590
            VE+L  RMVKW+K
Sbjct  121  VENLVERMVKWVK  133



>gb|AAL40895.1| phosphoethanolamine methyltransferase [Triticum aestivum]
Length=498

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            ER+VQKSYW EHS +LTVE+MMLDS+A DLDKEERPEVL++LP+Y GK+VLELGAGIGRF
Sbjct  15   ERKVQKSYWEEHSKDLTVESMMLDSRAKDLDKEERPEVLAILPSYAGKTVLELGAGIGRF  74

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHL-GNIKFMCADVTSKDLNFSDESIDLIFSN  521
            TGELA++AG VIA+DFI+SVIKKNE ING +  NI FMCADVTS +L   D S+D++FSN
Sbjct  75   TGELAKEAGHVIALDFIDSVIKKNEEINGDIYKNITFMCADVTSPELKIEDNSVDIVFSN  134

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYL+D+EVE L  R+VKWLK
Sbjct  135  WLLMYLNDEEVEKLIGRIVKWLK  157



>ref|XP_010500398.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=474

 Score =   216 bits (550),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 121/134 (90%), Gaps = 1/134 (1%)
 Frame = +3

Query  192  IEHSSELTVEAMMLDSKAADLDKEERPE-VLSMLPAYEGKSVLELGAGIGRFTGELAQKA  368
            +EHSS+LTVEAMMLDSKA+DLDKEERPE VLS++P YEGKSVLELGAGIGRFTGELAQKA
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEEVLSLIPPYEGKSVLELGAGIGRFTGELAQKA  60

Query  369  GQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQ  548
            G+VIA+DFIES I+KNE++NG   N+KF+CADVTS DL  +D SIDLIFSNWLLMYLSD+
Sbjct  61   GEVIALDFIESAIQKNESVNGQYKNVKFICADVTSPDLKIADGSIDLIFSNWLLMYLSDK  120

Query  549  EVESLXXRMVKWLK  590
            EVE +  RM+KW+K
Sbjct  121  EVELMAERMLKWVK  134



>ref|XP_010921205.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921212.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921222.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921230.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921238.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
Length=480

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  192  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  371
            +EHS +L VEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS+LELGAGIGRFTGELA++AG
Sbjct  1    MEHSKDLNVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSILELGAGIGRFTGELAKEAG  60

Query  372  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  551
             V+A+DFIE VIKKNE++NGH  NI FMCADVTS DL    ES+DLIFSNWLLMYLSD E
Sbjct  61   HVLALDFIEDVIKKNESVNGHFKNISFMCADVTSPDLMIEAESVDLIFSNWLLMYLSDNE  120

Query  552  VESLXXRMVKWLK  590
            VE L  RMVKW K
Sbjct  121  VEKLAERMVKWSK  133



>ref|XP_002317875.2| Phosphoethanolamine N-methyltransferase 1 family protein, partial 
[Populus trichocarpa]
 gb|EEE96095.2| Phosphoethanolamine N-methyltransferase 1 family protein, partial 
[Populus trichocarpa]
Length=129

 Score =   203 bits (516),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  192  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  371
            +++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGRFTGELAQKA 
Sbjct  1    MDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGRFTGELAQKAS  60

Query  372  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  551
            QV+A+DFIES IKKNE INGH  N+KFMCADV S DLNFS+ S+DLIFSNWLLMYLSD+E
Sbjct  61   QVVALDFIESAIKKNENINGHYKNVKFMCADVKSPDLNFSEGSVDLIFSNWLLMYLSDKE  120

Query  552  VESL  563
            V  L
Sbjct  121  VNRL  124



>ref|XP_002284594.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Vitis vinifera]
Length=490

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +3

Query  159  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  338
            GEER+VQKSYW+EHS+ELTVEAMMLDS+A+DLDKEERPE+LS+LP  EGK V+ELGAGIG
Sbjct  5    GEERDVQKSYWMEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIG  64

Query  339  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  518
            RFTGELA++AGQV+A+DFIESVI++NE ING   N KF+CADVTS DL+ S  S+DLIFS
Sbjct  65   RFTGELAKQAGQVLAIDFIESVIRENEVINGRFKNTKFVCADVTSPDLDISPGSVDLIFS  124

Query  519  NWLLMYLSDQEVESLXXRMVKWLK  590
            NWLLMYLSD+EVE L  RMVKWLK
Sbjct  125  NWLLMYLSDKEVEDLAERMVKWLK  148



>gb|KJB53041.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=448

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  6    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  65

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  524
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS DL+ S+ S+DLIFSN 
Sbjct  66   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPDLDISEGSMDLIFSNL  125

Query  525  LLMYLSDQEVESLXXRMVKWLK  590
            LLMYLS++EVE+L   M+KWLK
Sbjct  126  LLMYLSNEEVENLAQGMMKWLK  147



>gb|KJB53038.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=480

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  6    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  65

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  524
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS DL+ S+ S+DLIFSN 
Sbjct  66   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPDLDISEGSMDLIFSNL  125

Query  525  LLMYLSDQEVESLXXRMVKWLK  590
            LLMYLS++EVE+L   M+KWLK
Sbjct  126  LLMYLSNEEVENLAQGMMKWLK  147



>gb|KJB53040.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=489

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  6    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  65

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  524
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS DL+ S+ S+DLIFSN 
Sbjct  66   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPDLDISEGSMDLIFSNL  125

Query  525  LLMYLSDQEVESLXXRMVKWLK  590
            LLMYLS++EVE+L   M+KWLK
Sbjct  126  LLMYLSNEEVENLAQGMMKWLK  147



>gb|KJB53039.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=488

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  5    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  64

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  524
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS DL+ S+ S+DLIFSN 
Sbjct  65   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPDLDISEGSMDLIFSNL  124

Query  525  LLMYLSDQEVESLXXRMVKWLK  590
            LLMYLS++EVE+L   M+KWLK
Sbjct  125  LLMYLSNEEVENLAQGMMKWLK  146



>emb|CDX92181.1| BnaA05g22260D [Brassica napus]
Length=464

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  225  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  404
            MMLDS+AADLDKEERPEVLS+LP YEGKSVLELGAGIGRFTGELAQKAG++IA+DFI+SV
Sbjct  1    MMLDSRAADLDKEERPEVLSLLPPYEGKSVLELGAGIGRFTGELAQKAGELIALDFIDSV  60

Query  405  IKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLXXRMVKW  584
            IKKN+++NGH  N+KFMCADVTS DLN +D SIDLIFSNWLLMYLSD+EVE L  RMV W
Sbjct  61   IKKNKSVNGHYKNVKFMCADVTSPDLNITDGSIDLIFSNWLLMYLSDKEVELLVERMVGW  120

