BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS040B10

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011073820.1|  PREDICTED: probably inactive leucine-rich re...    182   4e-49   Sesamum indicum [beniseed]
ref|XP_009589223.1|  PREDICTED: probably inactive leucine-rich re...    179   4e-48   Nicotiana tomentosiformis
emb|CBI39439.3|  unnamed protein product                                178   4e-48   Vitis vinifera
ref|XP_002265846.1|  PREDICTED: probably inactive leucine-rich re...    179   8e-48   Vitis vinifera
ref|XP_007034091.1|  Leucine-rich receptor-like protein kinase fa...    178   9e-48   
emb|CDP14623.1|  unnamed protein product                                178   1e-47   Coffea canephora [robusta coffee]
ref|XP_006840189.1|  hypothetical protein AMTR_s00089p00108500          177   2e-47   
ref|XP_009765958.1|  PREDICTED: probably inactive leucine-rich re...    177   4e-47   Nicotiana sylvestris
ref|XP_006364689.1|  PREDICTED: probably inactive leucine-rich re...    176   8e-47   Solanum tuberosum [potatoes]
ref|XP_010528265.1|  PREDICTED: probably inactive leucine-rich re...    175   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_004152295.1|  PREDICTED: probably inactive leucine-rich re...    173   7e-46   Cucumis sativus [cucumbers]
ref|XP_007139297.1|  hypothetical protein PHAVU_008G017400g             173   7e-46   Phaseolus vulgaris [French bean]
ref|XP_004247993.1|  PREDICTED: probably inactive leucine-rich re...    173   7e-46   Solanum lycopersicum
ref|XP_004156987.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    173   8e-46   
ref|XP_008453972.1|  PREDICTED: probably inactive leucine-rich re...    172   2e-45   Cucumis melo [Oriental melon]
ref|XP_010268319.1|  PREDICTED: probably inactive leucine-rich re...    172   2e-45   Nelumbo nucifera [Indian lotus]
gb|KHN13843.1|  Probably inactive leucine-rich repeat receptor-li...    171   2e-45   Glycine soja [wild soybean]
ref|XP_003518672.1|  PREDICTED: probably inactive leucine-rich re...    171   3e-45   Glycine max [soybeans]
ref|XP_003552656.1|  PREDICTED: probably inactive leucine-rich re...    171   3e-45   Glycine max [soybeans]
gb|KHN27185.1|  Probably inactive leucine-rich repeat receptor-li...    171   3e-45   Glycine soja [wild soybean]
gb|KJB37929.1|  hypothetical protein B456_006G227000                    171   3e-45   Gossypium raimondii
ref|XP_002518223.1|  receptor protein kinase, putative                  171   4e-45   Ricinus communis
gb|KHG00472.1|  hypothetical protein F383_20103                         169   3e-44   Gossypium arboreum [tree cotton]
gb|EYU32740.1|  hypothetical protein MIMGU_mgv1a000860mg                166   2e-43   Erythranthe guttata [common monkey flower]
ref|XP_010023583.1|  PREDICTED: probably inactive leucine-rich re...    164   8e-43   Eucalyptus grandis [rose gum]
ref|XP_011000023.1|  PREDICTED: probably inactive leucine-rich re...    164   2e-42   Populus euphratica
ref|XP_010107246.1|  Probably inactive leucine-rich repeat recept...    164   2e-42   
ref|XP_002321093.1|  leucine-rich repeat transmembrane protein ki...    163   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_008337525.1|  PREDICTED: probably inactive leucine-rich re...    163   3e-42   Malus domestica [apple tree]
ref|XP_011042759.1|  PREDICTED: probably inactive leucine-rich re...    162   4e-42   Populus euphratica
ref|XP_002302895.2|  leucine-rich repeat transmembrane protein ki...    162   4e-42   
ref|XP_009371148.1|  PREDICTED: probably inactive leucine-rich re...    162   4e-42   Pyrus x bretschneideri [bai li]
