BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS040E03

Length=497
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57289.1|  ATP-dependent Lon protease                             329   5e-104   Ipomoea nil [qian niu]
emb|CDP13424.1|  unnamed protein product                                290   2e-89    Coffea canephora [robusta coffee]
ref|XP_002282657.1|  PREDICTED: lon protease homolog 2, peroxisomal     287   4e-88    Vitis vinifera
ref|XP_010110520.1|  Lon protease-2-like protein                        282   2e-86    
ref|XP_009615530.1|  PREDICTED: lon protease homolog 2, peroxisom...    282   3e-86    Nicotiana tomentosiformis
ref|XP_009371862.1|  PREDICTED: lon protease homolog 2, peroxisomal     280   1e-85    
ref|XP_008373622.1|  PREDICTED: lon protease homolog 2, peroxisomal     280   1e-85    Malus domestica [apple tree]
ref|XP_007210904.1|  hypothetical protein PRUPE_ppa001173mg             277   2e-84    Prunus persica
ref|XP_008348469.1|  PREDICTED: lon protease homolog 2, peroxisom...    277   2e-84    Malus domestica [apple tree]
emb|CAN75012.1|  hypothetical protein VITISV_034238                     276   4e-84    Vitis vinifera
ref|XP_009615537.1|  PREDICTED: lon protease homolog 2, peroxisom...    276   4e-84    Nicotiana tomentosiformis
ref|XP_009341221.1|  PREDICTED: lon protease homolog 2, peroxisom...    276   5e-84    Pyrus x bretschneideri [bai li]
ref|XP_009341220.1|  PREDICTED: lon protease homolog 2, peroxisom...    276   5e-84    Pyrus x bretschneideri [bai li]
ref|XP_010274558.1|  PREDICTED: lon protease homolog 2, peroxisomal     274   3e-83    Nelumbo nucifera [Indian lotus]
ref|XP_009765598.1|  PREDICTED: lon protease homolog 2, peroxisom...    273   4e-83    Nicotiana sylvestris
ref|XP_007155737.1|  hypothetical protein PHAVU_003G2274001g            263   9e-83    Phaseolus vulgaris [French bean]
gb|KDP45972.1|  hypothetical protein JCGZ_11875                         270   7e-82    Jatropha curcas
ref|XP_011070270.1|  PREDICTED: lon protease homolog 2, peroxisomal     270   8e-82    Sesamum indicum [beniseed]
ref|XP_009765597.1|  PREDICTED: lon protease homolog 2, peroxisom...    267   1e-80    Nicotiana sylvestris
gb|EYU33045.1|  hypothetical protein MIMGU_mgv1a001102mg                267   1e-80    Erythranthe guttata [common monkey flower]
ref|XP_010055388.1|  PREDICTED: lon protease homolog 2, peroxisomal     266   2e-80    Eucalyptus grandis [rose gum]
ref|XP_004300290.1|  PREDICTED: lon protease homolog 2, peroxisomal     266   4e-80    Fragaria vesca subsp. vesca
ref|XP_006440121.1|  hypothetical protein CICLE_v10018797mg             265   8e-80    
ref|XP_006440122.1|  hypothetical protein CICLE_v10018797mg             265   9e-80    Citrus clementina [clementine]
gb|EYU17852.1|  hypothetical protein MIMGU_mgv1a0010891mg               260   2e-79    Erythranthe guttata [common monkey flower]
ref|XP_008788653.1|  PREDICTED: LOW QUALITY PROTEIN: lon protease...    261   1e-78    Phoenix dactylifera
ref|XP_007156608.1|  hypothetical protein PHAVU_002G002900g             259   1e-78    Phaseolus vulgaris [French bean]
gb|KHN42642.1|  Lon protease like 2, peroxisomal                        261   1e-78    Glycine soja [wild soybean]
ref|XP_003517387.1|  PREDICTED: lon protease homolog 2, peroxisom...    261   2e-78    Glycine max [soybeans]
ref|XP_004150167.1|  PREDICTED: lon protease homolog 2, peroxisom...    261   2e-78    Cucumis sativus [cucumbers]
ref|XP_008448748.1|  PREDICTED: lon protease homolog 2, peroxisom...    260   3e-78    Cucumis melo [Oriental melon]
ref|XP_007039619.1|  Lon protease 2                                     259   6e-78    
ref|XP_007156607.1|  hypothetical protein PHAVU_002G002900g             258   8e-78    Phaseolus vulgaris [French bean]
ref|XP_010325534.1|  PREDICTED: lon protease homolog 2, peroxisom...    259   1e-77    Solanum lycopersicum
ref|XP_006358613.1|  PREDICTED: lon protease homolog 2, peroxisom...    259   1e-77    Solanum tuberosum [potatoes]
gb|EPS62878.1|  hypothetical protein M569_11910                         259   1e-77    Genlisea aurea
ref|XP_010677210.1|  PREDICTED: lon protease homolog 2, peroxisomal     258   1e-77    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAA20482.1|  ATP-dependent protease Lon                             258   2e-77    Spinacia oleracea
sp|O04979.2|LONP2_SPIOL  RecName: Full=Lon protease homolog 2, pe...    258   3e-77    Spinacia oleracea
gb|KJB25416.1|  hypothetical protein B456_004G190200                    257   4e-77    Gossypium raimondii
gb|KJB39795.1|  hypothetical protein B456_007G030900                    257   4e-77    Gossypium raimondii
gb|KJB39796.1|  hypothetical protein B456_007G030900                    257   5e-77    Gossypium raimondii
gb|KJB39792.1|  hypothetical protein B456_007G030900                    257   6e-77    Gossypium raimondii
ref|XP_011032006.1|  PREDICTED: lon protease homolog 2, peroxisom...    257   6e-77    Populus euphratica
gb|KJB25415.1|  hypothetical protein B456_004G190200                    256   7e-77    Gossypium raimondii
gb|KJB39794.1|  hypothetical protein B456_007G030900                    257   7e-77    Gossypium raimondii
gb|KHG28341.1|  Lon protease, peroxisomal -like protein                 256   8e-77    Gossypium arboreum [tree cotton]
ref|XP_010941248.1|  PREDICTED: lon protease homolog 2, peroxisom...    256   9e-77    Elaeis guineensis
ref|XP_010941245.1|  PREDICTED: lon protease homolog 2, peroxisom...    256   1e-76    Elaeis guineensis
gb|KHG09410.1|  Lon protease, peroxisomal -like protein                 256   1e-76    Gossypium arboreum [tree cotton]
ref|XP_010941247.1|  PREDICTED: lon protease homolog 2, peroxisom...    256   1e-76    Elaeis guineensis
ref|XP_010935031.1|  PREDICTED: lon protease homolog 2, peroxisomal     256   1e-76    Elaeis guineensis
ref|XP_010941244.1|  PREDICTED: lon protease homolog 2, peroxisom...    256   2e-76    Elaeis guineensis
ref|XP_008229504.1|  PREDICTED: LOW QUALITY PROTEIN: lon protease...    255   2e-76    
ref|XP_002528799.1|  ATP-dependent protease La, putative                254   7e-76    Ricinus communis
ref|XP_003524333.1|  PREDICTED: lon protease homolog 2, peroxisom...    253   9e-76    Glycine max [soybeans]
gb|KHN01656.1|  Lon protease like 2, peroxisomal                        252   3e-75    Glycine soja [wild soybean]
ref|XP_003549964.1|  PREDICTED: lon protease homolog 2, peroxisom...    252   3e-75    Glycine max [soybeans]
ref|XP_008799399.1|  PREDICTED: lon protease homolog 2, peroxisom...    252   4e-75    Phoenix dactylifera
ref|XP_004511756.1|  PREDICTED: lon protease homolog 2, peroxisom...    250   2e-74    Cicer arietinum [garbanzo]
ref|XP_009393749.1|  PREDICTED: lon protease homolog 2, peroxisomal     248   8e-74    Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH31576.1|  lon-related ATP-dependent protease, putative            248   1e-73    Medicago truncatula
ref|XP_006854015.1|  hypothetical protein AMTR_s00048p00009570          247   2e-73    Amborella trichopoda
ref|XP_006368476.1|  Lon protease 1 family protein                      247   3e-73    Populus trichocarpa [western balsam poplar]
ref|XP_002304362.2|  Lon protease 1 family protein                      246   4e-73    
gb|KHN21044.1|  Lon protease like 2, peroxisomal                        246   5e-73    Glycine soja [wild soybean]
ref|XP_004508987.1|  PREDICTED: lon protease homolog 2, peroxisom...    244   2e-72    Cicer arietinum [garbanzo]
ref|XP_003611421.1|  Lon protease-like protein                          243   5e-72    Medicago truncatula
ref|XP_011018661.1|  PREDICTED: lon protease homolog 2, peroxisomal     243   7e-72    Populus euphratica
ref|XP_009383286.1|  PREDICTED: lon protease homolog 2, peroxisom...    242   1e-71    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF78488.1|  unknown                                                 236   1e-71    Zea mays [maize]
ref|XP_006398398.1|  hypothetical protein EUTSA_v10000767mg             242   2e-71    Eutrema salsugineum [saltwater cress]
ref|XP_004957462.1|  PREDICTED: lon protease homolog 2, peroxisom...    236   2e-71    
gb|KFK31410.1|  hypothetical protein AALP_AA6G108400                    240   9e-71    Arabis alpina [alpine rockcress]
gb|AAK62365.1|AF385580_1  Lon protease                                  239   1e-70    Dichanthelium lanuginosum
ref|XP_010530002.1|  PREDICTED: lon protease homolog 2, peroxisom...    236   1e-69    Tarenaya hassleriana [spider flower]
emb|CDX77732.1|  BnaC07g19860D                                          236   2e-69    
ref|XP_009101454.1|  PREDICTED: lon protease homolog 2, peroxisomal     236   2e-69    Brassica rapa
emb|CDY33510.1|  BnaA06g35630D                                          236   2e-69    Brassica napus [oilseed rape]
ref|XP_010530000.1|  PREDICTED: lon protease homolog 2, peroxisom...    236   2e-69    Tarenaya hassleriana [spider flower]
ref|XP_010530001.1|  PREDICTED: lon protease homolog 2, peroxisom...    236   2e-69    Tarenaya hassleriana [spider flower]
ref|XP_010529999.1|  PREDICTED: lon protease homolog 2, peroxisom...    236   3e-69    Tarenaya hassleriana [spider flower]
ref|NP_001105903.1|  lon protease homolog 2, peroxisomal                235   5e-69    Zea mays [maize]
ref|XP_010495794.1|  PREDICTED: lon protease homolog 2, peroxisom...    233   5e-69    
sp|B8BDV1.1|LONP2_ORYSI  RecName: Full=Lon protease homolog 2, pe...    235   6e-69    Oryza sativa Indica Group [Indian rice]
gb|AAM95459.1|  Lon protease                                            235   6e-69    Oryza sativa Indica Group [Indian rice]
dbj|BAD33324.1|  putative Lon protease                                  234   6e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004970472.1|  PREDICTED: lon protease homolog 2, peroxisom...    235   6e-69    Setaria italica
ref|NP_001063769.1|  Os09g0533400                                       234   7e-69    
ref|XP_010441513.1|  PREDICTED: lon protease homolog 2, peroxisomal     234   9e-69    Camelina sativa [gold-of-pleasure]
ref|NP_568675.1|  lon protease-like 2                                   234   1e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002462726.1|  hypothetical protein SORBIDRAFT_02g030960          232   4e-68    Sorghum bicolor [broomcorn]
ref|XP_006279987.1|  hypothetical protein CARUB_v10025858mg             232   5e-68    Capsella rubella
ref|XP_002863374.1|  hypothetical protein ARALYDRAFT_494276             230   3e-67    
ref|XP_010518860.1|  PREDICTED: lon protease homolog 2, peroxisomal     227   3e-66    
ref|XP_008670352.1|  PREDICTED: lon protease homolog 2, peroxisom...    212   3e-66    
ref|XP_006661475.1|  PREDICTED: lon protease homolog 2, peroxisom...    226   1e-65    
ref|XP_010481381.1|  PREDICTED: lon protease homolog 2, peroxisomal     225   2e-65    Camelina sativa [gold-of-pleasure]
dbj|BAJ95084.1|  predicted protein                                      224   6e-65    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003578503.1|  PREDICTED: lon protease homolog 2, peroxisomal     220   1e-63    Brachypodium distachyon [annual false brome]
gb|AAS19619.1|  LON1 protease                                           217   1e-62    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002974838.1|  hypothetical protein SELMODRAFT_150045             186   2e-51    
gb|EMS60327.1|  Lon protease-like protein 2, peroxisomal                179   6e-49    Triticum urartu
gb|EMT28056.1|  Lon protease-like protein, mitochondrial                171   1e-46    
ref|XP_002963756.1|  hypothetical protein SELMODRAFT_141788             161   1e-42    
ref|XP_001757793.1|  predicted protein                                  149   4e-38    
gb|KDO52684.1|  hypothetical protein CISIN_1g003349mg                   146   4e-37    Citrus sinensis [apfelsine]
ref|XP_004163979.1|  PREDICTED: lon protease homolog 2, peroxisom...    145   5e-37    
ref|XP_010325536.1|  PREDICTED: lon protease homolog 2, peroxisom...    143   4e-36    Solanum lycopersicum
ref|XP_002980173.1|  hypothetical protein SELMODRAFT_444435             138   2e-35    
ref|XP_011032007.1|  PREDICTED: lon protease homolog 2, peroxisom...    140   5e-35    Populus euphratica
gb|KEH31578.1|  lon-related ATP-dependent protease, putative            127   2e-30    Medicago truncatula
gb|KEH31577.1|  lon-related ATP-dependent protease, putative            126   3e-30    Medicago truncatula
ref|XP_002963350.1|  hypothetical protein SELMODRAFT_405160           97.4    1e-20    
ref|XP_002501871.1|  lon protease                                     70.5    8e-11    Micromonas commoda
ref|XP_003057661.1|  predicted protein                                67.8    6e-10    Micromonas pusilla CCMP1545
ref|XP_008364428.1|  PREDICTED: uncharacterized protein LOC103428108  57.0    1e-06    
gb|ERZ96146.1|  hypothetical protein GLOINDRAFT_334534                53.1    2e-05    
gb|KIG14657.1|  ATP-dependent protease La                             52.8    3e-05    Enhygromyxa salina
gb|KDE02405.1|  hypothetical protein, variant                         50.8    1e-04    Microbotryum lychnidis-dioicae p1A1 Lamole
gb|KDE02404.1|  hypothetical protein MVLG_07037                       50.8    1e-04    Microbotryum lychnidis-dioicae p1A1 Lamole