Query  585  LK  590
            +K
Sbjct  121  IK  122



>gb|KJB30120.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=465

 Score =   210 bits (535),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  225  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  404
            MMLDSKAAD+DKEERPEVLS+LP YEGK++LELGAGIGRFTG+LA+KAG VIA+DFIE+V
Sbjct  1    MMLDSKAADIDKEERPEVLSLLPPYEGKTILELGAGIGRFTGDLAKKAGHVIALDFIENV  60

Query  405  IKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLXXRMVKW  584
            IKKNETINGH  N+KF+CADVTS DL F++ S+DLIFSNWLLMYLSD+EVE+L  RM+KW
Sbjct  61   IKKNETINGHYKNVKFLCADVTSPDLAFTEGSLDLIFSNWLLMYLSDKEVENLAERMLKW  120

Query  585  LK  590
            LK
Sbjct  121  LK  122



>ref|XP_001763293.1| predicted protein [Physcomitrella patens]
 gb|EDQ71823.1| predicted protein [Physcomitrella patens]
Length=491

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            ER +Q +YW EHS E +VEAMMLDS+A+ LDKEERPE+LS+LP YE K V+ELGAGIGRF
Sbjct  6    ERSLQSTYWKEHSVEPSVEAMMLDSQASKLDKEERPEILSLLPPYENKDVMELGAGIGRF  65

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  524
            TGELA+ AG V+AMDF+E++IKKNE +NGH  NI F CADVTS DLN +  S DL+FSNW
Sbjct  66   TGELAKHAGHVLAMDFMENLIKKNEDVNGHYNNIDFKCADVTSPDLNIAAGSADLVFSNW  125

Query  525  LLMYLSDQEVESLXXRMVKWLK  590
            LLMYLSD+EV+ L  R+++WL+
Sbjct  126  LLMYLSDEEVKGLASRVMEWLR  147



>gb|EEC79642.1| hypothetical protein OsI_20868 [Oryza sativa Indica Group]
Length=504

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 118/151 (78%), Gaps = 9/151 (6%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERP---------EVLSMLPAYEGKSVL  317
            ER+ Q+SYW EHS +LTVEAMMLDS+     +   P         +VLS+LP+Y+GKSVL
Sbjct  13   ERKAQRSYWEEHSKDLTVEAMMLDSRPRRPRQGGAPRGLIGTVDAQVLSVLPSYKGKSVL  72

Query  318  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  497
            ELGAGIGRFTGELA++AG V+A+DFIESVIKKNE INGH  NI FMCADVTS DL   D 
Sbjct  73   ELGAGIGRFTGELAKEAGHVLALDFIESVIKKNENINGHHKNITFMCADVTSPDLTIEDN  132

Query  498  SIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            SIDLIFSNWLLMYLSD+EVE L  RMVKWLK
Sbjct  133  SIDLIFSNWLLMYLSDEEVEKLVGRMVKWLK  163



>ref|XP_010655650.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Vitis vinifera]
Length=494

 Score =   208 bits (530),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 129/148 (87%), Gaps = 4/148 (3%)
 Frame = +3

Query  159  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  338
            GEER+VQKSYW+EHS+ELTVEAMMLDS+A+DLDKEERPE+LS+LP  EGK V+ELGAGIG
Sbjct  5    GEERDVQKSYWMEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIG  64

Query  339  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  518
            RFTGELA++AGQV+A+DFIESVI++NE ING   N KF+CADVTS DL+ S  S+DLIFS
Sbjct  65   RFTGELAKQAGQVLAIDFIESVIRENEVINGRFKNTKFVCADVTSPDLDISPGSVDLIFS  124

Query  519  NWLLMYLSDQE----VESLXXRMVKWLK  590
            NWLLMYLSD+E    VE L  RMVKWLK
Sbjct  125  NWLLMYLSDKEVVTMVEDLAERMVKWLK  152



>ref|XP_006306318.1| hypothetical protein CARUB_v10012188mg, partial [Capsella rubella]
 gb|EOA39216.1| hypothetical protein CARUB_v10012188mg, partial [Capsella rubella]
Length=354

 Score =   199 bits (507),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 118/136 (87%), Gaps = 3/136 (2%)
 Frame = +3

Query  192  IEHSSELTVEAMMLDS-KAADLDKEE--RPEVLSMLPAYEGKSVLELGAGIGRFTGELAQ  362
            +EHSS+LT EAMMLDS +A+DLD+EE  RPEVLS++P YEGKSVLELGAGI RF GE+AQ
Sbjct  1    MEHSSDLTAEAMMLDSTEASDLDEEEERRPEVLSLIPPYEGKSVLELGAGIDRFIGEVAQ  60

Query  363  KAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLS  542
            KAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS DL  +D S++LIFSNWLLMYLS
Sbjct  61   KAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPDLKIADGSVELIFSNWLLMYLS  120

Query  543  DQEVESLXXRMVKWLK  590
            D+EVE +  RM+ W+K
Sbjct  121  DKEVELMAERMLGWVK  136



>emb|CDX95799.1| BnaC05g35500D [Brassica napus]
Length=481

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 112/139 (81%), Gaps = 17/139 (12%)
 Frame = +3

Query  225  MMLDSKAADLDKEERPE-----------------VLSMLPAYEGKSVLELGAGIGRFTGE  353
            MMLDS+AADLDKEERPE                 VLS+LP YEGKSVLELGAGIGRFTGE
Sbjct  1    MMLDSRAADLDKEERPEEMFSLSLSLLRFRESDGVLSLLPPYEGKSVLELGAGIGRFTGE  60

Query  354  LAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLM  533
            LAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DLN +D SIDLIFSNWLLM
Sbjct  61   LAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLNITDGSIDLIFSNWLLM  120

Query  534  YLSDQEVESLXXRMVKWLK  590
            YLSD+EVE L  RMV W+K
Sbjct  121  YLSDKEVELLVERMVGWIK  139



>gb|ABK24808.1| unknown [Picea sitchensis]
Length=472

 Score =   200 bits (508),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            ER +Q +YW EHS  L++EAMMLDS+A+ LD+EERPE++S+LP  EGKSV+ELGAGIGR+
Sbjct  6    ERALQLNYWKEHSVVLSLEAMMLDSQASKLDQEERPEIISLLPPLEGKSVIELGAGIGRY  65

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  524
            T ELAQKA  ++AMDFIES IKKNE  NGH  N++FMCADVTS DL     S DL+FSNW
Sbjct  66   TVELAQKADHILAMDFIESAIKKNEETNGHFKNVEFMCADVTSADLKIEPGSADLVFSNW  125

Query  525  LLMYLSDQEVESLXXRMVKWLK  590
            LLMYLSD+EV  L  +MV+W+K
Sbjct  126  LLMYLSDEEVVELAKKMVQWVK  147



>ref|XP_001768934.1| predicted protein [Physcomitrella patens]
 gb|EDQ66288.1| predicted protein [Physcomitrella patens]
Length=431