ref|XP_003621730.1|  Probably inactive leucine-rich repeat recept...    161   9e-42   Medicago truncatula
ref|XP_010514517.1|  PREDICTED: probably inactive leucine-rich re...    160   2e-41   Camelina sativa [gold-of-pleasure]
gb|KFK33718.1|  hypothetical protein AALP_AA5G051000                    160   4e-41   Arabis alpina [alpine rockcress]
ref|XP_006494521.1|  PREDICTED: probably inactive leucine-rich re...    158   1e-40   Citrus sinensis [apfelsine]
ref|XP_006421080.1|  hypothetical protein CICLE_v10004238mg             158   1e-40   Citrus clementina [clementine]
ref|XP_010425587.1|  PREDICTED: probably inactive leucine-rich re...    158   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_004296675.1|  PREDICTED: probably inactive leucine-rich re...    157   4e-40   Fragaria vesca subsp. vesca
ref|XP_006290541.1|  hypothetical protein CARUB_v10016623mg             155   1e-39   Capsella rubella
ref|XP_009111587.1|  PREDICTED: probably inactive leucine-rich re...    155   2e-39   Brassica rapa
ref|XP_002875419.1|  hypothetical protein ARALYDRAFT_484589             155   2e-39   
gb|EPS70115.1|  hypothetical protein M569_04636                         154   2e-39   Genlisea aurea
emb|CDY20032.1|  BnaA09g02190D                                          154   4e-39   Brassica napus [oilseed rape]
ref|NP_189443.2|  probably inactive leucine-rich repeat receptor-...    154   4e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010555906.1|  PREDICTED: probably inactive leucine-rich re...    151   3e-38   Tarenaya hassleriana [spider flower]
ref|XP_004492049.1|  PREDICTED: probably inactive leucine-rich re...    151   3e-38   Cicer arietinum [garbanzo]
ref|XP_010555905.1|  PREDICTED: probably inactive leucine-rich re...    151   3e-38   Tarenaya hassleriana [spider flower]
ref|XP_006395381.1|  hypothetical protein EUTSA_v10003580mg             149   1e-37   Eutrema salsugineum [saltwater cress]
ref|XP_009151898.1|  PREDICTED: probably inactive leucine-rich re...    149   2e-37   Brassica rapa
emb|CDY00141.1|  BnaC09g01600D                                          146   2e-36   
ref|XP_010502811.1|  PREDICTED: probably inactive leucine-rich re...    143   3e-35   Camelina sativa [gold-of-pleasure]
gb|KDP37890.1|  hypothetical protein JCGZ_05772                         142   3e-35   Jatropha curcas
gb|KJB67930.1|  hypothetical protein B456_010G218400                    137   7e-34   Gossypium raimondii
gb|KJB67929.1|  hypothetical protein B456_010G218400                    137   2e-33   Gossypium raimondii
ref|XP_008244427.1|  PREDICTED: probably inactive leucine-rich re...    137   4e-33   Prunus mume [ume]
ref|XP_007225370.1|  hypothetical protein PRUPE_ppa000838mg             136   5e-33   
ref|XP_010673272.1|  PREDICTED: probably inactive leucine-rich re...    135   9e-33   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG03607.1|  hypothetical protein F383_26757                         135   1e-32   Gossypium arboreum [tree cotton]
ref|XP_010931370.1|  PREDICTED: probably inactive leucine-rich re...    133   6e-32   Elaeis guineensis
ref|XP_008350571.1|  PREDICTED: probably inactive leucine-rich re...    129   1e-31   
ref|XP_009403616.1|  PREDICTED: probably inactive leucine-rich re...    132   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009372024.1|  PREDICTED: probably inactive leucine-rich re...    132   2e-31   Pyrus x bretschneideri [bai li]
ref|XP_002275275.1|  PREDICTED: probably inactive leucine-rich re...    131   2e-31   Vitis vinifera