>dbj|BAO57289.1| ATP-dependent Lon protease [Ipomoea nil]
Length=886

 Score =   329 bits (844),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 159/160 (99%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            SAETTTVAPTLSPGV TDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS
Sbjct  61   SAETTTVAPTLSPGVATDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  160



>emb|CDP13424.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   290 bits (743),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            SAET TVAP+LS G+ TDS +R  K+Q G S++HKH+ KN QEVIHWHNRGVAARALHLS
Sbjct  61   SAETATVAPSLSQGLGTDSVERNSKSQVGVSDAHKHESKNAQEVIHWHNRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITS
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITS  160



>ref|XP_002282657.1| PREDICTED: lon protease homolog 2, peroxisomal [Vitis vinifera]
 emb|CBI33970.3| unnamed protein product [Vitis vinifera]
Length=888

 Score =   287 bits (734),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AE TTV P LS GV TDS +R+ K Q  TSES+K DGKNQQEVIHWH RGVAARALHLS
Sbjct  61   TAEMTTVGPLLSQGVGTDSGERSSKIQVATSESNKPDGKNQQEVIHWHTRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI+S
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARISS  160



>ref|XP_010110520.1| Lon protease-2-like protein [Morus notabilis]
 gb|EXC26738.1| Lon protease-2-like protein [Morus notabilis]
Length=865

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPARLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AETTTV P LS GV +DS +R  + Q GTS+SHK DGKNQQE IHWH RGVAARALHLS
Sbjct  61   AAETTTVGPVLSQGVGSDSGERNSRVQVGTSDSHKLDGKNQQEAIHWHTRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYY+ARI+
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFTVQELSTRGTYYSARIS  159



>ref|XP_009615530.1| PREDICTED: lon protease homolog 2, peroxisomal {ECO:0000255|HAMAP-Rule:MF_03121} 
isoform X1 [Nicotiana tomentosiformis]
Length=888

 Score =   282 bits (721),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MGESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            SAET T     S G   +SA+R  KNQAG S++HKHD KNQQEVIHWHNRGVAARALHLS
Sbjct  61   SAETATSGTATSSGGGVESAERGLKNQAGISDTHKHDSKNQQEVIHWHNRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITS
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITS  160



>ref|XP_009371862.1| PREDICTED: lon protease homolog 2, peroxisomal [Pyrus x bretschneideri]
Length=888

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPTRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AE  TVAP LS GV +DS +R+ + Q GTS+SH+ DGKNQQEVIHWH RGVAARALHLS
Sbjct  61   AAEAATVAPVLSQGVGSDSGERSSRVQVGTSDSHRPDGKNQQEVIHWHTRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTY+VVLEGLCRF+VQELSTRGTYYTARI+
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFNVQELSTRGTYYTARIS  159



>ref|XP_008373622.1| PREDICTED: lon protease homolog 2, peroxisomal [Malus domestica]
Length=888

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPTRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AE  TVAP LS GV +DS +R+ + Q GTS+SH+ DGKNQQEVIHWH RGVAARALHLS
Sbjct  61   AAEAATVAPVLSQGVGSDSGERSSRVQVGTSDSHRPDGKNQQEVIHWHTRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTY+VVLEGLCRF+VQELSTRGTYYTARI+
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFNVQELSTRGTYYTARIS  159



>ref|XP_007210904.1| hypothetical protein PRUPE_ppa001173mg [Prunus persica]
 gb|EMJ12103.1| hypothetical protein PRUPE_ppa001173mg [Prunus persica]
Length=888

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELPGRL ILPF+NKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPGRLGILPFKNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AE  +V P LS GV ++S +R  + Q GTS+SH+ DGKNQQEVIHWH RGVAARALHLS
Sbjct  61   AAEAASVGPVLSQGVGSESGERGSRVQVGTSDSHRLDGKNQQEVIHWHTRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTY+VVLEGLCRFSVQELSTRGTYYTARI+
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFSVQELSTRGTYYTARIS  159



>ref|XP_008348469.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Malus domestica]
Length=888

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPTRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AE  TV P +S GV TDS +R+ + Q G S+SH+ DGKNQQEVIHWH+RGVAARALHLS
Sbjct  61   AAEAATVGPVVSQGVGTDSGERSSRVQVGVSDSHRLDGKNQQEVIHWHSRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTY+VVLEGLCRF++QELSTRGTYYTARI+
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFNIQELSTRGTYYTARIS  159



>emb|CAN75012.1| hypothetical protein VITISV_034238 [Vitis vinifera]
Length=904

 Score =   276 bits (707),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 146/176 (83%), Gaps = 16/176 (9%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLS----------------PGVVTDSADRTPKNQAGTSESHKHDGKNQQEV  329
            +AE TTV P LS                 GV TDS +R+ K Q  TSES+K DGKNQQEV
Sbjct  61   TAEMTTVXPLLSQVSFIACFEGNAFYLSAGVGTDSGERSSKIQVATSESNKPDGKNQQEV  120

Query  330  IHWHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            IHWH RGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI+S
Sbjct  121  IHWHTRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARISS  176



>ref|XP_009615537.1| PREDICTED: lon protease homolog 2, peroxisomal {ECO:0000255|HAMAP-Rule:MF_03121} 
isoform X2 [Nicotiana tomentosiformis]
Length=882

 Score =   276 bits (706),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 142/160 (89%), Gaps = 6/160 (4%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MGESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            SAET T       G   +SA+R  KNQAG S++HKHD KNQQEVIHWHNRGVAARALHLS
Sbjct  61   SAETAT------SGGGVESAERGLKNQAGISDTHKHDSKNQQEVIHWHNRGVAARALHLS  114

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITS
Sbjct  115  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITS  154



>ref|XP_009341221.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X2 
[Pyrus x bretschneideri]
Length=888

 Score =   276 bits (706),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPTRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +A+  TV P +S GV TDS +R+ + Q G S+SH+ DGKNQQEVIHWH+RGVAARALHLS
Sbjct  61   AADAATVDPVVSQGVGTDSGERSSRVQVGASDSHRLDGKNQQEVIHWHSRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTY+VVLEGLCRF+VQELSTRGTYYTARI+
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFNVQELSTRGTYYTARIS  159



>ref|XP_009341220.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 
[Pyrus x bretschneideri]
Length=900

 Score =   276 bits (706),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPTRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +A+  TV P +S GV TDS +R+ + Q G S+SH+ DGKNQQEVIHWH+RGVAARALHLS
Sbjct  61   AADAATVDPVVSQGVGTDSGERSSRVQVGASDSHRLDGKNQQEVIHWHSRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTY+VVLEGLCRF+VQELSTRGTYYTARI+
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFNVQELSTRGTYYTARIS  159



>ref|XP_010274558.1| PREDICTED: lon protease homolog 2, peroxisomal [Nelumbo nucifera]
Length=888

 Score =   274 bits (700),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            M E VELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIGVLPVRD
Sbjct  1    MVEPVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGVLPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AETT+V   LSPGV T+S D+  K    TS+SHK D KNQQE+IHWH RGVAARALHLS
Sbjct  61   AAETTSVGSILSPGVGTESGDQGVKEPVSTSDSHKQDSKNQQELIHWHTRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTY+VVLEGLCRFSVQELS RGTYYTARI+
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFSVQELSARGTYYTARIS  159



>ref|XP_009765598.1| PREDICTED: lon protease homolog 2, peroxisomal isoform X2 [Nicotiana 
sylvestris]
Length=882

 Score =   273 bits (699),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 140/160 (88%), Gaps = 6/160 (4%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MGESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            SA T T       G   +SA+R  KNQ G S++HKHD KNQQEVIHWHNRGVAARALHLS
Sbjct  61   SAATAT------SGAGVESAERGLKNQTGISDTHKHDSKNQQEVIHWHNRGVAARALHLS  114

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITS
Sbjct  115  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITS  154



>ref|XP_007155737.1| hypothetical protein PHAVU_003G2274001g, partial [Phaseolus vulgaris]
 gb|ESW27731.1| hypothetical protein PHAVU_003G2274001g, partial [Phaseolus vulgaris]
Length=462

 Score =   263 bits (672),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RLAILPF+NKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFKNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AE   V PT+S G  TDSA++  + Q G+S+SHK D K Q +V+HWHNRGVAAR LHLS
Sbjct  61   AAEIKAVGPTVSEG--TDSANQNTRVQGGSSDSHKLDTKRQNDVVHWHNRGVAARPLHLS  118

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY VVLEGLCRFSVQELSTRG Y+TARITS
Sbjct  119  RGVEKPSGRVTYTVVLEGLCRFSVQELSTRGIYHTARITS  158



>gb|KDP45972.1| hypothetical protein JCGZ_11875 [Jatropha curcas]
Length=895

 Score =   270 bits (691),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 143/163 (88%), Gaps = 3/163 (2%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAE---TTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARAL  368
            +A    T +V PTLS GV +DS +R+ K Q G +E+ K DGKNQQEVI WHNRGVAARAL
Sbjct  61   AAAEETTASVGPTLSQGVGSDSGERSSKIQVGNAENLKLDGKNQQEVIRWHNRGVAARAL  120

Query  369  HLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            HLSRGVEKPSGRVTYIVVLEGLCRFSVQELS RG YYTARI+S
Sbjct  121  HLSRGVEKPSGRVTYIVVLEGLCRFSVQELSKRGMYYTARISS  163



>ref|XP_011070270.1| PREDICTED: lon protease homolog 2, peroxisomal [Sesamum indicum]
Length=889

 Score =   270 bits (690),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAP-TLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  374
            +A  +  A  TL+PG  T+  +R+ KNQ  TS+SHKH GKNQQEVIHWHN+GVAARALHL
Sbjct  61   AAAESQSAASTLAPGGGTNLGERSSKNQEETSDSHKHGGKNQQEVIHWHNKGVAARALHL  120