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            ER +Q +YW EHS   +VE MMLDS+A  LD EERPE+LS+LP Y+GK V+ELGAGIGRF
Sbjct  17   ERTLQSNYWKEHSVNPSVETMMLDSQAPKLDLEERPEILSLLPPYKGKDVIELGAGIGRF  76

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  524
            TG+LA+ AG V+AMDF+E++IKKNE ++GH+ NI F CADVTS  L+ S  S DL+FSNW
Sbjct  77   TGDLAKSAGHVLAMDFMENLIKKNEDVHGHMNNIDFKCADVTSPQLDISSASADLVFSNW  136

Query  525  LLMYLSDQEVESLXXRMVKWLK  590
            LLM LSD+EVE L  R+++WL+
Sbjct  137  LLMSLSDEEVEGLTSRIIEWLR  158



>ref|XP_002454522.1| hypothetical protein SORBIDRAFT_04g032625 [Sorghum bicolor]
 gb|EES07498.1| hypothetical protein SORBIDRAFT_04g032625 [Sorghum bicolor]
Length=136

 Score =   188 bits (477),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +3

Query  210  LTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMD  389
            LTVEAMMLDS+AADL++EERPEVLS+LP+YEGKSVLELGAGIG FTGELA+ AG V+A+D
Sbjct  19   LTVEAMMLDSRAADLNREERPEVLSLLPSYEGKSVLELGAGIGHFTGELAKIAGNVLALD  78

Query  390  FIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEV  554
            FIES IKKNE+INGH  N  FMCA VTS+DL     SIDLIFSNWLLMYLSD+EV
Sbjct  79   FIESAIKKNESINGHYNNASFMCAYVTSEDLVLPASSIDLIFSNWLLMYLSDEEV  133



>ref|XP_002969650.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
 gb|EFJ29738.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
Length=495

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            ER+ Q SYW EHS+ LTVE M+LDS+AA LD+EERPE+LSMLP  EG SV+ELGAGIGRF
Sbjct  9    ERDAQLSYWKEHSTALTVEEMLLDSQAAKLDQEERPEILSMLPPLEGISVVELGAGIGRF  68

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  524
            TG+LA+ A  V+AMDF++SVI KN+ +NG   N++F+CADVTS  L F   S DLIFSNW
Sbjct  69   TGDLAKSAKHVVAMDFVQSVIDKNKEVNGCHKNVEFLCADVTSPSLTFPRSSKDLIFSNW  128

Query  525  LLMYLSDQEVESLXXRMVKWLK  590
            LLMYLSD EV +L  +M+ WLK
Sbjct  129  LLMYLSDDEVTALTKKMIFWLK  150



>ref|XP_002970912.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
 gb|EFJ28238.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
Length=495

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            ER+ Q SYW EHS+ LTVE M+LDS+AA LD+EERPE+LSMLP  EG SV+ELGAGIGRF
Sbjct  9    ERDAQLSYWKEHSTALTVEEMLLDSQAAKLDQEERPEILSMLPPLEGISVVELGAGIGRF  68

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  524
            TG+LA+ A  V+AMDF++SVI KN+ +NG   N++F+CADVTS  L F   S DLIFSNW
Sbjct  69   TGDLAKSAKHVVAMDFVQSVIDKNKEVNGCHRNVEFLCADVTSPSLTFPRSSKDLIFSNW  128

Query  525  LLMYLSDQEVESLXXRMVKWLK  590
            LLMYLSD EV +L  +M+ WLK
Sbjct  129  LLMYLSDDEVTALTKKMIFWLK  150



>emb|CBI26879.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   192 bits (488),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  192  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  371
            +EHS+ELTVEAMMLDS+A+DLDKEERPE+LS+LP  EGK V+ELGAGIGRFTGELA++AG
Sbjct  1    MEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIGRFTGELAKQAG  60

Query  372  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  551
            QV+A+DFIESVI++NE ING   N KF+CADVTS DL+ S  S+DLIFSNWLLMYLSD+E
Sbjct  61   QVLAIDFIESVIRENEVINGRFKNTKFVCADVTSPDLDISPGSVDLIFSNWLLMYLSDKE  120

Query  552  VESLXXRMVKWLK  590
            VE L  RMVKWLK
Sbjct  121  VEDLAERMVKWLK  133



>gb|KHN10536.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=466

 Score =   192 bits (487),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 109/124 (88%), Gaps = 2/124 (2%)
 Frame = +3

Query  225  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  404
            MMLDSKAA LDKEERPEVLS+LP +EGKSV+ELGAGIGRFTGELA KAGQ++A+DFI++ 
Sbjct  1    MMLDSKAAHLDKEERPEVLSLLPPFEGKSVIELGAGIGRFTGELALKAGQLLAVDFIDTA  60

Query  405  IKKNETINGHLGNIKFMCADVTSKDL--NFSDESIDLIFSNWLLMYLSDQEVESLXXRMV  578
            IKKNETINGH  ++KF+CADVTS ++  N S+ S+D++FSNWLLMYLSD EVE L  RMV
Sbjct  61   IKKNETINGHHNHVKFLCADVTSPNMSNNVSEGSVDVVFSNWLLMYLSDIEVEKLAERMV  120

Query  579  KWLK  590
            +WLK
Sbjct  121  RWLK  124



>gb|AGO59019.1| heat responsive transcription factor protein, partial [Triticum 
aestivum]
Length=460

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 107/123 (87%), Gaps = 1/123 (1%)
 Frame = +3

Query  225  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  404
            MMLDS+A DLDKEERPEVL++LP+Y GK+VLELGAGIGRFTGELA++AG VIA+DFI+SV
Sbjct  1    MMLDSRAKDLDKEERPEVLAILPSYAGKTVLELGAGIGRFTGELAKEAGHVIALDFIDSV  60

Query  405  IKKNETINGHL-GNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLXXRMVK  581
            IKKNE ING +  NI FMCADVTS +L   D SID++FSNWLLMYL+D+EVE L  R+VK
Sbjct  61   IKKNEEINGDIYKNITFMCADVTSPELKIEDNSIDIVFSNWLLMYLNDEEVEKLIGRIVK  120

Query  582  WLK  590
            WLK
Sbjct  121  WLK  123



>ref|XP_010540184.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like, partial 
[Tarenaya hassleriana]
Length=457

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  264  ERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGN  443
            ERPE+LS+LP +EGKSVLE GAGIGRFTGE AQ+A QVIA+DFIESVIKKNE INGH  N
Sbjct  6    ERPEILSVLPPFEGKSVLEFGAGIGRFTGEFAQRASQVIAVDFIESVIKKNEDINGHHKN  65

Query  444  IKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            +KFMCADVTS DL FSDES+DLIFSNWLLMYLSD+EVE L  RM++WLK
Sbjct  66   VKFMCADVTSPDLKFSDESVDLIFSNWLLMYLSDKEVEGLARRMLQWLK  114