ref|XP_009416321.1|  PREDICTED: probably inactive leucine-rich re...    131   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB73018.1|  hypothetical protein B456_011G209800                    131   3e-31   Gossypium raimondii
gb|KHG09451.1|  hypothetical protein F383_09289                         131   4e-31   Gossypium arboreum [tree cotton]
ref|XP_011002596.1|  PREDICTED: probably inactive leucine-rich re...    130   6e-31   Populus euphratica
ref|XP_006486161.1|  PREDICTED: probably inactive leucine-rich re...    130   1e-30   Citrus sinensis [apfelsine]
ref|XP_006435929.1|  hypothetical protein CICLE_v10030625mg             130   1e-30   
gb|KDO67528.1|  hypothetical protein CISIN_1g002321mg                   129   1e-30   Citrus sinensis [apfelsine]
ref|XP_007220278.1|  hypothetical protein PRUPE_ppa000889mg             129   1e-30   
ref|XP_008233886.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    129   2e-30   Prunus mume [ume]
ref|XP_002323672.2|  hypothetical protein POPTR_0016s14410g             129   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_007207150.1|  hypothetical protein PRUPE_ppa000904mg             129   3e-30   Prunus persica
ref|XP_008244834.1|  PREDICTED: probably inactive leucine-rich re...    128   3e-30   Prunus mume [ume]
ref|XP_002309183.1|  hypothetical protein POPTR_0006s10910g             128   4e-30   
ref|XP_008788529.1|  PREDICTED: probably inactive leucine-rich re...    128   5e-30   Phoenix dactylifera
gb|ACN33819.1|  unknown                                                 128   5e-30   Zea mays [maize]
ref|XP_010253067.1|  PREDICTED: probably inactive leucine-rich re...    127   6e-30   Nelumbo nucifera [Indian lotus]
ref|XP_008672259.1|  PREDICTED: uncharacterized protein LOC100216...    128   6e-30   
ref|XP_011019006.1|  PREDICTED: probably inactive leucine-rich re...    127   6e-30   Populus euphratica
ref|XP_008792235.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    127   7e-30   
ref|XP_011019007.1|  PREDICTED: probably inactive leucine-rich re...    127   7e-30   Populus euphratica
ref|XP_009406870.1|  PREDICTED: probably inactive leucine-rich re...    127   7e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_191196.1|  leucine-rich repeat protein kinase-like protein       127   7e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010253073.1|  PREDICTED: probably inactive leucine-rich re...    127   8e-30   Nelumbo nucifera [Indian lotus]
ref|XP_002972654.1|  hypothetical protein SELMODRAFT_98598              127   8e-30   Selaginella moellendorffii
ref|XP_002459131.1|  hypothetical protein SORBIDRAFT_03g046350          127   9e-30   
ref|XP_010921154.1|  PREDICTED: probably inactive leucine-rich re...    127   9e-30   
ref|XP_010922754.1|  PREDICTED: probably inactive leucine-rich re...    127   9e-30   Elaeis guineensis
ref|XP_010921155.1|  PREDICTED: probably inactive leucine-rich re...    127   9e-30   
ref|XP_003521989.1|  PREDICTED: probably inactive leucine-rich re...    127   1e-29   Glycine max [soybeans]
gb|EAY77289.1|  hypothetical protein OsI_05265                          127   1e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_002878081.1|  hypothetical protein ARALYDRAFT_907079             126   1e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_002267737.3|  PREDICTED: probably inactive leucine-rich re...    127   1e-29   Vitis vinifera
dbj|BAB92869.1|  putative receptor-like protein kinase                  126   1e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007011288.1|  Leucine-rich repeat protein kinase family pr...    126   1e-29   