Query  375  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI  491
            SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI
Sbjct  121  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI  159



>ref|XP_009765597.1| PREDICTED: lon protease homolog 2, peroxisomal isoform X1 [Nicotiana 
sylvestris]
Length=888

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MGESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            SA T T     S G   +SA+R  KNQ G S++HKHD KNQQEVIHWHNRGVAARALHLS
Sbjct  61   SAATATSGTATSSGAGVESAERGLKNQTGISDTHKHDSKNQQEVIHWHNRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITS
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITS  160



>gb|EYU33045.1| hypothetical protein MIMGU_mgv1a001102mg [Erythranthe guttata]
Length=889

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 141/160 (88%), Gaps = 1/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKG+IG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGIIGILPVRD  60

Query  198  SA-ETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  374
            +A E  +   T S G  T+  +R+ K Q  TS+SHK  GKNQQEVIHWHNRGVAARALHL
Sbjct  61   AAVEAPSAGSTSSAGGGTNLGERSSKTQEETSDSHKLGGKNQQEVIHWHNRGVAARALHL  120

Query  375  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT
Sbjct  121  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  160



>ref|XP_010055388.1| PREDICTED: lon protease homolog 2, peroxisomal [Eucalyptus grandis]
 gb|KCW71845.1| hypothetical protein EUGRSUZ_E00326 [Eucalyptus grandis]
Length=888

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQKEEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            + ET +V+P +S GV TD  +R+ K QA +++SHK +GKN QEVIHWH RGVAARALHLS
Sbjct  61   AEETPSVSPVISHGVGTDLTERSSKTQASSTDSHKLNGKNPQEVIHWHARGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTY+VVLEGLCRFSVQEL TRGTYY ARIT
Sbjct  121  RGVEKPSGRVTYMVVLEGLCRFSVQELGTRGTYYIARIT  159



>ref|XP_004300290.1| PREDICTED: lon protease homolog 2, peroxisomal [Fragaria vesca 
subsp. vesca]
Length=887

 Score =   266 bits (679),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RL ILPF+NKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLGILPFKNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AE   V P LS G+ +DS +R+ K Q GTS+  + DGKNQQ+ IHWH RGVAARALHLS
Sbjct  61   AAEAAAVGPMLSQGMGSDSGERSSKVQVGTSDPQRLDGKNQQD-IHWHTRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTY+VVLEGLCRFSVQELSTRGTYYTARI+
Sbjct  120  RGVEKPSGRVTYVVVLEGLCRFSVQELSTRGTYYTARIS  158



>ref|XP_006440121.1| hypothetical protein CICLE_v10018797mg [Citrus clementina]
 gb|ESR53361.1| hypothetical protein CICLE_v10018797mg [Citrus clementina]
Length=863

 Score =   265 bits (676),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 140/161 (87%), Gaps = 6/161 (4%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            M ESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MTESVELPNRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVT-DSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  374
            +A  T+V PT+S G V  DS++R  K Q G S     DGKNQQEVIHWHNRGVAARALHL
Sbjct  61   AAADTSVGPTVSQGGVGGDSSERASKVQVGAS-----DGKNQQEVIHWHNRGVAARALHL  115

Query  375  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI+S
Sbjct  116  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARISS  156



>ref|XP_006440122.1| hypothetical protein CICLE_v10018797mg [Citrus clementina]
 ref|XP_006477041.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Citrus sinensis]
 gb|ESR53362.1| hypothetical protein CICLE_v10018797mg [Citrus clementina]
Length=886

 Score =   265 bits (676),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 140/161 (87%), Gaps = 6/161 (4%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            M ESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MTESVELPNRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVT-DSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  374
            +A  T+V PT+S G V  DS++R  K Q G S     DGKNQQEVIHWHNRGVAARALHL
Sbjct  61   AAADTSVGPTVSQGGVGGDSSERASKVQVGAS-----DGKNQQEVIHWHNRGVAARALHL  115

Query  375  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI+S
Sbjct  116  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARISS  156



>gb|EYU17852.1| hypothetical protein MIMGU_mgv1a0010891mg, partial [Erythranthe 
guttata]
Length=685

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 141/167 (84%), Gaps = 8/167 (5%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKG+IG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGIIGILPVRD  60

Query  198  SA-ETTTVAPTLSPGVV-------TDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGV  353
            +A E  +   T S G         T+  +R+ K Q  TS+SHK  GKNQQEVIHWHNRGV
Sbjct  61   AAVEAPSAGSTSSAGNRCTLSRGGTNLGERSSKTQEETSDSHKLGGKNQQEVIHWHNRGV  120

Query  354  AARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            AARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT
Sbjct  121  AARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  167



>ref|XP_008788653.1| PREDICTED: LOW QUALITY PROTEIN: lon protease homolog 2, peroxisomal-like 
[Phoenix dactylifera]
Length=888

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE VELPGRL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIGVLPVRD
Sbjct  1    MAELVELPGRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGVLPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGT-SESHKHDGKNQQEVIHWHNRGVAARALHL  374
            S E  TV   LSPGV  DS +R+ K  A    +S K DGKNQQE+IHWHNRGVAARALHL
Sbjct  61   S-EAATVGSMLSPGVGNDSGERSLKGPADVLGDSQKQDGKNQQELIHWHNRGVAARALHL  119

Query  375  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG YY AR++
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGNYYIARVS  159



>ref|XP_007156608.1| hypothetical protein PHAVU_002G002900g [Phaseolus vulgaris]
 gb|ESW28602.1| hypothetical protein PHAVU_002G002900g [Phaseolus vulgaris]
Length=722

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAES+ELP RLAILPFRNKVLLPGAIIRI CTSP SVKLVEQELWQRE+KGLIG+LPVRD
Sbjct  1    MAESIELPSRLAILPFRNKVLLPGAIIRIYCTSPTSVKLVEQELWQREDKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +A+  T AP +  GV TDS D++ K Q G+  SH+ D  +Q +V+HWH RGVAARALHLS
Sbjct  61   AAQLKTAAPVVPHGVGTDSLDKSSKVQGGSPNSHELDANSQHDVVHWHKRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTYIVVLEGLCRFSVQELS RGTY+TARI+S
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFSVQELSMRGTYHTARISS  160



>gb|KHN42642.1| Lon protease like 2, peroxisomal [Glycine soja]
Length=889

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAES ELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESFELPNRLAILPFRNKVLLPGAIIRIRCTSPISVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SA-ETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  374
            +A E     P +S G  TDS D+  K Q G+S+S K D KNQ +V+HWHNRGVAARALHL
Sbjct  61   AAAEIQPAGPVISHGKGTDSLDQNSKVQGGSSDSQKLDVKNQHDVVHWHNRGVAARALHL  120

Query  375  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTY+TARI+S
Sbjct  121  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYHTARISS  161



>ref|XP_003517387.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 
[Glycine max]
Length=889

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAES ELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESFELPNRLAILPFRNKVLLPGAIIRIRCTSPISVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SA-ETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  374
            +A E     P +S G  TDS D+  K Q G+S+S K D KNQ +V+HWHNRGVAARALHL
Sbjct  61   AAAEIQPAGPVISHGKGTDSLDQNSKVQGGSSDSQKLDVKNQHDVVHWHNRGVAARALHL  120

Query  375  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTY+TARI+S
Sbjct  121  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYHTARISS  161



>ref|XP_004150167.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN55802.1| hypothetical protein Csa_3G016960 [Cucumis sativus]
Length=886

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            M ESVELP RL ILPFRNKVLLPGAIIRIRCTS  SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLGILPFRNKVLLPGAIIRIRCTSSSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
             A+   + P LS GV +DS DR+ + Q+GTS+S + DGKN QEVI WH+RGVAARAL LS
Sbjct  61   DADAPAIVPVLSQGVGSDSGDRSSRVQSGTSDSQRVDGKNHQEVIQWHSRGVAARALQLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTY VVLEGLCRF+VQELSTRGTYYTARI+
Sbjct  121  RGVEKPSGRVTYTVVLEGLCRFTVQELSTRGTYYTARIS  159



>ref|XP_008448748.1| PREDICTED: lon protease homolog 2, peroxisomal isoform X1 [Cucumis 
melo]
Length=886

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            M ESVELP RL ILPFRNKVLLPGAIIRIRCTS  SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLGILPFRNKVLLPGAIIRIRCTSSSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
             A+   + P LS GV +DS DR+ + Q+GTS+S + DGKN QEVI WH+RGVAARAL LS
Sbjct  61   DADAPAIVPVLSQGVGSDSGDRSSRVQSGTSDSQRVDGKNHQEVIQWHSRGVAARALQLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTY VVLEGLCRF+VQELSTRGTYYTARI+
Sbjct  121  RGVEKPSGRVTYTVVLEGLCRFTVQELSTRGTYYTARIS  159



>ref|XP_007039619.1| Lon protease 2 [Theobroma cacao]
 gb|EOY24120.1| Lon protease 2 [Theobroma cacao]
Length=888

 Score =   259 bits (663),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MA+SVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAQSVELPGRLAILPFRNKVLLPGAFIRIRCTSHSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +A+ T++   LS GV ++S +R+ K +A TS++HK DGKN  EVIHWHNRGVAARALHLS
Sbjct  61   AADMTSMDSVLSQGVGSESGERSSKVKASTSDAHKVDGKNHPEVIHWHNRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTYIVVLEGLCRF+V+ELSTRG Y TA+I+S
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVEELSTRGPYCTAKISS  160



>ref|XP_007156607.1| hypothetical protein PHAVU_002G002900g, partial [Phaseolus vulgaris]
 gb|ESW28601.1| hypothetical protein PHAVU_002G002900g, partial [Phaseolus vulgaris]
Length=828

 Score =   258 bits (660),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAES+ELP RLAILPFRNKVLLPGAIIRI CTSP SVKLVEQELWQRE+KGLIG+LPVRD
Sbjct  1    MAESIELPSRLAILPFRNKVLLPGAIIRIYCTSPTSVKLVEQELWQREDKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +A+  T AP +  GV TDS D++ K Q G+  SH+ D  +Q +V+HWH RGVAARALHLS
Sbjct  61   AAQLKTAAPVVPHGVGTDSLDKSSKVQGGSPNSHELDANSQHDVVHWHKRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTYIVVLEGLCRFSVQELS RGTY+TARI+S
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFSVQELSMRGTYHTARISS  160



>ref|XP_010325534.1| PREDICTED: lon protease homolog 2, peroxisomal isoform X1 [Solanum 
lycopersicum]
Length=877

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 137/160 (86%), Gaps = 11/160 (7%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            SAE+ T    +S G+  +           TS+SHK D KNQQEVIHWH+RGVAARALHLS
Sbjct  61   SAESATSGTAVSSGMGGE-----------TSDSHKLDSKNQQEVIHWHDRGVAARALHLS  109

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITS
Sbjct  110  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITS  149



>ref|XP_006358613.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Solanum 
tuberosum]
Length=877

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 137/160 (86%), Gaps = 11/160 (7%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            SAE+ T    +S G+  +           TS+SHK D KNQQEVIHWH+RGVAARALHLS
Sbjct  61   SAESATSGTAVSSGMGGE-----------TSDSHKLDSKNQQEVIHWHDRGVAARALHLS  109

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITS
Sbjct  110  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITS  149



>gb|EPS62878.1| hypothetical protein M569_11910 [Genlisea aurea]
Length=886

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 138/160 (86%), Gaps = 5/160 (3%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP R+AILPFRNKVLLPG+IIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRIAILPFRNKVLLPGSIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +A +       S G+ T+  +R PK+Q   S+SHKH GKNQQE+IHWHNRGVAARALHLS
Sbjct  61   AAGSLQ-----SSGLGTNVMERNPKSQDDASDSHKHGGKNQQEIIHWHNRGVAARALHLS  115

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTYIVVLEG+CRF VQ+L  RGTYYTARIT+
Sbjct  116  RGVEKPSGRVTYIVVLEGMCRFGVQDLINRGTYYTARITT  155



>ref|XP_010677210.1| PREDICTED: lon protease homolog 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=888