>ref|XP_006303561.1| hypothetical protein CARUB_v10011038mg [Capsella rubella]
 gb|EOA36459.1| hypothetical protein CARUB_v10011038mg [Capsella rubella]
Length=475

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 113/134 (84%), Gaps = 5/134 (4%)
 Frame = +3

Query  192  IEHSSELTVEAMMLDSKAADLDKEERP-EVLSMLPAYEGKSVLELGAGIGRFTGELAQKA  368
            +EHSS++ V++    ++A+DLDKEE P E+L ++P YEGK+VLELGAGIGRFTGELAQKA
Sbjct  1    MEHSSDVMVDS----TEASDLDKEELPHELLCLIPPYEGKTVLELGAGIGRFTGELAQKA  56

Query  369  GQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQ  548
            G+VIA+DFIES I KNE++NGH  N+KFMCADVTS DL  +D SIDLIFSNWLLMYLSD+
Sbjct  57   GEVIALDFIESAIHKNESVNGHYKNVKFMCADVTSPDLKIADGSIDLIFSNWLLMYLSDK  116

Query  549  EVESLXXRMVKWLK  590
            EVE +  RM+ W+K
Sbjct  117  EVELIAERMLGWVK  130



>gb|KDD75565.1| hypothetical protein H632_c615p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=278

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 103/142 (73%), Gaps = 2/142 (1%)
 Frame = +3

Query  165  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  344
            ER VQK YWIEHS+  TVE MMLDSKAAD+DK ERPEVL +L + EGK V+ELGAGIGRF
Sbjct  10   ERAVQKQYWIEHSANATVETMMLDSKAADIDKMERPEVLELLGSVEGKDVVELGAGIGRF  69

Query  345  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  524
            T  LA  A  V+A+DF+E++I++N   N H GNI F C D T  +L     S DL+FSNW
Sbjct  70   TAPLASTAKSVVALDFMENLIEENRRTNSHYGNIDFRCGDAT--ELELPASSQDLVFSNW  127

Query  525  LLMYLSDQEVESLXXRMVKWLK  590
            LLMYL+D EV  L  RM+ WL+
Sbjct  128  LLMYLNDDEVRRLAQRMLGWLR  149



>gb|KIZ00652.1| hypothetical protein MNEG_7307 [Monoraphidium neglectum]
Length=252

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 106/150 (71%), Gaps = 2/150 (1%)
 Frame = +3

Query  138  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  317
            +A A    +EREVQ +YW+EHS E TVEAMMLDSKA+++D+ ERPEVLS L + +GK VL
Sbjct  2    AAAAEVGVQEREVQLNYWLEHSKEPTVEAMMLDSKASEIDQMERPEVLSTLGSIKGKRVL  61

Query  318  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  497
            ELGAGIGRFTGE+A+ A  V+A DF+E  I +N   NGHL N+ F  ADVT   L     
Sbjct  62   ELGAGIGRFTGEIAKTASSVLACDFMEVSIDENRRRNGHLPNVDFRVADVTQ--LRCEPR  119

Query  498  SIDLIFSNWLLMYLSDQEVESLXXRMVKWL  587
              D++FSNWLLMYLSD+EV  L    + WL
Sbjct  120  QFDVVFSNWLLMYLSDEEVSQLVKNALTWL  149



>gb|EAY75471.1| hypothetical protein OsI_03371 [Oryza sativa Indica Group]
Length=456

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +3

Query  243  AADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNET  422
             ADLD      +LS+LP YEGKSVLELGAGIGRFTGEL + AG V+AMDFIESVIKKNE+
Sbjct  8    TADLDIVASHRILSLLPPYEGKSVLELGAGIGRFTGELVKTAGHVLAMDFIESVIKKNES  67

Query  423  INGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            INGH  N  FMCADVT  DL   D SIDLIFSNWLLMYLSD+EVE L  RMV+WLK
Sbjct  68   INGHHKNASFMCADVTCPDLMIEDNSIDLIFSNWLLMYLSDEEVEKLVKRMVRWLK  123



>ref|XP_004166030.1| PREDICTED: LOW QUALITY PROTEIN: phosphoethanolamine N-methyltransferase 
1-like [Cucumis sativus]
Length=468

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +3

Query  216  VEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFI  395
            +E+MM+DS + +LD EE  EV+S+LP YEGK+V+ELGAGIGRFT ELAQ+A QVIA+DF+
Sbjct  1    MESMMVDSDSHELDSEETAEVISLLPPYEGKTVVELGAGIGRFTSELAQRAAQVIAVDFV  60

Query  396  ESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLXXRM  575
            E VI+KNE+INGH  N+KF CADVT  +L+  ++S+D IFSN LLMYLSD+EV+ L  RM
Sbjct  61   EDVIRKNESINGHHKNVKFQCADVTFSELDIHEDSVDFIFSNLLLMYLSDEEVKLLAERM  120

Query  576  VKWLK  590
            +KWLK
Sbjct  121  IKWLK  125



>ref|XP_004137342.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
sativus]
 gb|KGN63873.1| hypothetical protein Csa_1G025050 [Cucumis sativus]
Length=468

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +3

Query  216  VEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFI  395
            +E+MM+DS + +LD EE  EV+S+LP YEGK+V+ELGAGIGRFT ELAQ+A QVIA+DF+
Sbjct  1    MESMMVDSDSHELDSEETAEVISLLPPYEGKTVVELGAGIGRFTSELAQRAAQVIAVDFV  60

Query  396  ESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLXXRM  575
            E VI+KNE+INGH  N+KF CADVT  +L+  ++S+D IFSN LLMYLSD+EV+ L  RM
Sbjct  61   EDVIRKNESINGHHKNVKFQCADVTFSELDIHEDSVDFIFSNLLLMYLSDEEVKLLAERM  120

Query  576  VKWLK  590
            +KWLK
Sbjct  121  IKWLK  125



>ref|XP_011399976.1| Phosphoethanolamine N-methyltransferase [Auxenochlorella protothecoides]
 gb|KFM27020.1| Phosphoethanolamine N-methyltransferase [Auxenochlorella protothecoides]
Length=503

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 105/143 (73%), Gaps = 2/143 (1%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +ERE QKSYW EHSS  TVE+MMLDS+AAD+DK ERPEVL +L + +G  V+ELGAGIGR
Sbjct  5    QEREAQKSYWAEHSSNATVESMMLDSQAADIDKLERPEVLKLLGSVDGLDVVELGAGIGR  64

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FT  LA++A  V+A+DF+ ++I++N   NGHLGNI F C D T  DL       DL+FSN
Sbjct  65   FTRPLAEEARSVVALDFMPNLIEQNRVDNGHLGNIDFRCGDATELDLPAG--CADLVFSN  122