ref|XP_010929848.1|  PREDICTED: probably inactive leucine-rich re...    126   2e-29   Elaeis guineensis
ref|NP_001290509.1|  probably inactive leucine-rich repeat recept...    126   2e-29   Elaeis guineensis
ref|XP_004971314.1|  PREDICTED: probably inactive leucine-rich re...    126   2e-29   Setaria italica
ref|XP_002520879.1|  ATP binding protein, putative                      125   3e-29   Ricinus communis
ref|XP_010427454.1|  PREDICTED: probably inactive leucine-rich re...    125   3e-29   
ref|XP_009402208.1|  PREDICTED: probably inactive leucine-rich re...    125   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK34877.1|  Leucine-rich repeat protein kinase family protein       125   5e-29   Arabis alpina [alpine rockcress]
ref|XP_006357297.1|  PREDICTED: probably inactive leucine-rich re...    125   5e-29   Solanum tuberosum [potatoes]
ref|XP_004137674.1|  PREDICTED: probably inactive leucine-rich re...    125   6e-29   Cucumis sativus [cucumbers]
ref|XP_010067617.1|  PREDICTED: probably inactive leucine-rich re...    125   6e-29   Eucalyptus grandis [rose gum]
ref|XP_011001391.1|  PREDICTED: probably inactive leucine-rich re...    124   7e-29   Populus euphratica
ref|XP_008456960.1|  PREDICTED: probably inactive leucine-rich re...    124   8e-29   Cucumis melo [Oriental melon]
gb|AAL49790.1|  unknown protein                                         124   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002988156.1|  hypothetical protein SELMODRAFT_40688              124   9e-29   
ref|XP_009623562.1|  PREDICTED: probably inactive leucine-rich re...    124   9e-29   Nicotiana tomentosiformis
ref|XP_006429586.1|  hypothetical protein CICLE_v10010994mg             124   1e-28   
gb|KDO64103.1|  hypothetical protein CISIN_1g002094mg                   124   1e-28   Citrus sinensis [apfelsine]
ref|XP_006481196.1|  PREDICTED: probably inactive leucine-rich re...    124   1e-28   Citrus sinensis [apfelsine]
ref|XP_004246289.1|  PREDICTED: probably inactive leucine-rich re...    124   1e-28   Solanum lycopersicum
ref|XP_002528692.1|  Brassinosteroid LRR receptor kinase precurso...    124   1e-28   Ricinus communis
ref|XP_004502826.1|  PREDICTED: probably inactive leucine-rich re...    124   1e-28   Cicer arietinum [garbanzo]
ref|XP_002325929.2|  leucine-rich repeat transmembrane protein ki...    124   1e-28   
dbj|BAJ85468.1|  predicted protein                                      124   2e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001170194.1|  uncharacterized protein LOC100384143 precursor     120   2e-28   
ref|XP_006290555.1|  hypothetical protein CARUB_v10016642mg             123   2e-28   
ref|XP_002467905.1|  hypothetical protein SORBIDRAFT_01g036160          123   2e-28   Sorghum bicolor [broomcorn]
ref|XP_001771841.1|  predicted protein                                  123   2e-28   
ref|XP_009757206.1|  PREDICTED: probably inactive leucine-rich re...    123   2e-28   Nicotiana sylvestris
ref|XP_011010876.1|  PREDICTED: probably inactive leucine-rich re...    123   2e-28   Populus euphratica
ref|XP_011010875.1|  PREDICTED: probably inactive leucine-rich re...    123   2e-28   Populus euphratica
ref|XP_008442319.1|  PREDICTED: probably inactive leucine-rich re...    123   2e-28   Cucumis melo [Oriental melon]
ref|XP_006290556.1|  hypothetical protein CARUB_v10016642mg             123   2e-28   Capsella rubella
ref|XP_004984462.1|  PREDICTED: probably inactive leucine-rich re...    123   2e-28   Setaria italica