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE VELP RL IL FRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG++PVRD
Sbjct  1    MAEPVELPNRLGILAFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGIVPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AE+ +V   L PG  +DS +R  KNQ+G S+S K D K+QQE +HWHNRGVAARALHLS
Sbjct  61   AAESASVGSVLYPGGGSDSGERNLKNQSGLSDSRKTDAKSQQEAVHWHNRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTY VVLEGLCRFSV EL++RGTYYTARI+
Sbjct  121  RGVEKPSGRVTYTVVLEGLCRFSVLELNSRGTYYTARIS  159



>dbj|BAA20482.1| ATP-dependent protease Lon [Spinacia oleracea]
Length=875

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE+VELP RL IL FRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG++PVRD
Sbjct  1    MAEAVELPSRLGILAFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGIVPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            ++E+ +VAP L PG  TDS +R  K+Q G S+S K DGK+QQE +HWH RGVAARALHLS
Sbjct  61   ASESASVAPVLYPGGGTDSGERNVKSQPGLSDSRKADGKSQQEAVHWHTRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTY VVLEGLCRF V EL++RG YYTARI+
Sbjct  121  RGVEKPSGRVTYTVVLEGLCRFRVMELNSRGNYYTARIS  159



>sp|O04979.2|LONP2_SPIOL RecName: Full=Lon protease homolog 2, peroxisomal [Spinacia oleracea]
Length=887

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE+VELP RL IL FRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG++PVRD
Sbjct  1    MAEAVELPSRLGILAFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGIVPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            ++E+ +VAP L PG  TDS +R  K+Q G S+S K DGK+QQE +HWH RGVAARALHLS
Sbjct  61   ASESASVAPVLYPGGGTDSGERNVKSQPGLSDSRKADGKSQQEAVHWHTRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTY VVLEGLCRF V EL++RG YYTARI+
Sbjct  121  RGVEKPSGRVTYTVVLEGLCRFRVMELNSRGNYYTARIS  159



>gb|KJB25416.1| hypothetical protein B456_004G190200 [Gossypium raimondii]
Length=832

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSHSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AE T++   LS GV ++S +R+ K Q  TS++HK DGK+  EVIHWH RGVAARALHLS
Sbjct  61   AAEMTSMDSVLSQGVGSESGERSSKVQISTSDAHKVDGKSHPEVIHWHKRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTYIVVLEGLCRF+V+ELSTRG Y TA+I+S
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVEELSTRGPYCTAKISS  160



>gb|KJB39795.1| hypothetical protein B456_007G030900 [Gossypium raimondii]
Length=875

 Score =   257 bits (657),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPV+D
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSQSSVKLVEQELWQREEKGLIGILPVQD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AETT++   LS GV ++S +R+   Q  TS++HK DGKN  EVIHWHNRGVAARALHLS
Sbjct  61   AAETTSMDSMLSQGVGSESGERSSNVQVSTSDAHKVDGKNPSEVIHWHNRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTYIVVLEGLCRF+++EL+TRG Y TA+I+
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNIEELNTRGPYCTAKIS  159



>gb|KJB39796.1| hypothetical protein B456_007G030900 [Gossypium raimondii]
Length=881

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPV+D
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSQSSVKLVEQELWQREEKGLIGILPVQD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AETT++   LS GV ++S +R+   Q  TS++HK DGKN  EVIHWHNRGVAARALHLS
Sbjct  61   AAETTSMDSMLSQGVGSESGERSSNVQVSTSDAHKVDGKNPSEVIHWHNRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTYIVVLEGLCRF+++EL+TRG Y TA+I+
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNIEELNTRGPYCTAKIS  159



>gb|KJB39792.1| hypothetical protein B456_007G030900 [Gossypium raimondii]
 gb|KJB39793.1| hypothetical protein B456_007G030900 [Gossypium raimondii]
 gb|KJB39797.1| hypothetical protein B456_007G030900 [Gossypium raimondii]
Length=890

 Score =   257 bits (656),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPV+D
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSQSSVKLVEQELWQREEKGLIGILPVQD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AETT++   LS GV ++S +R+   Q  TS++HK DGKN  EVIHWHNRGVAARALHLS
Sbjct  61   AAETTSMDSMLSQGVGSESGERSSNVQVSTSDAHKVDGKNPSEVIHWHNRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTYIVVLEGLCRF+++EL+TRG Y TA+I+
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNIEELNTRGPYCTAKIS  159



>ref|XP_011032006.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 
[Populus euphratica]
Length=895

 Score =   257 bits (656),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 142/166 (86%), Gaps = 7/166 (4%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTT------VAPTLSPGVVTDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGVA  356
            +A   +      V PTLS GV +DS++R+ K QA TS  + K DGK+QQEV HWHNRGVA
Sbjct  61   AAAAASSSETASVGPTLSQGVGSDSSERSSKTQASTSSDNVKLDGKHQQEVFHWHNRGVA  120

Query  357  ARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            ARALHLSRGVEKPSGRVTYIVVLEGLCRF++ EL TRGTYYTARI+
Sbjct  121  ARALHLSRGVEKPSGRVTYIVVLEGLCRFNLNELVTRGTYYTARIS  166



>gb|KJB25415.1| hypothetical protein B456_004G190200 [Gossypium raimondii]
Length=888

 Score =   256 bits (655),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSHSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AE T++   LS GV ++S +R+ K Q  TS++HK DGK+  EVIHWH RGVAARALHLS
Sbjct  61   AAEMTSMDSVLSQGVGSESGERSSKVQISTSDAHKVDGKSHPEVIHWHKRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTYIVVLEGLCRF+V+ELSTRG Y TA+I+S
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVEELSTRGPYCTAKISS  160



>gb|KJB39794.1| hypothetical protein B456_007G030900 [Gossypium raimondii]
Length=904

 Score =   257 bits (656),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPV+D
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSQSSVKLVEQELWQREEKGLIGILPVQD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AETT++   LS GV ++S +R+   Q  TS++HK DGKN  EVIHWHNRGVAARALHLS
Sbjct  61   AAETTSMDSMLSQGVGSESGERSSNVQVSTSDAHKVDGKNPSEVIHWHNRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTYIVVLEGLCRF+++EL+TRG Y TA+I+
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNIEELNTRGPYCTAKIS  159



>gb|KHG28341.1| Lon protease, peroxisomal -like protein [Gossypium arboreum]
Length=888

 Score =   256 bits (655),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSHSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AE T++   LS GV ++S +R+ K Q  TS++HK DGK+  EVIHWH RGVAARALHLS
Sbjct  61   AAEMTSMDSVLSQGVGSESGERSSKVQISTSDNHKVDGKSHPEVIHWHKRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTYIVVLEGLCRF+V+ELSTRG Y TA+I+S
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVEELSTRGPYCTAKISS  160



>ref|XP_010941248.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X4 
[Elaeis guineensis]
Length=880

 Score =   256 bits (654),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE V+LP RL ILPFRNKVLLPGAIIRIRCTSP SV LVEQELWQ+EEKGLIGVLPVRD
Sbjct  8    MAEPVDLPSRLGILPFRNKVLLPGAIIRIRCTSPSSVMLVEQELWQKEEKGLIGVLPVRD  67

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            + ET  V   LSPGV  DS +R  K  A   +S K DGKN QE+IHWHNRGVAARALHLS
Sbjct  68   T-ETAAVGSMLSPGVGNDSGERRLKGPADVLDSQKQDGKNPQELIHWHNRGVAARALHLS  126

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTYIVVLEGLCRF+VQELS RGTYYTAR++
Sbjct  127  RGVEKPSGRVTYIVVLEGLCRFNVQELSARGTYYTARVS  165



>ref|XP_010941245.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X2 
[Elaeis guineensis]
 ref|XP_010941246.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X2 
[Elaeis guineensis]
Length=891

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE V+LP RL ILPFRNKVLLPGAIIRIRCTSP SV LVEQELWQ+EEKGLIGVLPVRD
Sbjct  8    MAEPVDLPSRLGILPFRNKVLLPGAIIRIRCTSPSSVMLVEQELWQKEEKGLIGVLPVRD  67

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            + ET  V   LSPGV  DS +R  K  A   +S K DGKN QE+IHWHNRGVAARALHLS
Sbjct  68   T-ETAAVGSMLSPGVGNDSGERRLKGPADVLDSQKQDGKNPQELIHWHNRGVAARALHLS  126

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTYIVVLEGLCRF+VQELS RGTYYTAR++
Sbjct  127  RGVEKPSGRVTYIVVLEGLCRFNVQELSARGTYYTARVS  165



>gb|KHG09410.1| Lon protease, peroxisomal -like protein [Gossypium arboreum]
Length=934

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPV+D
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSQSSVKLVEQELWQREEKGLIGILPVQD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AETT++   LS GV ++S +R+   Q  TS++HK DGKN  EVIHWHNRGVAARALHLS
Sbjct  61   AAETTSMDSMLSQGVGSESCERSSNAQVSTSDAHKVDGKNPSEVIHWHNRGVAARALHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTYIVVLEGLCRF+++EL+TRG Y TA+I+
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNIEELNTRGPYCTAKIS  159



>ref|XP_010941247.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X3 
[Elaeis guineensis]
Length=889

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE V+LP RL ILPFRNKVLLPGAIIRIRCTSP SV LVEQELWQ+EEKGLIGVLPVRD
Sbjct  8    MAEPVDLPSRLGILPFRNKVLLPGAIIRIRCTSPSSVMLVEQELWQKEEKGLIGVLPVRD  67

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            + ET  V   LSPGV  DS +R  K  A   +S K DGKN QE+IHWHNRGVAARALHLS
Sbjct  68   T-ETAAVGSMLSPGVGNDSGERRLKGPADVLDSQKQDGKNPQELIHWHNRGVAARALHLS  126

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTYIVVLEGLCRF+VQELS RGTYYTAR++
Sbjct  127  RGVEKPSGRVTYIVVLEGLCRFNVQELSARGTYYTARVS  165



>ref|XP_010935031.1| PREDICTED: lon protease homolog 2, peroxisomal [Elaeis guineensis]
Length=886

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE VELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIGVLPVRD
Sbjct  1    MAELVELPSRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGVLPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGT-SESHKHDGKNQQEVIHWHNRGVAARALHL  374
            + E   V   LSPGV  DS +R+ K  A    +S K DGKNQQE+IHWHNRGVAARALHL
Sbjct  61   T-EAAAVGSMLSPGVGNDSGERSLKGPADVLGDSQKQDGKNQQELIHWHNRGVAARALHL  119

Query  375  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG YY AR++
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGNYYIARVS  159



>ref|XP_010941244.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 
[Elaeis guineensis]
Length=894

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE V+LP RL ILPFRNKVLLPGAIIRIRCTSP SV LVEQELWQ+EEKGLIGVLPVRD
Sbjct  8    MAEPVDLPSRLGILPFRNKVLLPGAIIRIRCTSPSSVMLVEQELWQKEEKGLIGVLPVRD  67

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            + ET  V   LSPGV  DS +R  K  A   +S K DGKN QE+IHWHNRGVAARALHLS
Sbjct  68   T-ETAAVGSMLSPGVGNDSGERRLKGPADVLDSQKQDGKNPQELIHWHNRGVAARALHLS  126

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTYIVVLEGLCRF+VQELS RGTYYTAR++
Sbjct  127  RGVEKPSGRVTYIVVLEGLCRFNVQELSARGTYYTARVS  165



>ref|XP_008229504.1| PREDICTED: LOW QUALITY PROTEIN: lon protease homolog 2, peroxisomal 
[Prunus mume]
Length=886

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RL ILPF+NKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLGILPFKNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AE  +V P LS GV ++S +R  + Q GTS+SHK D       IHWH RGVAARALHLS
Sbjct  61   AAEAASVGPVLSQGVGSESGERGSRVQVGTSDSHKLD-XXXXXXIHWHTRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTY+VVLEGLCRFSVQELSTRGTYYTARI+
Sbjct  120  RGVEKPSGRVTYVVVLEGLCRFSVQELSTRGTYYTARIS  158



>ref|XP_002528799.1| ATP-dependent protease La, putative [Ricinus communis]
 gb|EEF33621.1| ATP-dependent protease La, putative [Ricinus communis]
Length=890

 Score =   254 bits (649),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 140/166 (84%), Gaps = 10/166 (6%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPNSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SA--ETTTVA---PTLSPGVVTDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGVAA  359
            SA  ETTT     P LS GV  DS     K Q   S+++ K DGK+QQEVI WHNRGVAA
Sbjct  61   SAAEETTTSVGPPPVLSQGVGNDSG----KIQVNNSDNNLKLDGKSQQEVIRWHNRGVAA  116