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYL+D EV  L   M+ W+K
Sbjct  123  WLLMYLADDEVAKLAHNMLTWVK  145



>ref|XP_010231068.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Brachypodium distachyon]
Length=472

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = +3

Query  243  AADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNET  422
            AA+LD E    VLS+LP+YEGK+VLELGAGIGRFTGELA++AG V+A+DFI+SVIKKNE 
Sbjct  15   AAELDPESDQWVLSILPSYEGKTVLELGAGIGRFTGELAKEAGHVLALDFIDSVIKKNEE  74

Query  423  INGHL-GNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            INGH+  NI FMCADVTS +L   D SIDL+FSNWLLMYLSD+EVE L  R+VKWLK
Sbjct  75   INGHIHNNITFMCADVTSPELKIEDNSIDLVFSNWLLMYLSDEEVEKLIGRIVKWLK  131



>ref|XP_002730517.1| PREDICTED: phosphoethanolamine N-methyltransferase-like, partial 
[Saccoglossus kowalevskii]
Length=160

 Score =   164 bits (416),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 105/144 (73%), Gaps = 2/144 (1%)
 Frame = +3

Query  159  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  338
             E R+V  SYW++HS + ++E MMLD++A  L + E PE+LS+LP YEGK ++ELGAGIG
Sbjct  4    NEVRQVMSSYWMDHSKDASLEEMMLDTQAESLAQSEHPEILSLLPPYEGKRIIELGAGIG  63

Query  339  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  518
            RFTG LA+KA  V A+DF+ES IKKN+  N H  N+ F  ADVT   L   ++S DL+FS
Sbjct  64   RFTGVLAKKASHVTAVDFMESFIKKNKDANSHHKNVDFKQADVTV--LKCPEKSFDLVFS  121

Query  519  NWLLMYLSDQEVESLXXRMVKWLK  590
            NWL+MYL+++EV +L   M+ WLK
Sbjct  122  NWLMMYLTNEEVLALARNMLSWLK  145



>ref|XP_002594091.1| hypothetical protein BRAFLDRAFT_68467 [Branchiostoma floridae]
 gb|EEN50102.1| hypothetical protein BRAFLDRAFT_68467 [Branchiostoma floridae]
Length=242

 Score =   166 bits (419),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 104/141 (74%), Gaps = 2/141 (1%)
 Frame = +3

Query  168  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  347
            R+    +W EHSS+ ++E MMLD  A +L K+E PE+LS+LP  EGK++LELGAGIGR+T
Sbjct  10   RDKMSQFWREHSSQASIEEMMLDDAAKELSKDELPEILSLLPGIEGKTILELGAGIGRYT  69

Query  348  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  527
              LAQ+A  V A+DF+E  I+KNE +NGH  N++FM ADVT   L    +S D++FSNWL
Sbjct  70   APLAQQAKHVTAVDFMEPFIRKNEEVNGHHKNVRFMQADVTK--LEMPPKSFDIVFSNWL  127

Query  528  LMYLSDQEVESLXXRMVKWLK  590
            +MYLSD EV++L  +++ WLK
Sbjct  128  MMYLSDAEVQALAEKVLTWLK  148



>gb|EPS69227.1| hypothetical protein M569_05544 [Genlisea aurea]
Length=333

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +3

Query  210  LTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMD  389
            L++E MM D+KA+DLD+EERPEVLS++P Y+GKS+LELGAG+GRFT E A+ A Q++A++
Sbjct  69   LSIEDMMADTKASDLDREERPEVLSLVPPYDGKSILELGAGVGRFTAEFAKTAAQIVAVE  128

Query  390  FIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEV  554
             IES  +KNE  NGH  N KF+CADV S DL+F D S DLIFSNWLL+YLS+ EV
Sbjct  129  LIESAAEKNEITNGHHKNAKFICADVRSPDLSFPDGSFDLIFSNWLLLYLSENEV  183



>ref|XP_002594077.1| hypothetical protein BRAFLDRAFT_68483 [Branchiostoma floridae]
 gb|EEN50088.1| hypothetical protein BRAFLDRAFT_68483 [Branchiostoma floridae]
Length=274

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 102/134 (76%), Gaps = 2/134 (1%)
 Frame = +3

Query  186  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  365
            +W E S + +++ MMLD  A +LD+EERPE+L+MLP  +GK VLELGAGIGRFT  LA++
Sbjct  56   FWREQSHDGSLQEMMLDENADELDQEERPEILAMLPDLKGKRVLELGAGIGRFTPSLARQ  115

Query  366  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  545
            A  V A+DF+ES IKKNE  N HLGNI F+ ADVT  DL    ES+D++FSNWL+MYL+D
Sbjct  116  ADHVTAVDFMESFIKKNEEANRHLGNINFLQADVTRLDL--PQESVDVVFSNWLMMYLAD  173

Query  546  QEVESLXXRMVKWL  587
            +EV +L  +++ WL
Sbjct  174  EEVSALAAKVLSWL  187



>ref|XP_002594089.1| hypothetical protein BRAFLDRAFT_118790 [Branchiostoma floridae]
 gb|EEN50100.1| hypothetical protein BRAFLDRAFT_118790 [Branchiostoma floridae]
Length=577

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 112/155 (72%), Gaps = 8/155 (5%)
 Frame = +3

Query  144  MAAFQGEEREVQKS------YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  305
            M++ QGE  E + +      +W EHSS+ ++E MMLD  A +L K+E PE+LS+LP  EG
Sbjct  1    MSSDQGESAEYEATRDKMSQFWREHSSKASLEEMMLDDNAKELSKDELPEILSLLPGIEG  60

Query  306  KSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLN  485
            K++LELGAGIGR+T  LAQ+A  V A+DF+ES I+KNE +NGH  N++FM ADVT   L 
Sbjct  61   KTILELGAGIGRYTAPLAQQAKHVTAVDFMESFIRKNEEVNGHHKNVRFMQADVTK--LE  118

Query  486  FSDESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
               +S D++FSNWL+MYLSD EV++L  +++ WLK
Sbjct  119  MPPKSFDIVFSNWLMMYLSDAEVQALAEKVLTWLK  153



>ref|XP_009011308.1| hypothetical protein HELRODRAFT_71964 [Helobdella robusta]
 gb|ESO11039.1| hypothetical protein HELRODRAFT_71964 [Helobdella robusta]
Length=215

 Score =   159 bits (402),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = +3

Query  180  KSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELA  359
            +++W EHS++   E MMLDS A  L +EE PE+LS+LP  EGKSVLELGAGIGRF+G +A
Sbjct  2    QNFWKEHSTKANEEEMMLDSDADTLGREEVPEILSLLPGLEGKSVLELGAGIGRFSGRIA  61