ref|XP_006358746.1|  PREDICTED: probably inactive leucine-rich re...    123   2e-28   Solanum tuberosum [potatoes]
ref|XP_010504542.1|  PREDICTED: probably inactive leucine-rich re...    123   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_004241084.1|  PREDICTED: probably inactive leucine-rich re...    123   2e-28   Solanum lycopersicum
ref|XP_008388889.1|  PREDICTED: probably inactive leucine-rich re...    120   2e-28   
ref|XP_004146470.1|  PREDICTED: probably inactive leucine-rich re...    123   3e-28   Cucumis sativus [cucumbers]
gb|EYU42026.1|  hypothetical protein MIMGU_mgv1a000905mg                123   3e-28   Erythranthe guttata [common monkey flower]
ref|XP_010412798.1|  PREDICTED: probably inactive leucine-rich re...    123   3e-28   
ref|XP_008808300.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    122   4e-28   
ref|XP_008782666.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    122   4e-28   
ref|XP_004240861.1|  PREDICTED: probably inactive leucine-rich re...    122   4e-28   Solanum lycopersicum
ref|XP_006402993.1|  hypothetical protein EUTSA_v10005773mg             122   5e-28   Eutrema salsugineum [saltwater cress]
ref|XP_008681357.1|  PREDICTED: uncharacterized protein LOC100304...    122   5e-28   
ref|XP_010525412.1|  PREDICTED: probably inactive leucine-rich re...    122   6e-28   Tarenaya hassleriana [spider flower]
ref|XP_002319878.2|  leucine-rich repeat transmembrane protein ki...    122   6e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006341303.1|  PREDICTED: probably inactive leucine-rich re...    121   9e-28   Solanum tuberosum [potatoes]
ref|XP_006842493.1|  hypothetical protein AMTR_s00077p00091370          121   9e-28   Amborella trichopoda
ref|XP_009116341.1|  PREDICTED: probably inactive leucine-rich re...    121   1e-27   Brassica rapa
gb|EYU35201.1|  hypothetical protein MIMGU_mgv1a000839mg                121   1e-27   Erythranthe guttata [common monkey flower]
ref|XP_008370260.1|  PREDICTED: probably inactive leucine-rich re...    120   1e-27   
ref|XP_011084816.1|  PREDICTED: probably inactive leucine-rich re...    120   2e-27   Sesamum indicum [beniseed]
ref|XP_009349085.1|  PREDICTED: probably inactive leucine-rich re...    120   2e-27   Pyrus x bretschneideri [bai li]
gb|KDP21644.1|  hypothetical protein JCGZ_03315                         120   2e-27   Jatropha curcas
ref|XP_009362809.1|  PREDICTED: probably inactive leucine-rich re...    120   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_009614707.1|  PREDICTED: probably inactive leucine-rich re...    120   2e-27   Nicotiana tomentosiformis
ref|XP_010103654.1|  Probably inactive leucine-rich repeat recept...    120   2e-27   Morus notabilis
ref|XP_009793754.1|  PREDICTED: probably inactive leucine-rich re...    120   2e-27   Nicotiana sylvestris
gb|KHN11868.1|  Probably inactive leucine-rich repeat receptor-li...    120   3e-27   Glycine soja [wild soybean]
ref|XP_008655312.1|  PREDICTED: uncharacterized protein LOC100384...    120   3e-27   Zea mays [maize]
ref|XP_003516434.1|  PREDICTED: probably inactive leucine-rich re...    119   4e-27   Glycine max [soybeans]
ref|XP_010043193.1|  PREDICTED: probably inactive leucine-rich re...    119   4e-27   Eucalyptus grandis [rose gum]
ref|XP_007134721.1|  hypothetical protein PHAVU_010G070400g             119   4e-27   Phaseolus vulgaris [French bean]
ref|XP_003522510.2|  PREDICTED: probably inactive leucine-rich re...    119   4e-27   Glycine max [soybeans]
ref|NP_001239730.1|  probably inactive leucine-rich repeat recept...    119   6e-27   Glycine max [soybeans]