Query  360  RALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELS RG YYTARI+S
Sbjct  117  RALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSKRGMYYTARISS  162



>ref|XP_003524333.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Glycine 
max]
Length=885

 Score =   253 bits (647),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +AE   V PT+S G   DS ++  K Q+G+S+SHK D K Q +V HWHNRGVAAR LHLS
Sbjct  61   AAEIKPVGPTVSEG--ADSTNQNSKVQSGSSDSHKLDTKKQNDV-HWHNRGVAARPLHLS  117

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY VVLEGLCRFSVQELS RG Y+TARITS
Sbjct  118  RGVEKPSGRVTYTVVLEGLCRFSVQELSMRGIYHTARITS  157



>gb|KHN01656.1| Lon protease like 2, peroxisomal [Glycine soja]
Length=886

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
              E   V PT+S G   DS ++  K Q G+ +S K D K Q +V+HWHNRGVAAR LHLS
Sbjct  61   VVEIKPVGPTVSEG--ADSTNQNSKVQGGSLDSRKLDTKKQNDVVHWHNRGVAARPLHLS  118

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY VVLEGLCRFSVQELSTRG Y+TARITS
Sbjct  119  RGVEKPSGRVTYTVVLEGLCRFSVQELSTRGIYHTARITS  158



>ref|XP_003549964.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 
[Glycine max]
Length=886

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
              E   V PT+S G   DS ++  K Q G+ +S K D K Q +V+HWHNRGVAAR LHLS
Sbjct  61   VVEIKPVGPTVSEG--ADSTNQNSKVQGGSLDSRKLDTKKQNDVVHWHNRGVAARPLHLS  118

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY VVLEGLCRFSVQELSTRG Y+TARITS
Sbjct  119  RGVEKPSGRVTYTVVLEGLCRFSVQELSTRGIYHTARITS  158



>ref|XP_008799399.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Phoenix 
dactylifera]
Length=887

 Score =   252 bits (643),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 133/159 (84%), Gaps = 1/159 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE V+LP RL ILPFRNKVLLPGAIIRIRCTSP SV LVEQELWQ+EEKGLIGVLPVRD
Sbjct  1    MAEPVDLPSRLGILPFRNKVLLPGAIIRIRCTSPSSVMLVEQELWQKEEKGLIGVLPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            + E   V   LSPGV  DS +R+ K  A   +S K DGKNQQ++IHWHNRGVAARALHLS
Sbjct  61   T-EAAAVGSMLSPGVGNDSGERSLKGPADVLDSQKQDGKNQQKLIHWHNRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTYIVVLEGLCRFSVQELS RGTY  AR++
Sbjct  120  RGVEKPSGRVTYIVVLEGLCRFSVQELSARGTYRMARVS  158



>ref|XP_004511756.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Cicer arietinum]
Length=888

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 138/164 (84%), Gaps = 9/164 (5%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MA+SVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MADSVELPNRLAILPFRNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTT----VAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARA  365
            SA        + PTLS GV  DS D++ K   G+S+SH    K Q +V+HWHNRGVAARA
Sbjct  61   SASAAETKPPLGPTLSQGV--DSLDQSSKTHGGSSDSH---AKIQHDVVHWHNRGVAARA  115

Query  366  LHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            LHLSRGVEKPSGRVTYIVVLEGLCRFSV+ELSTRG Y+TARI+S
Sbjct  116  LHLSRGVEKPSGRVTYIVVLEGLCRFSVEELSTRGAYHTARISS  159



>ref|XP_009393749.1| PREDICTED: lon protease homolog 2, peroxisomal [Musa acuminata 
subsp. malaccensis]
Length=889

 Score =   248 bits (634),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE VELP RLAILPFRN+VLLPGAIIRIRCTSP SVKLVEQELWQ+EEKGLIGVLPVRD
Sbjct  1    MAEPVELPSRLAILPFRNQVLLPGAIIRIRCTSPSSVKLVEQELWQKEEKGLIGVLPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGT-SESHKHDGKNQQEVIHWHNRGVAARALHL  374
            + E T V   ++PG+ +DS+ R  K  A    +S K D KN QEVIHWHNRGVAARALHL
Sbjct  61   T-EATGVGSMIAPGMGSDSSGRGLKGVADVVGDSQKQDAKNPQEVIHWHNRGVAARALHL  119

Query  375  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            SRGVEKPSGRVTYIVVLEGLCRF+VQELS RGTYY AR+ 
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFNVQELSARGTYYVARVN  159



>gb|KEH31576.1| lon-related ATP-dependent protease, putative [Medicago truncatula]
Length=888

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP R+AILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAESVELPSRIAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQKEEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            + E  +  PT S G  TD  +++ K Q G+S+S K D K Q +++HWHNRGVAAR LHLS
Sbjct  61   ALEINSAGPTASQGAGTDILNQSSKLQDGSSDSIKPDTKRQNDIVHWHNRGVAARPLHLS  120

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY VVLEGLCRFSV ELSTRG Y+TA+I+S
Sbjct  121  RGVEKPSGRVTYTVVLEGLCRFSVLELSTRGIYHTAKISS  160



>ref|XP_006854015.1| hypothetical protein AMTR_s00048p00009570 [Amborella trichopoda]
 gb|ERN15482.1| hypothetical protein AMTR_s00048p00009570 [Amborella trichopoda]
Length=888

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE VELPGRLAILPFRNKVLLPG+I+RIRCTSP SVKLVEQELWQREEKGLIGVLPV D
Sbjct  1    MAEMVELPGRLAILPFRNKVLLPGSIVRIRCTSPTSVKLVEQELWQREEKGLIGVLPVHD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            +   ++ A T   G   DS D    N A  +ESHK DGKNQ ++I+WH RGVAARALHLS
Sbjct  61   AGAESS-ASTSPSGATNDSRDHGSNNSASPTESHKQDGKNQHDLINWHKRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTY V+LEGLCRFSVQELS RGTYY ARI+
Sbjct  120  RGVEKPSGRVTYSVILEGLCRFSVQELSARGTYYVARIS  158



>ref|XP_006368476.1| Lon protease 1 family protein [Populus trichocarpa]
 gb|ERP65045.1| Lon protease 1 family protein [Populus trichocarpa]
Length=893

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 141/164 (86%), Gaps = 5/164 (3%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SV+LVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVQLVEQELWQREEKGLIGILPVRD  60

Query  198  ----SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGVAAR  362
                +AET +V PTLS    +D+++++ +  A TS  + K DGK+QQEV HWHNRGVAAR
Sbjct  61   AAAATAETASVGPTLSHSAGSDTSEKSSRTPASTSSDNVKLDGKHQQEVFHWHNRGVAAR  120

Query  363  ALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            ALHLSRGVEKPSGRVTYIVVLEGLCRF++ ELSTRG YYTARI+
Sbjct  121  ALHLSRGVEKPSGRVTYIVVLEGLCRFNLHELSTRGAYYTARIS  164



>ref|XP_002304362.2| Lon protease 1 family protein [Populus trichocarpa]
 gb|EEE79341.2| Lon protease 1 family protein [Populus trichocarpa]
Length=893

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 139/164 (85%), Gaps = 5/164 (3%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTV----APTLSPGVVTDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGVAAR  362
            +A  ++        +  GV +DS++R+ K QA TS  + K DGK+QQEV HWHNRGVAAR
Sbjct  61   AAAASSSETASGNMICLGVGSDSSERSSKTQASTSSDNVKLDGKHQQEVFHWHNRGVAAR  120

Query  363  ALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            ALHLSRGVEKPSGRVTYIVVLEGLCRF++ EL TRGTYYTARI+
Sbjct  121  ALHLSRGVEKPSGRVTYIVVLEGLCRFNLNELITRGTYYTARIS  164



>gb|KHN21044.1| Lon protease like 2, peroxisomal [Glycine soja]
Length=893

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 137/168 (82%), Gaps = 11/168 (7%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNR--------GV  353
            +AE   V PT+S G   DS ++  K Q+G+S+SHK D K Q +V HWHNR        GV
Sbjct  61   AAEIKPVGPTVSEG--ADSTNQNSKVQSGSSDSHKLDTKKQNDV-HWHNRHSSREYLLGV  117

Query  354  AARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            AAR LHLSRGVEKPSGRVTY VVLEGLCRFSVQELS RG Y+TARITS
Sbjct  118  AARPLHLSRGVEKPSGRVTYTVVLEGLCRFSVQELSMRGIYHTARITS  165



>ref|XP_004508987.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Cicer arietinum]
Length=886

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            M+ESV+LP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MSESVDLPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQKEEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            + E  +  PT S G  TD  D++ K Q  +S+S K D K Q +V+HWHNRGVAAR LHLS
Sbjct  61   ALEIKSAGPTASQG--TDFLDQSSKLQDSSSDSLKLDTKKQNDVVHWHNRGVAARPLHLS  118

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY VVLEGLCRFSV ELSTRG Y+TARI+S
Sbjct  119  RGVEKPSGRVTYTVVLEGLCRFSVLELSTRGIYHTARISS  158



>ref|XP_003611421.1| Lon protease-like protein [Medicago truncatula]
 gb|AES94379.1| lon-related ATP-dependent protease, putative [Medicago truncatula]
Length=883

 Score =   243 bits (621),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 138/163 (85%), Gaps = 11/163 (7%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MA+SVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKG+IG+LPVRD
Sbjct  1    MADSVELPSRLAILPFRNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGMIGILPVRD  60

Query  198  ---SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARAL  368
               SAET  +  T     V+DS D+T K   G+S+S   + K Q +V+HWHNRGVAARAL
Sbjct  61   TAASAETKQLGST-----VSDSIDQTSKVHGGSSDS---NAKVQNDVVHWHNRGVAARAL  112

Query  369  HLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            HLSRGVEKPSGRVTYIVVLEGLCRF+VQEL+TRGTY+TARI+S
Sbjct  113  HLSRGVEKPSGRVTYIVVLEGLCRFNVQELNTRGTYHTARISS  155



>ref|XP_011018661.1| PREDICTED: lon protease homolog 2, peroxisomal [Populus euphratica]
Length=896

 Score =   243 bits (620),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 140/167 (84%), Gaps = 8/167 (5%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SV+LVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVQLVEQELWQREEKGLIGILPVRD  60

Query  198  SAETT----TVAPTLSPGVV---TDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGV  353
            +A  T    +V PTLS       +D+++++ K  A TS  + K DGK+QQEV HWHNRGV
Sbjct  61   AAAATTETASVGPTLSDDKTRAESDTSEKSSKTPASTSSDNVKPDGKHQQEVFHWHNRGV  120

Query  354  AARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            AARALHLSRGVEKPSGRVTYIVVLEGLCRF++ ELSTRG YYTARI+
Sbjct  121  AARALHLSRGVEKPSGRVTYIVVLEGLCRFNLHELSTRGAYYTARIS  167



>ref|XP_009383286.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            M E  ELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELW +EEKGLIGVLPVRD
Sbjct  1    MVELAELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWHKEEKGLIGVLPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            + E   V   ++PG+ +DS +++ K +A   E    D  N+QE++HWH+RGVAARALHLS
Sbjct  61   T-EAAAVGSMIAPGMGSDSGEQSLKAKADVGEFQNQDANNEQELMHWHHRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            RGVEKPSGRVTYIVVLEGLCR SVQELSTRGTYY ARI+
Sbjct  120  RGVEKPSGRVTYIVVLEGLCRISVQELSTRGTYYVARIS  158



>gb|ACF78488.1| unknown [Zea mays]
 tpg|DAA62468.1| TPA: hypothetical protein ZEAMMB73_586377 [Zea mays]
Length=514

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = +3

Query  18   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  194
            M++S VELP RLA+LPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+EEKGLIGVLPVR
Sbjct  1    MSDSPVELPSRLAVLPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR  60

Query  195  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  374
            DS E T V   LSPGV +DS +   K      ES K D KN +E IHWH++GVAARALHL
Sbjct  61   DS-EATAVGSLLSPGVGSDSGEGGSKVGGSAVESSKQDTKNGKEPIHWHSKGVAARALHL  119