Query  360  QKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYL  539
             KA  V+A+DF+E+ IK NE+ NGH GNI+F+ ADV    L F + S DL+FSNWLLMYL
Sbjct  62   AKAKSVVAVDFMENFIKCNESTNGHHGNIQFVQADVML--LKFPENSFDLVFSNWLLMYL  119

Query  540  SDQEVESLXXRMVKWLK  590
             + EV +L  ++  WLK
Sbjct  120  EEDEVCTLFEKIFNWLK  136



>ref|XP_008324913.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Cynoglossus semilaevis]
Length=491

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 99/141 (70%), Gaps = 2/141 (1%)
 Frame = +3

Query  168  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  347
            R    ++W EHS+E TVE MMLD++A DL ++E PE+LS+LP   G  VLELGAGIGR+T
Sbjct  5    RNNMAAFWKEHSTEATVEEMMLDTQARDLTQQEMPEILSLLPRLTGYKVLELGAGIGRYT  64

Query  348  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  527
             +L  KA  V A+DF+ES I+KN  +NGH  N+ F+ ADVT   L     S+D IFSNWL
Sbjct  65   SQLLTKAAHVTAVDFMESFIEKNREVNGHHKNVTFLHADVTK--LEIPKTSLDFIFSNWL  122

Query  528  LMYLSDQEVESLXXRMVKWLK  590
            LMYLSD E++ L  +M+ WL+
Sbjct  123  LMYLSDDEIQPLMKKMLSWLR  143



>ref|XP_008324912.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Cynoglossus semilaevis]
Length=495

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 99/141 (70%), Gaps = 2/141 (1%)
 Frame = +3

Query  168  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  347
            R    ++W EHS+E TVE MMLD++A DL ++E PE+LS+LP   G  VLELGAGIGR+T
Sbjct  5    RNNMAAFWKEHSTEATVEEMMLDTQARDLTQQEMPEILSLLPRLTGYKVLELGAGIGRYT  64

Query  348  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  527
             +L  KA  V A+DF+ES I+KN  +NGH  N+ F+ ADVT   L     S+D IFSNWL
Sbjct  65   SQLLTKAAHVTAVDFMESFIEKNREVNGHHKNVTFLHADVTK--LEIPKTSLDFIFSNWL  122

Query  528  LMYLSDQEVESLXXRMVKWLK  590
            LMYLSD E++ L  +M+ WL+
Sbjct  123  LMYLSDDEIQPLMKKMLSWLR  143



>ref|XP_008324914.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324916.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324917.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
Length=488

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 98/136 (72%), Gaps = 2/136 (1%)
 Frame = +3

Query  183  SYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQ  362
            ++W EHS+E TVE MMLD++A DL ++E PE+LS+LP   G  VLELGAGIGR+T +L  
Sbjct  3    AFWKEHSTEATVEEMMLDTQARDLTQQEMPEILSLLPRLTGYKVLELGAGIGRYTSQLLT  62

Query  363  KAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLS  542
            KA  V A+DF+ES I+KN  +NGH  N+ F+ ADVT   L     S+D IFSNWLLMYLS
Sbjct  63   KAAHVTAVDFMESFIEKNREVNGHHKNVTFLHADVTK--LEIPKTSLDFIFSNWLLMYLS  120

Query  543  DQEVESLXXRMVKWLK  590
            D E++ L  +M+ WL+
Sbjct  121  DDEIQPLMKKMLSWLR  136



>ref|XP_008453688.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cucumis 
melo]
Length=184

 Score =   152 bits (383),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +3

Query  273  EVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKF  452
            +V+S+LP YEGK+V+ELGAG+GRFT ELAQ+A QVIA+DF+E VI+KNE+INGH  N+KF
Sbjct  12   KVISLLPPYEGKTVVELGAGVGRFTAELAQRAAQVIAVDFVEDVIRKNESINGHHKNVKF  71

Query  453  MCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            + ADVTS +L+  ++S+D IFSN LLMYLSD+EV+ L   M+KWLK
Sbjct  72   LWADVTSPELDIHEDSVDFIFSNLLLMYLSDEEVKLLAEMMIKWLK  117



>ref|XP_008418601.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Poecilia reticulata]
Length=491

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = +3

Query  186  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  365
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG+ VLELGAGIGRFT  L  K
Sbjct  10   FWKEHSKAATVEEMMLDSRAKELTEHELPEILSMLPSLEGRRVLELGAGIGRFTSHLLTK  69

Query  366  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  545
            A  V A+DF++S + KN   NGH  N+ F+ ADVT  D+     SID IFSNWLLMYLSD
Sbjct  70   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTKLDI--PQHSIDFIFSNWLLMYLSD  127

Query  546  QEVESLXXRMVKWLK  590
            +E++S   +M+ WL+
Sbjct  128  EELKSFMKKMLNWLQ  142



>ref|XP_008418600.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Poecilia reticulata]
Length=492

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = +3

Query  186  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  365
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG+ VLELGAGIGRFT  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTEHELPEILSMLPSLEGRRVLELGAGIGRFTSHLLTK  70

Query  366  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  545
            A  V A+DF++S + KN   NGH  N+ F+ ADVT  D+     SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTKLDI--PQHSIDFIFSNWLLMYLSD  128

Query  546  QEVESLXXRMVKWLK  590
            +E++S   +M+ WL+
Sbjct  129  EELKSFMKKMLNWLQ  143



>gb|EMT23240.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=497

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +3

Query  276  VLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHL-GNIKF  452
            VL++LP+Y GK+VLELGAGIGRFTGELA++AG VIA+DFI+SVIKKNE ING +  NI F
Sbjct  51   VLAILPSYAGKTVLELGAGIGRFTGELAKEAGHVIALDFIDSVIKKNEEINGDIYKNITF  110

Query  453  MCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLXXRMVKWLK  590
            MCADVTS +L   D S+D++FSNWLLMYL+D+EVE L  R+VKWLK
Sbjct  111  MCADVTSPELKIEDNSVDIVFSNWLLMYLNDEEVEKLIGRIVKWLK  156



>ref|XP_007550439.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Poecilia 
formosa]
Length=492

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = +3

Query  186  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  365
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG+ VLELGAGIGRFT  L  K
Sbjct  11   FWKEHSKGATVEEMMLDSRAKELTEHELPEILSMLPSLEGRRVLELGAGIGRFTSHLLTK  70

Query  366  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  545
            A  V A+DF++S + KN   NGH  N+ F+ ADVT  D+     SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTKLDI--PQHSIDFIFSNWLLMYLSD  128

Query  546  QEVESLXXRMVKWLK  590
            +E++S   +M+ WL+
Sbjct  129  EELKSFMKKMLNWLQ  143



>ref|XP_005096334.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Aplysia californica]
Length=494

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            E R+V  +YW EHS + +VE MMLD+ A +L KEE PE+LS LP Y GK V+ELGAGIGR
Sbjct  4    EVRQVMAAYWKEHSKQGSVEEMMLDNTAEELSKEELPEILSYLPEYAGKDVIELGAGIGR  63