Query  375  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG Y+ AR++
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGPYHVARVS  159



>ref|XP_006398398.1| hypothetical protein EUTSA_v10000767mg [Eutrema salsugineum]
 gb|ESQ39851.1| hypothetical protein EUTSA_v10000767mg [Eutrema salsugineum]
Length=887

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQEV HWHNRGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGAGSDSGERSLKFLVGTTDAQKSDAKDQQEV-HWHNRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITS
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITS  159



>ref|XP_004957462.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Setaria 
italica]
Length=563

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = +3

Query  18   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  194
            MA+S VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+EEKGLIGVLPVR
Sbjct  1    MADSPVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR  60

Query  195  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  374
            DS E   V   LS GV +DS +   K      ES K D KN +E IHWH++GVAARALHL
Sbjct  61   DS-EAGAVGSLLSAGVGSDSGEGGSKAGGSAGESSKQDTKNGKEPIHWHSKGVAARALHL  119

Query  375  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVS  159



>gb|KFK31410.1| hypothetical protein AALP_AA6G108400 [Arabis alpina]
Length=889

 Score =   240 bits (612),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
             AE + +   ++PG  +D+ +R+ K   GT+++ K D K+QQEV HWHNRGVAARALHLS
Sbjct  61   DAEGSAIGTMINPGAGSDTGERSLKFLVGTTDAQKSDAKDQQEV-HWHNRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY+VVLEGL RFSVQ+L  RG Y  ARITS
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFSVQDLGKRGPYSVARITS  159



>gb|AAK62365.1|AF385580_1 Lon protease [Dichanthelium lanuginosum]
Length=884

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 135/160 (84%), Gaps = 3/160 (2%)
 Frame = +3

Query  18   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  194
            MA+S VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+EEKGLIGVLPVR
Sbjct  1    MADSPVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR  60

Query  195  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  374
            DS E   V   LSPGV +DS +   K   G+ ES K D KN +E IHWH++GVAARALHL
Sbjct  61   DS-EAAAVGSLLSPGVGSDSGEGGSK-AGGSGESSKQDTKNGKEPIHWHSKGVAARALHL  118

Query  375  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++
Sbjct  119  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVS  158



>ref|XP_010530002.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X4 
[Tarenaya hassleriana]
Length=838

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            + ET      ++PGV +DS ++  K+Q  T+++H  + ++QQEV HWHNRGVAARALHLS
Sbjct  61   AGETAPFGTLITPGVGSDSGEKGIKHQVVTADAHGSEARDQQEV-HWHNRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY+VVLEGL RFSVQEL  RG Y  ARITS
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFSVQELGKRGPYSVARITS  159



>emb|CDX77732.1| BnaC07g19860D [Brassica napus]
Length=887

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MA++VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MADTVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQEV HWH+RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGGGSDSGERSLKFLVGTTDAQKSDAKDQQEV-HWHSRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITS
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITS  159



>ref|XP_009101454.1| PREDICTED: lon protease homolog 2, peroxisomal [Brassica rapa]
Length=887

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MA++VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MADTVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQEV HWH+RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGGGSDSGERSLKFLVGTTDAQKSDAKDQQEV-HWHSRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITS
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITS  159



>emb|CDY33510.1| BnaA06g35630D [Brassica napus]
Length=887

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MA++VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MADNVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQEV HWH+RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGGGSDSGERSLKFLVGTTDAQKSDAKDQQEV-HWHSRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITS
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITS  159



>ref|XP_010530000.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X2 
[Tarenaya hassleriana]
Length=889

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            + ET      ++PGV +DS ++  K+Q  T+++H  + ++QQEV HWHNRGVAARALHLS
Sbjct  61   AGETAPFGTLITPGVGSDSGEKGIKHQVVTADAHGSEARDQQEV-HWHNRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY+VVLEGL RFSVQEL  RG Y  ARITS
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFSVQELGKRGPYSVARITS  159



>ref|XP_010530001.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X3 
[Tarenaya hassleriana]
Length=876

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            + ET      ++PGV +DS ++  K+Q  T+++H  + ++QQEV HWHNRGVAARALHLS
Sbjct  61   AGETAPFGTLITPGVGSDSGEKGIKHQVVTADAHGSEARDQQEV-HWHNRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY+VVLEGL RFSVQEL  RG Y  ARITS
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFSVQELGKRGPYSVARITS  159



>ref|XP_010529999.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 
[Tarenaya hassleriana]
Length=905

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
            + ET      ++PGV +DS ++  K+Q  T+++H  + ++QQEV HWHNRGVAARALHLS
Sbjct  61   AGETAPFGTLITPGVGSDSGEKGIKHQVVTADAHGSEARDQQEV-HWHNRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY+VVLEGL RFSVQEL  RG Y  ARITS
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFSVQELGKRGPYSVARITS  159



>ref|NP_001105903.1| lon protease homolog 2, peroxisomal [Zea mays]
 sp|P93647.1|LONP2_MAIZE RecName: Full=Lon protease homolog 2, peroxisomal [Zea mays]
 gb|AAC50011.1| LON1 protease [Zea mays]
 tpg|DAA62469.1| TPA: lon protease-like protein 2, peroxisomal [Zea mays]
Length=885

 Score =   235 bits (600),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = +3

Query  18   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  194
            M++S VELP RLA+LPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+EEKGLIGVLPVR
Sbjct  1    MSDSPVELPSRLAVLPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR  60

Query  195  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  374
            DS E T V   LSPGV +DS +   K      ES K D KN +E IHWH++GVAARALHL
Sbjct  61   DS-EATAVGSLLSPGVGSDSGEGGSKVGGSAVESSKQDTKNGKEPIHWHSKGVAARALHL  119

Query  375  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG Y+ AR++
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGPYHVARVS  159



>ref|XP_010495794.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Camelina 
sativa]
Length=726

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+Q E   WH RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGAGSDSGERSLKFLVGTTDAQKSDAKDQHEA-QWHTRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITS
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITS  159



>sp|B8BDV1.1|LONP2_ORYSI RecName: Full=Lon protease homolog 2, peroxisomal [Oryza sativa 
Indica Group]
 gb|EEC84943.1| hypothetical protein OsI_32159 [Oryza sativa Indica Group]
Length=884

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 135/161 (84%), Gaps = 5/161 (3%)
 Frame = +3

Query  18   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  194
            MA++ VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQREEKGLIGVLPV 
Sbjct  1    MADAAVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQREEKGLIGVLPVH  60

Query  195  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTS-ESHKHDGKNQQEVIHWHNRGVAARALH  371
            DS    ++   LSPGV +DS +   K   G++ ES K D KN +E IHWH+RGVAARALH
Sbjct  61   DSEAAGSL---LSPGVGSDSGEGGSKAPGGSAGESTKQDTKNGKETIHWHSRGVAARALH  117

Query  372  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            LSRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++
Sbjct  118  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVS  158



>gb|AAM95459.1| Lon protease [Oryza sativa Indica Group]
Length=884

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 135/161 (84%), Gaps = 5/161 (3%)
 Frame = +3

Query  18   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  194
            MA++ VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQREEKGLIGVLPV 
Sbjct  1    MADAAVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQREEKGLIGVLPVH  60

Query  195  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTS-ESHKHDGKNQQEVIHWHNRGVAARALH  371
            DS    ++   LSPGV +DS +   K   G++ ES K D KN +E IHWH+RGVAARALH
Sbjct  61   DSEAAGSL---LSPGVGSDSGEGGSKAPGGSAGESTKQDTKNGKETIHWHSRGVAARALH  117

Query  372  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            LSRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++
Sbjct  118  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVS  158



>dbj|BAD33324.1| putative Lon protease [Oryza sativa Japonica Group]
 dbj|BAD46033.1| putative Lon protease [Oryza sativa Japonica Group]
Length=880

 Score =   234 bits (598),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 135/161 (84%), Gaps = 5/161 (3%)
 Frame = +3

Query  18   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  194
            MA++ VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQREEKGLIGVLPV 
Sbjct  1    MADAAVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQREEKGLIGVLPVH  60

Query  195  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTS-ESHKHDGKNQQEVIHWHNRGVAARALH  371
            DS    ++   LSPGV +DS +   K   G++ ES K D KN +E IHWH+RGVAARALH
Sbjct  61   DSEAAGSL---LSPGVGSDSGEGGSKAPGGSAGESTKQDTKNGKETIHWHSRGVAARALH  117

Query  372  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            LSRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++
Sbjct  118  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVS  158



>ref|XP_004970472.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Setaria 
italica]
Length=885

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = +3

Query  18   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  194
            MA+S VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+EEKGLIGVLPVR
Sbjct  1    MADSPVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR  60

Query  195  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  374
            DS E   V   LS GV +DS +   K      ES K D KN +E IHWH++GVAARALHL
Sbjct  61   DS-EAGAVGSLLSAGVGSDSGEGGSKAGGSAGESSKQDTKNGKEPIHWHSKGVAARALHL  119

Query  375  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVS  159



>ref|NP_001063769.1| Os09g0533400 [Oryza sativa Japonica Group]
 sp|Q0J032.1|LONP2_ORYSJ RecName: Full=Lon protease homolog 2, peroxisomal [Oryza sativa 
Japonica Group]
 dbj|BAF25683.1| Os09g0533400 [Oryza sativa Japonica Group]
 gb|EEE70111.1| hypothetical protein OsJ_30122 [Oryza sativa Japonica Group]
Length=884

 Score =   234 bits (598),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 135/161 (84%), Gaps = 5/161 (3%)
 Frame = +3

Query  18   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  194
            MA++ VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQREEKGLIGVLPV 
Sbjct  1    MADAAVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQREEKGLIGVLPVH  60

Query  195  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTS-ESHKHDGKNQQEVIHWHNRGVAARALH  371
            DS    ++   LSPGV +DS +   K   G++ ES K D KN +E IHWH+RGVAARALH
Sbjct  61   DSEAAGSL---LSPGVGSDSGEGGSKAPGGSAGESTKQDTKNGKETIHWHSRGVAARALH  117

Query  372  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            LSRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++
Sbjct  118  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVS  158



>ref|XP_010441513.1| PREDICTED: lon protease homolog 2, peroxisomal [Camelina sativa]
Length=888

 Score =   234 bits (598),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQE   WH RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGAGSDSVERSLKFLVGTTDAQKSDAKDQQEA-QWHTRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITS
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITS  159



>ref|NP_568675.1| lon protease-like 2 [Arabidopsis thaliana]
 sp|O64948.1|LONP2_ARATH RecName: Full=Lon protease homolog 2, peroxisomal [Arabidopsis 
thaliana]
 gb|AAC05085.1| Lon protease [Arabidopsis thaliana]
 dbj|BAB10243.1| mitochondrial Lon protease homolog 1 precursor [Arabidopsis thaliana]
 gb|AED95460.1| lon protease-like 2 [Arabidopsis thaliana]
Length=888

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQ+ + WH RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGAGSDSGERSLKFLVGTTDAQKSDAKDQQD-LQWHTRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITS
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITS  159



>ref|XP_002462726.1| hypothetical protein SORBIDRAFT_02g030960 [Sorghum bicolor]
 gb|EER99247.1| hypothetical protein SORBIDRAFT_02g030960 [Sorghum bicolor]
Length=885

 Score =   232 bits (592),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = +3

Query  18   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  194
            MA++ VELP RLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+EEKGLIGVLPVR
Sbjct  1    MADAPVELPSRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR  60

Query  195  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  374
            DS E T V   LSPGV +DS +   K      ES + D KN ++ IHWH++GVAARALHL
Sbjct  61   DS-EATAVGSLLSPGVGSDSGEGGSKAGGSAGESSRQDTKNGKDPIHWHSKGVAARALHL  119

Query  375  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            SRGVEKPSGRVTYIVVLEGLCRF+VQELS RG Y+ AR++
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFNVQELSARGPYHVARVS  159



>ref|XP_006279987.1| hypothetical protein CARUB_v10025858mg [Capsella rubella]
 gb|EOA12885.1| hypothetical protein CARUB_v10025858mg [Capsella rubella]
Length=888

 Score =   232 bits (592),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQEV  WH RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGAGSDSGERSLKFLVGTTDAQKSDAKDQQEV-QWHTRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY+VVLEGL RF+VQE   RG Y  AR+TS
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQEHGKRGPYSVARVTS  159



>ref|XP_002863374.1| hypothetical protein ARALYDRAFT_494276 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39633.1| hypothetical protein ARALYDRAFT_494276 [Arabidopsis lyrata subsp. 
lyrata]
Length=888

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
             AE +++   ++ G  +DS +R+ K   GT+++ K D K+QQ+ + WH RGVAARALHLS
Sbjct  61   DAEGSSIGTMINHGAGSDSGERSLKFLVGTTDAQKSDAKDQQD-LQWHTRGVAARALHLS  119

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITS
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITS  159



>ref|XP_010518860.1| PREDICTED: lon protease homolog 2, peroxisomal [Tarenaya hassleriana]
Length=875

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 131/156 (84%), Gaps = 1/156 (1%)
 Frame = +3

Query  30   VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDSAET  209
            +ELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD+AE 
Sbjct  1    MELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRDAAEG  60

Query  210  TTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVE  389
            T+++  +SPGV +DS +   K+Q GT+++ K + ++QQ+V  WH+RGVAARALHLSRGVE
Sbjct  61   TSISTMISPGVGSDSGENGMKHQVGTADAQKSEARDQQDV-DWHHRGVAARALHLSRGVE  119

Query  390  KPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            KPSGRVTY+VVLEGL RFSV EL  RG Y  A+ITS
Sbjct  120  KPSGRVTYVVVLEGLSRFSVHELGKRGPYSVAKITS  155



>ref|XP_008670352.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Zea mays]
Length=188

 Score =   212 bits (539),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = +3

Query  18   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  194
            MA+S VELP RLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+E+KGLIGVLPVR
Sbjct  1    MADSPVELPNRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEDKGLIGVLPVR  60

Query  195  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  374
            DS E T +   LSPGV +DS     K      ES K   KN +E I WH +GVAARALHL
Sbjct  61   DS-EATAIGSLLSPGVGSDSGGGGSKAVGSAGESSKQHLKNGKEPIQWHTKGVAARALHL  119

Query  375  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            SRGVEKPSGRVTYIVVLEGLCRFSVQEL+ RG Y+ AR++
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELNARGPYHFARVS  159



>ref|XP_006661475.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Oryza brachyantha]
Length=894

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 130/166 (78%), Gaps = 14/166 (8%)
 Frame = +3

Query  30   VELPGRLAILPFRNKVLLPGAIIRIRCTSPR----------SVKLVEQELWQREEKGLIG  179
            VELPGRLAILPFRNKVLLPGAI+RIRCT+P           SVKLVEQELWQREEKGLIG
Sbjct  6    VELPGRLAILPFRNKVLLPGAIVRIRCTNPILLYQCNCFACSVKLVEQELWQREEKGLIG  65

Query  180  VLPVRDSAETTTVAPTLSPGVVTDSADRTPKNQAGTS-ESHKHDGKNQQEVIHWHNRGVA  356
            VLPV DS    ++   LSPGV +DS +   K   GT  ES K D KN +E IHWH+RGVA
Sbjct  66   VLPVHDSEAAGSL---LSPGVGSDSGEGGSKAPGGTGGESTKQDTKNGKETIHWHSRGVA  122

Query  357  ARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            ARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++
Sbjct  123  ARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVS  168



>ref|XP_010481381.1| PREDICTED: lon protease homolog 2, peroxisomal [Camelina sativa]
Length=883

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 128/160 (80%), Gaps = 6/160 (4%)
 Frame = +3

Query  18   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
             AE +++   ++PG  +DS +R+ K   GT+     D K+QQE   WH RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGAGSDSGERSLKFLVGTT-----DAKDQQEA-QWHTRGVAARALHLS  114

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITS  497
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITS
Sbjct  115  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITS  154



>dbj|BAJ95084.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=886

 Score =   224 bits (570),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 135/163 (83%), Gaps = 7/163 (4%)
 Frame = +3

Query  18   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  194
            MA++ VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQRE+KGLIGVLPVR
Sbjct  1    MADAPVELPGRLAILPFRNKVLLPGAIVRIRCTTPSSVKLVEQELWQREDKGLIGVLPVR  60

Query  195  DSAETTTVAPTLSPGVVTDSAD---RTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARA  365
            DS E   V   LSPGV  DS +   R+P    G  ES K D K+ +E IHWH+RGVAARA
Sbjct  61   DS-EAAAVGSILSPGVGGDSGEGGRRSPGASGG--ESSKQDAKSGKEPIHWHSRGVAARA  117

Query  366  LHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            LHLSRGVEKPSGRVTYIVVLEGLCRFSV+EL+ RG+Y+ AR++
Sbjct  118  LHLSRGVEKPSGRVTYIVVLEGLCRFSVEELNARGSYHVARVS  160



>ref|XP_003578503.1| PREDICTED: lon protease homolog 2, peroxisomal [Brachypodium 
distachyon]
Length=886

 Score =   220 bits (560),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 133/161 (83%), Gaps = 3/161 (2%)
 Frame = +3

Query  18   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  194
            MA++ VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQRE+KGLIGVLPVR
Sbjct  1    MADAPVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQREDKGLIGVLPVR  60

Query  195  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGVAARALH  371
            DS E  +V   LSPGV  DS +   K+  G+     K D KN +E IHWHNRGVAARALH
Sbjct  61   DS-EAASVGSILSPGVGGDSGEGGSKSPGGSGGESTKQDAKNGKEPIHWHNRGVAARALH  119

Query  372  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            LSRGVEKPSGRVTY VVLEGLCRFSVQEL+ RG+Y+ AR++
Sbjct  120  LSRGVEKPSGRVTYTVVLEGLCRFSVQELNARGSYHVARVS  160



>gb|AAS19619.1| LON1 protease [Triticum aestivum]
Length=886

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 135/161 (84%), Gaps = 3/161 (2%)
 Frame = +3

Query  18   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  194
            MA++ VELPGRLAILPFRNKVLLPGAI+RIRCT P SVKLVEQELWQRE++GLIGVLPVR
Sbjct  1    MADAPVELPGRLAILPFRNKVLLPGAIVRIRCTYPSSVKLVEQELWQREDRGLIGVLPVR  60

Query  195  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTS-ESHKHDGKNQQEVIHWHNRGVAARALH  371
            DS E   V   LSPGV +DS D   ++  G+  ES K D K+ +E IHWH+RGVAARALH
Sbjct  61   DS-EAAAVGSILSPGVGSDSGDGGRRSPGGSGGESTKQDAKSGKEPIHWHSRGVAARALH  119

Query  372  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            LSRGVEKPSGRVTYIVVLEGLCRFSV+EL+ RG+Y+ AR++
Sbjct  120  LSRGVEKPSGRVTYIVVLEGLCRFSVEELNARGSYHVARVS  160



>ref|XP_002974838.1| hypothetical protein SELMODRAFT_150045 [Selaginella moellendorffii]
 gb|EFJ24358.1| hypothetical protein SELMODRAFT_150045 [Selaginella moellendorffii]
Length=888

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 119/159 (75%), Gaps = 10/159 (6%)
 Frame = +3

Query  21   AESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDS  200
             +  ELP RLAI+ FRN+VLLPGA++RIRCTSP +V+LVEQELWQ+E++GLIGVLPVRD 
Sbjct  6    GDVAELPPRLAIMLFRNRVLLPGAVVRIRCTSPTNVRLVEQELWQKEDRGLIGVLPVRDL  65

Query  201  AETTTVAPTLSPGVVTDSADRTPKNQAGTS--ESHKHDGKNQQEVIHWHNRGVAARALHL  374
             +T           VT     +P ++ GT+  +  +  GK  QE++ WH RGVAARALHL
Sbjct  66   QQTVLG--------VTCVLIASPGDRGGTALPDFQQCLGKQNQELVQWHPRGVAARALHL  117

Query  375  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI  491
            SRG+EKPSGRVTY VVLEG CRFS+++++ RG+Y TARI
Sbjct  118  SRGMEKPSGRVTYTVVLEGWCRFSLKDMNARGSYNTARI  156



>gb|EMS60327.1| Lon protease-like protein 2, peroxisomal [Triticum urartu]
Length=838

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 107/133 (80%), Gaps = 2/133 (2%)
 Frame = +3

Query  99   RIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDSAETTTVAPTLSPGVVTDSADRTPKNQ  278
            R RC +P SVKLVEQELWQRE+KGLIGVLPVRDS E   V   LSPGV +DS +   ++ 
Sbjct  3    RSRCPTPSSVKLVEQELWQREDKGLIGVLPVRDS-EAAAVGSILSPGVGSDSGEGGRRSP  61

Query  279  AGTS-ESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQE  455
             G+  ES K D K+ +E IHWH+RGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSV+E
Sbjct  62   GGSGGESTKQDAKSGKEPIHWHSRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVEE  121

Query  456  LSTRGTYYTARIT  494
            L+ RG+Y+ AR++
Sbjct  122  LNARGSYHVARVS  134



>gb|EMT28056.1| Lon protease-like protein, mitochondrial [Aegilops tauschii]
Length=597

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 103/126 (82%), Gaps = 2/126 (2%)
 Frame = +3

Query  120  RSVKLVEQELWQREEKGLIGVLPVRDSAETTTVAPTLSPGVVTDSADRTPKNQAGTS-ES  296
            +SVKLVEQELWQRE+KGLIGVLPVRDS E   V   LSPGV +DS +   ++  G+  ES
Sbjct  28   KSVKLVEQELWQREDKGLIGVLPVRDS-EAAAVGSILSPGVGSDSGEGGRRSPGGSGGES  86

Query  297  HKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTY  476
             K D K+ +E IHWH+RGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSV+EL+ RG+Y
Sbjct  87   TKQDAKSGKEPIHWHSRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVEELNARGSY  146

Query  477  YTARIT  494
            + AR++
Sbjct  147  HVARVS  152



>ref|XP_002963756.1| hypothetical protein SELMODRAFT_141788 [Selaginella moellendorffii]
 gb|EFJ35627.1| hypothetical protein SELMODRAFT_141788 [Selaginella moellendorffii]
Length=879

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 109/157 (69%), Gaps = 15/157 (10%)
 Frame = +3

Query  21   AESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDS  200
             +  ELP RLAI+ FRN+VLLPGA++RIRCTSP +V+LVEQELWQ+E++GLIGVLPVRD 
Sbjct  6    GDVAELPPRLAIMLFRNRVLLPGAVVRIRCTSPTNVRLVEQELWQKEDRGLIGVLPVRDL  65

Query  201  AETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSR  380
              +   +       +  S +  P    G +     DG  +        RGVAARALHLSR
Sbjct  66   QHSAWESK------IKSSCNGIP----GKNSRVFPDGSRKNVC-----RGVAARALHLSR  110

Query  381  GVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI  491
            G+EKPSGRVTY VVLEG CRFS+++++ RG+Y TARI
Sbjct  111  GMEKPSGRVTYTVVLEGWCRFSLKDMNARGSYNTARI  147



>ref|XP_001757793.1| predicted protein [Physcomitrella patens]
 gb|EDQ77433.1| predicted protein [Physcomitrella patens]
Length=893

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 102/156 (65%), Gaps = 9/156 (6%)
 Frame = +3

Query  36   LPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKG-LIGVLPVRDSAETT  212
            LP  LAILPFRNKVLLPGAI++IR   P SV+L+EQELWQ+E KG  IGVLP+ D     
Sbjct  12   LPPVLAILPFRNKVLLPGAIVKIRVNVPASVRLIEQELWQKENKGRFIGVLPLHDLHRVI  71

Query  213  T--VAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGV  386
            +  V P    G V  +     + +   S    H  KN  ++I WH RGVAARAL L + +
Sbjct  72   SHKVKPA---GTVIKAPGEKERGEIILS---LHSNKNGDDLIQWHPRGVAARALELEQKI  125

Query  387  EKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            EK +GRV+YIV+LEG CRF VQEL +  +Y +ARIT
Sbjct  126  EKYTGRVSYIVMLEGWCRFGVQELISTSSYKSARIT  161



>gb|KDO52684.1| hypothetical protein CISIN_1g003349mg [Citrus sinensis]
Length=828