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FT E+A+KA  V A+DF+E  I KN+  N +  NI+++ ADVT   L+   ES DLIFSN
Sbjct  64   FTTEIAKKAKSVAAVDFMEEFINKNKKTNQNFNNIEYVVADVTK--LDRPKESADLIFSN  121

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WLLMYL+D EV+    + + WL+
Sbjct  122  WLLMYLNDNEVQEFFRKQLSWLR  144



>ref|XP_005643867.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE19323.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=498

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            EER  QKSYW +HS+  +VEAMMLDS+A+ +DKEERPEVL+ML   EG  ++ELGAGIGR
Sbjct  16   EERAAQKSYWADHSATASVEAMMLDSQASVIDKEERPEVLTMLGCVEGARIVELGAGIGR  75

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FTGELA  A  V+A+DF+E++I +N   N H  N+++   D T  +L     S D++FSN
Sbjct  76   FTGELAVAARSVLAVDFMENLIAENRRANSHRRNVRWQVGDAT--ELELPAGSADVVFSN  133

Query  522  WLLMYLSDQEVESLXXRMVKWL  587
            WLLMYLSD+EV  L    + W+
Sbjct  134  WLLMYLSDKEVAKLAGDALTWV  155



>gb|ETM43048.1| hypothetical protein L914_11412, partial [Phytophthora parasitica]
Length=244

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 94/141 (67%), Gaps = 2/141 (1%)
 Frame = +3

Query  168  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  347
            R++ K+YW  HSS  TVE MMLDS A  L + E PE+L   P+ E K VLEL AGIGR+T
Sbjct  5    RDLMKAYWEGHSSSATVETMMLDSHAKTLTELEVPEILDKAPSMEHKDVLELAAGIGRYT  64

Query  348  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  527
              +A KA  V A++FIE  IK NE  NGHLGNIKF+C DV    L     S D+IFSNW+
Sbjct  65   SVIATKAKSVTAVEFIEDFIKVNEDKNGHLGNIKFLCKDVVH--LEAEPNSFDVIFSNWI  122

Query  528  LMYLSDQEVESLXXRMVKWLK  590
            LMY+ D+EV+    + VKWL+
Sbjct  123  LMYMEDEEVKEFAKKAVKWLR  143



>ref|XP_010864863.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Esox 
lucius]
Length=495

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 99/143 (69%), Gaps = 2/143 (1%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +ER     +W EHS + TVE MMLDS A +L + E PE+LS+LP+   + +LELGAGIGR
Sbjct  4    KERSSMTEFWKEHSRQATVEEMMLDSHAKELTQHELPEILSLLPSLHDQRILELGAGIGR  63

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            FT  L  +A  V A+DF+ES +KKN+  NGH  N  F+ ADVT   L+F   S D+IFSN
Sbjct  64   FTSHLLAQASHVTAVDFMESFVKKNQQENGHHSNAAFIQADVTK--LDFPKNSYDIIFSN  121

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WL+MYLSD+E+ SL  RM+ WL+
Sbjct  122  WLMMYLSDEELRSLTERMLGWLR  144



>ref|XP_005806845.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Xiphophorus 
maculatus]
Length=492

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 94/135 (70%), Gaps = 2/135 (1%)
 Frame = +3

Query  186  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  365
            +W EHS   TVE MMLDS+A  L + E PE+LSMLP  EG+ VLELGAGIGRFT  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSQAKKLTEHELPEILSMLPPLEGRRVLELGAGIGRFTSHLLTK  70

Query  366  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  545
            A  V A+DF++S + KN   NGH  N+ F+ ADVT  D+     SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTKLDI--PQHSIDFIFSNWLLMYLSD  128

Query  546  QEVESLXXRMVKWLK  590
            +E++S   +M+ WL+
Sbjct  129  EELKSFMKKMLNWLQ  143



>ref|NP_001096276.2| phosphoethanolamine methyltransferase [Xenopus (Silurana) tropicalis]
Length=494

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 102/143 (71%), Gaps = 2/143 (1%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            + R+V   +W EHS + TVE MMLDS A  L  EE+PE++ +LP  +G SVLELGAGIGR
Sbjct  4    DTRQVMTQFWEEHSRDATVEEMMLDSSAKLLSLEEKPEIILLLPCLDGHSVLELGAGIGR  63

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            +TG LA+ A  V A+DF+++ I+KN+  NG  GNI F+ ADVT+ DL   +ES D IFSN
Sbjct  64   YTGHLAKLASHVTAVDFMQNFIEKNQKDNGFRGNITFLQADVTNLDL--PNESFDFIFSN  121

Query  522  WLLMYLSDQEVESLXXRMVKWLK  590
            WL MYL+D E+ +L  +M+ WLK
Sbjct  122  WLFMYLTDAELLALIQKMLGWLK  144



>ref|XP_006003521.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like, partial 
[Latimeria chalumnae]
Length=264

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = +3

Query  180  KSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELA  359
            K +W EHS E +VE MMLDS A  + +E+R E+++MLP  EGK VLELGAGIGRF+G+LA
Sbjct  2    KQFWEEHSKEASVEEMMLDSNAQAIAEEDRSEIIAMLPCVEGKDVLELGAGIGRFSGQLA  61

Query  360  QKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYL  539
            +KA +V A+DF+++ ++KN  +N   GN+ F+ ADVT+ DL     S DLIFSNWL MYL
Sbjct  62   KKARRVTAVDFMKTFMEKNREVNKVYGNVTFLQADVTNLDL--PPNSFDLIFSNWLFMYL  119

Query  540  SDQEVESLXXRMVKWLK  590
            +D+E+     ++++WL+
Sbjct  120  TDKELVHFTNKLLQWLR  136



>ref|XP_005723169.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Pundamilia nyererei]
Length=485

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +3

Query  186  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  365
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  4    FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  63

Query  366  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  545
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  64   AAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  121

Query  546  QEVESLXXRMVKWLK  590
            +E+ S+  +M+ WLK
Sbjct  122  EELNSVMQKMLTWLK  136



>ref|XP_005723168.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Pundamilia nyererei]
Length=491

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +3

Query  186  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  365
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  10   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  69

Query  366  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  545
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  70   AAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  127

Query  546  QEVESLXXRMVKWLK  590
            +E+ S+  +M+ WLK
Sbjct  128  EELNSVMQKMLTWLK  142



>ref|XP_005723167.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Pundamilia nyererei]
Length=492

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +3

Query  186  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  365
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  70

Query  366  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  545
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  128

Query  546  QEVESLXXRMVKWLK  590
            +E+ S+  +M+ WLK
Sbjct  129  EELNSVMQKMLTWLK  143



>gb|ETK83171.1| hypothetical protein L915_11577 [Phytophthora parasitica]
Length=185

 Score =   149 bits (375),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 93/141 (66%), Gaps = 2/141 (1%)
 Frame = +3

Query  168  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  347
            R++ K+YW  HSS  TVE MMLDS A  L + E PE+L   P+ E K VLEL AGIGR+T
Sbjct  5    RDLMKAYWEGHSSSATVETMMLDSHAKTLTELEVPEILDKAPSMEHKDVLELAAGIGRYT  64

Query  348  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  527
              +A  A  V A++FIE  IK NE  NGHLGNIKF+C DV    L     S D+IFSNW+
Sbjct  65   SVIATMAKSVTAVEFIEDFIKVNEDKNGHLGNIKFLCKDVVH--LEAEPNSFDVIFSNWI  122

Query  528  LMYLSDQEVESLXXRMVKWLK  590
            LMY+ D+EV+    + VKWL+
Sbjct  123  LMYMEDEEVKEFAKKAVKWLR  143



>gb|AHY01341.1| phosphoethanolamine methyltransferase, partial [Carassius gibelio]
Length=172

 Score =   148 bits (373),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = +3

Query  186  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  365
            +W EHS   TVE MMLD+ A +L + E PE+LS+LP+     VLELGAGIGRFT  L  K
Sbjct  4    FWKEHSKFATVEEMMLDTNAQELTQHELPEILSLLPSLAASDVLELGAGIGRFTRHLIGK  63

Query  366  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  545
            A  V A+DF+E  ++KN+  N HLG+++F+ ADVT   L+F     D++FSNWLLMYLSD
Sbjct  64   ARHVTAVDFMEKFVEKNKKDNSHLGSVEFIQADVTK--LDFPKHGFDVVFSNWLLMYLSD  121

Query  546  QEVESLXXRMVKWLK  590
            QE++SL  +++ WL+
Sbjct  122  QELKSLAEKLLLWLR  136



>ref|XP_006781399.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Neolamprologus 
brichardi]
Length=492

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 94/135 (70%), Gaps = 2/135 (1%)
 Frame = +3

Query  186  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  365
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP  EG  VLELGAGIGR+T  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPRLEGCKVLELGAGIGRYTKHLLTK  70

Query  366  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  545
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  128

Query  546  QEVESLXXRMVKWLK  590
            +E+ S+  +M+ WLK
Sbjct  129  EELNSVMQKMLTWLK  143



>ref|NP_001167350.1| phosphoethanolamine N-methyltransferase 3 [Salmo salar]
 gb|ACN11445.1| phosphoethanolamine N-methyltransferase 3 [Salmo salar]
Length=495

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 96/142 (68%), Gaps = 2/142 (1%)
 Frame = +3

Query  162  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  341
            +ER     +W EHS + TVE MMLDS A +L + E PE+LS+LP+  G+ VLELGAGIGR
Sbjct  4    KERSTMTEFWKEHSRQATVEEMMLDSHAQELTQHELPEILSLLPSLSGQRVLELGAGIGR  63

Query  342  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  521
            +T  L   A  V A+DF+ES ++KN   N H  N  F+ ADVT   L+F   S D+IFSN
Sbjct  64   YTSHLLTLASHVTAVDFMESFVEKNRQDNSHYSNASFLQADVTK--LDFPKNSFDIIFSN  121

Query  522  WLLMYLSDQEVESLXXRMVKWL  587
            WLLMYLSD+E+ SL  RM+ WL
Sbjct  122  WLLMYLSDEELTSLTERMLGWL  143



>ref|XP_005913451.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Haplochromis burtoni]
Length=485

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 94/135 (70%), Gaps = 2/135 (1%)
 Frame = +3

Query  186  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  365
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  4    FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  63

Query  366  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  545
            A  V A+DF+E  I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  64   AAHVTAVDFMERFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  121

Query  546  QEVESLXXRMVKWLK  590
            +E+ S+  +M+ WLK
Sbjct  122  EELNSVMQKMLTWLK  136



>ref|XP_005467629.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X4 [Oreochromis niloticus]
Length=485

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +3

Query  186  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  365
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  4    FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  63

Query  366  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  545
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT   L+    SID +FSNWLLMYLSD
Sbjct  64   AAHVTAVDFMESFIEKNRQENGHHSNGTFLQADVTK--LDVPQNSIDFMFSNWLLMYLSD  121

Query  546  QEVESLXXRMVKWLK  590
            +E+ S+  +M+ WLK
Sbjct  122  EELNSVMQKMLTWLK  136



>ref|XP_004545581.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Maylandia zebra]
Length=492

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 94/135 (70%), Gaps = 2/135 (1%)
 Frame = +3

Query  186  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  365
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  70

Query  366  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  545
            A  V A+DF+E  I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMERFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  128

Query  546  QEVESLXXRMVKWLK  590
            +E+ S+  +M+ WLK
Sbjct  129  EELNSVMQKMLTWLK  143



>ref|XP_004545582.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Maylandia zebra]
Length=491

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 94/135 (70%), Gaps = 2/135 (1%)
 Frame = +3

Query  186  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  365
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  10   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  69

Query  366  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  545
            A  V A+DF+E  I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  70   AAHVTAVDFMERFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  127

Query  546  QEVESLXXRMVKWLK  590
            +E+ S+  +M+ WLK
Sbjct  128  EELNSVMQKMLTWLK  142



>ref|XP_005467627.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Oreochromis niloticus]
 ref|XP_005467628.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Oreochromis niloticus]
Length=492

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +3

Query  186  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  365
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  70

Query  366  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  545
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT   L+    SID +FSNWLLMYLSD
Sbjct  71   AAHVTAVDFMESFIEKNRQENGHHSNGTFLQADVTK--LDVPQNSIDFMFSNWLLMYLSD  128

Query  546  QEVESLXXRMVKWLK  590
            +E+ S+  +M+ WLK
Sbjct  129  EELNSVMQKMLTWLK  143



>ref|XP_003444639.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Oreochromis niloticus]
Length=493

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +3

Query  186  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  365
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  12   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  71

Query  366  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  545
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT   L+    SID +FSNWLLMYLSD
Sbjct  72   AAHVTAVDFMESFIEKNRQENGHHSNGTFLQADVTK--LDVPQNSIDFMFSNWLLMYLSD  129

Query  546  QEVESLXXRMVKWLK  590
            +E+ S+  +M+ WLK
Sbjct  130  EELNSVMQKMLTWLK  144



>ref|XP_005913450.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Haplochromis burtoni]
Length=492

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 94/135 (70%), Gaps = 2/135 (1%)
 Frame = +3

Query  186  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  365
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  70

Query  366  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  545
            A  V A+DF+E  I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMERFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  128

Query  546  QEVESLXXRMVKWLK  590
            +E+ S+  +M+ WLK
Sbjct  129  EELNSVMQKMLTWLK  143



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160