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 75/87 (86%), Gaps = 5/87 (6%)
 Frame = +3

Query  237  GVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYI  416
            GV  DS++R  K Q G S     DGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYI
Sbjct  17   GVGGDSSERASKVQVGAS-----DGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYI  71

Query  417  VVLEGLCRFSVQELSTRGTYYTARITS  497
            VVLEGLCRFSVQELSTRGTYYTARI+S
Sbjct  72   VVLEGLCRFSVQELSTRGTYYTARISS  98



>ref|XP_004163979.1| PREDICTED: lon protease homolog 2, peroxisomal-like, partial 
[Cucumis sativus]
Length=816

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +3

Query  228  LSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRV  407
            LS GV +DS DR+ + Q+GTS+S + DGKN QEVI WH+RGVAARAL LSRGVEKPSGRV
Sbjct  1    LSQGVGSDSGDRSSRVQSGTSDSQRVDGKNHQEVIQWHSRGVAARALQLSRGVEKPSGRV  60

Query  408  TYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            TY VVLEGLCRF+VQELSTRGTYYTARI+
Sbjct  61   TYTVVLEGLCRFTVQELSTRGTYYTARIS  89



>ref|XP_010325536.1| PREDICTED: lon protease homolog 2, peroxisomal isoform X2 [Solanum 
lycopersicum]
Length=803

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +3

Query  285  TSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELST  464
            TS+SHK D KNQQEVIHWH+RGVAARALHLSRGVEKPSGRVTYIVVLEGLCRF+VQELST
Sbjct  5    TSDSHKLDSKNQQEVIHWHDRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFNVQELST  64

Query  465  RGTYYTARITS  497
            RGTYYTARITS
Sbjct  65   RGTYYTARITS  75



>ref|XP_002980173.1| hypothetical protein SELMODRAFT_444435, partial [Selaginella 
moellendorffii]
 gb|EFJ18433.1| hypothetical protein SELMODRAFT_444435, partial [Selaginella 
moellendorffii]
Length=432

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 92/125 (74%), Gaps = 8/125 (6%)
 Frame = +3

Query  33   ELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDSAETT  212
            ELP RL+I+ FRN+VLLPGA++RIRCTSP +V+LVEQELWQ+E++GLIGVLPVRD  ++ 
Sbjct  10   ELPPRLSIMLFRNRVLLPGAVVRIRCTSPTNVRLVEQELWQKEDRGLIGVLPVRDLQQSD  69

Query  213  TVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEK  392
              +P   P   + S  R         ++ K  GK  QE++ WH RGVAARALHLSRG+EK
Sbjct  70   PASPPPPPPPSSSSLPRL--------KARKGLGKQNQELVQWHPRGVAARALHLSRGMEK  121

Query  393  PSGRV  407
            PSGR+
Sbjct  122  PSGRM  126



>ref|XP_011032007.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X2 
[Populus euphratica]
Length=842

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  237  GVVTDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTY  413
            GV +DS++R+ K QA TS  + K DGK+QQEV HWHNRGVAARALHLSRGVEKPSGRVTY
Sbjct  27   GVGSDSSERSSKTQASTSSDNVKLDGKHQQEVFHWHNRGVAARALHLSRGVEKPSGRVTY  86

Query  414  IVVLEGLCRFSVQELSTRGTYYTARIT  494
            IVVLEGLCRF++ EL TRGTYYTARI+
Sbjct  87   IVVLEGLCRFNLNELVTRGTYYTARIS  113



>gb|KEH31578.1| lon-related ATP-dependent protease, putative [Medicago truncatula]
Length=821

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +3

Query  237  GVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYI  416
            G  TD  +++ K Q G+S+S K D K Q +++HWHNRGVAAR LHLSRGVEKPSGRVTY 
Sbjct  7    GAGTDILNQSSKLQDGSSDSIKPDTKRQNDIVHWHNRGVAARPLHLSRGVEKPSGRVTYT  66

Query  417  VVLEGLCRFSVQELSTRGTYYTARITS  497
            VVLEGLCRFSV ELSTRG Y+TA+I+S
Sbjct  67   VVLEGLCRFSVLELSTRGIYHTAKISS  93



>gb|KEH31577.1| lon-related ATP-dependent protease, putative [Medicago truncatula]
Length=825

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  246  TDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYIVVL  425
            TD  +++ K Q G+S+S K D K Q +++HWHNRGVAAR LHLSRGVEKPSGRVTY VVL
Sbjct  14   TDILNQSSKLQDGSSDSIKPDTKRQNDIVHWHNRGVAARPLHLSRGVEKPSGRVTYTVVL  73

Query  426  EGLCRFSVQELSTRGTYYTARITS  497
            EGLCRFSV ELSTRG Y+TA+I+S
Sbjct  74   EGLCRFSVLELSTRGIYHTAKISS  97



>ref|XP_002963350.1| hypothetical protein SELMODRAFT_405160 [Selaginella moellendorffii]
 gb|EFJ35221.1| hypothetical protein SELMODRAFT_405160 [Selaginella moellendorffii]
Length=432

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +3

Query  21   AESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  197
             +  ELP RLAI+ FRN+VLLPGA++RIRCTSP +V+LVEQELWQ+E++GLIGVLPVRD
Sbjct  6    GDVAELPPRLAIMLFRNRVLLPGAVVRIRCTSPTNVRLVEQELWQKEDRGLIGVLPVRD  64



>ref|XP_002501871.1| lon protease [Micromonas sp. RCC299]
 gb|ACO63129.1| lon protease [Micromonas sp. RCC299]
Length=904

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 74/149 (50%), Gaps = 16/149 (11%)
 Frame = +3

Query  36   LPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQ------REEKGLIGVLPVRD  197
            LP  L+ILP +N++LLP + +++  TSPRSV LV+  L              +GV+P R 
Sbjct  12   LPSTLSILPLKNRILLPSSAMKLLLTSPRSVALVDAILSSTSAGSGHHHSLYVGVVPTRR  71

Query  198  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  377
                 + A   + G++ D+ D            H   G ++ E    H+ G AAR + +S
Sbjct  72   DPRANSNAFAAANGMLDDTDD-------NEDAPHHAGGDHEDERARLHDVGTAARIVQIS  124

Query  378  RGVEKPSGRVTYIVVLEGLCRFSVQELST  464
            R   K S   +Y ++LEG CRF + +L+ 
Sbjct  125  R---KDSPVRSYTLLLEGRCRFGLDKLTA  150



>ref|XP_003057661.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57612.1| predicted protein [Micromonas pusilla CCMP1545]
Length=917

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 83/170 (49%), Gaps = 27/170 (16%)
 Frame = +3

Query  21   AESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQEL---WQREEKGLIGVLPV  191
            AE   LP  L+ILP ++++LLP + +++  T+P ++ LV+  L   + +     +GV+PV
Sbjct  9    AEPRGLPSTLSILPLKDRILLPSSAMKLVLTTPSALALVDDILGAAYVKPGTLYVGVVPV  68

Query  192  RDSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALH  371
            R  A         S G VT  A +        +ES   +        H H+ G AAR + 
Sbjct  69   RRDAPP-------SAGGVTSGASQL------DAESFDAEDDADDVRAHLHDVGTAARIIQ  115

Query  372  LSRGVEKPSGRV----------TYIVVLEGLCRFSVQELSTRGTYYTARI  491
            ++RG ++P  +           +Y ++LEG CRF + +LS+   +  A +
Sbjct  116  IARG-DRPGMKARSIHWSPYDRSYTLLLEGRCRFELNQLSSTSPFLVAHV  164



>ref|XP_008364428.1| PREDICTED: uncharacterized protein LOC103428108 [Malus domestica]
Length=452

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  15   SMAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPR  122
            +M ESVELP  L ILPFRNKVLL  AII IRCTSP 
Sbjct  416  NMTESVELPTSLNILPFRNKVLLLSAIIXIRCTSPN  451



>gb|ERZ96146.1| hypothetical protein GLOINDRAFT_334534 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX78515.1| Pim1p [Rhizophagus irregularis DAOM 197198w]
Length=850

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 76/165 (46%), Gaps = 27/165 (16%)
 Frame = +3

Query  33   ELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELW----QREEKGLIGVLPVR--  194
            ++P  L I+P RNKVLLP A + ++  S  SV+L+ Q ++     +E K +IG +PV   
Sbjct  7    DVPKILPIIPIRNKVLLPSASLVLQVVSKDSVQLL-QRIYRSAENKESKYIIGCVPVHPP  65

Query  195  -----DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAA  359
                 +S +TTT     +P  +T + +R    +    E+     +        H  G AA
Sbjct  66   SYNKLESKDTTT-----APFTLTRNGNRNSTPKKTIEETFNQSIQPSD----LHKFGCAA  116

Query  360  RALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
            R + L R V        +IV +EG+ R  + +      Y  A +T
Sbjct  117  RIVKLERTVN------GFIVRIEGVIRIRIDKYVLERPYLEAEVT  155



>gb|KIG14657.1| ATP-dependent protease La [Enhygromyxa salina]
Length=789

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 66/154 (43%), Gaps = 43/154 (28%)
 Frame = +3

Query  33   ELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDSAETT  212
            +LP  +++LP RN VL PG+II I    P+SVKL+E+ +    E+ +IG++  R+S    
Sbjct  13   DLPEVVSLLPLRNSVLFPGSIIPIDVGRPKSVKLIEEAIAS--ERPVIGIVMQRESR---  67

Query  213  TVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEK  392
                                    T E    D          H  G A R L + +    
Sbjct  68   ------------------------TEEPGAED---------LHEVGCAVRILKVIK----  90

Query  393  PSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  494
               R  Y V+L+G+ R  + +L +   +  AR+T
Sbjct  91   -LARDNYSVILQGVMRIKIDQLVSNEPFLQARVT  123



>gb|KDE02405.1| hypothetical protein, variant [Microbotryum violaceum p1A1 Lamole]
Length=955

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 76/163 (47%), Gaps = 29/163 (18%)
 Frame = +3

Query  27   SVELPGRLAILPFRNK-VLLPGAIIRIRCTSPRSVKLVEQELWQREEKG-----LIGVLP  188
            S  +P  L ILP   K VL P  ++ I+  S  SV L++  L + E+       +IGV+P
Sbjct  5    SYNIPTHLPILPLPEKQVLYPSLVLSIQFVSKHSVALLQSVLREAEQNSGNKPLIIGVVP  64

Query  189  VRDSAETTTVAPTL-SPGVVTDSAD--RTPKNQAGTSESHK--HDGKNQQEVIH------  335
            ++D++  TT  P   +P   ++  D  RTP      S++    +  K++  V+H      
Sbjct  65   LKDTSSPTTGPPARPTPNPTSNRRDPYRTPPQSDDESDNQNKSNSAKSRAVVLHKSSAAQ  124

Query  336  -------WHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRF  443
                       GVAAR + L R     SG   +IVVLEGL R 
Sbjct  125  GKPPIADLFEYGVAARIVRLER---LSSG--GFIVVLEGLARI  162



>gb|KDE02404.1| hypothetical protein MVLG_07037 [Microbotryum violaceum p1A1 
Lamole]
Length=1013

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 76/163 (47%), Gaps = 29/163 (18%)
 Frame = +3

Query  27   SVELPGRLAILPFRNK-VLLPGAIIRIRCTSPRSVKLVEQELWQREEKG-----LIGVLP  188
            S  +P  L ILP   K VL P  ++ I+  S  SV L++  L + E+       +IGV+P
Sbjct  5    SYNIPTHLPILPLPEKQVLYPSLVLSIQFVSKHSVALLQSVLREAEQNSGNKPLIIGVVP  64

Query  189  VRDSAETTTVAPTL-SPGVVTDSAD--RTPKNQAGTSESHK--HDGKNQQEVIH------  335
            ++D++  TT  P   +P   ++  D  RTP      S++    +  K++  V+H      
Sbjct  65   LKDTSSPTTGPPARPTPNPTSNRRDPYRTPPQSDDESDNQNKSNSAKSRAVVLHKSSAAQ  124

Query  336  -------WHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRF  443
                       GVAAR + L R     SG   +IVVLEGL R 
Sbjct  125  GKPPIADLFEYGVAARIVRLER---LSSG--GFIVVLEGLARI  162



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552737873190