ref|XP_004305081.1|  PREDICTED: probably inactive leucine-rich re...    119   7e-27   Fragaria vesca subsp. vesca
ref|XP_007140080.1|  hypothetical protein PHAVU_008G082500g             119   7e-27   Phaseolus vulgaris [French bean]
ref|XP_010683484.1|  PREDICTED: probably inactive leucine-rich re...    118   9e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004514781.1|  PREDICTED: probably inactive leucine-rich re...    118   1e-26   
ref|XP_004173348.1|  PREDICTED: probably inactive leucine-rich re...    118   1e-26   
ref|XP_004138394.1|  PREDICTED: probably inactive leucine-rich re...    117   2e-26   Cucumis sativus [cucumbers]
ref|XP_004492560.1|  PREDICTED: probably inactive leucine-rich re...    117   2e-26   Cicer arietinum [garbanzo]
ref|XP_008369373.1|  PREDICTED: probably inactive leucine-rich re...    117   2e-26   
ref|XP_004308984.1|  PREDICTED: probably inactive leucine-rich re...    117   2e-26   Fragaria vesca subsp. vesca
ref|XP_009363794.1|  PREDICTED: probably inactive leucine-rich re...    117   3e-26   Pyrus x bretschneideri [bai li]
ref|XP_008456780.1|  PREDICTED: probably inactive leucine-rich re...    117   3e-26   Cucumis melo [Oriental melon]
ref|XP_003533657.2|  PREDICTED: probably inactive leucine-rich re...    117   4e-26   Glycine max [soybeans]
ref|XP_007136420.1|  hypothetical protein PHAVU_009G043600g             116   4e-26   Phaseolus vulgaris [French bean]
ref|XP_010553156.1|  PREDICTED: probably inactive leucine-rich re...    116   4e-26   Tarenaya hassleriana [spider flower]
gb|AES79844.2|  LRR receptor-like kinase family protein                 116   5e-26   Medicago truncatula
gb|EPS70735.1|  hypothetical protein M569_04020                         116   5e-26   Genlisea aurea
ref|XP_003623626.1|  Receptor-like protein kinase                       116   5e-26   
emb|CBI25352.3|  unnamed protein product                                115   1e-25   Vitis vinifera
gb|KJB71525.1|  hypothetical protein B456_011G127000                    115   1e-25   Gossypium raimondii
ref|XP_007033525.1|  Leucine-rich receptor-like protein kinase fa...    115   1e-25   
ref|XP_009406353.1|  PREDICTED: probably inactive leucine-rich re...    114   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011095143.1|  PREDICTED: probably inactive leucine-rich re...    114   3e-25   Sesamum indicum [beniseed]
gb|EEC75203.1|  hypothetical protein OsI_11455                          114   3e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_010092789.1|  Probably inactive leucine-rich repeat recept...    114   4e-25   Morus notabilis
gb|KEH35536.1|  leucine-rich receptor-like kinase family protein        114   4e-25   Medicago truncatula
ref|XP_003605286.1|  Receptor-like protein kinase                       113   6e-25   Medicago truncatula
ref|XP_002870895.1|  hypothetical protein ARALYDRAFT_486880             112   9e-25   
ref|XP_002990527.1|  hypothetical protein SELMODRAFT_131809             106   1e-24   
dbj|BAF79960.1|  receptor-like kinase                                   112   1e-24   Marchantia polymorpha
ref|XP_006398567.1|  hypothetical protein EUTSA_v10012579mg             112   2e-24   Eutrema salsugineum [saltwater cress]
ref|XP_009125388.1|  PREDICTED: probably inactive leucine-rich re...    111   2e-24   Brassica rapa
gb|EMT18823.1|  Putative LRR receptor-like serine/threonine-prote...    111   3e-24   
emb|CBI18033.3|  unnamed protein product                                110   4e-24   Vitis vinifera
ref|XP_003557968.1|  PREDICTED: probably inactive leucine-rich re...    110   9e-24   Brachypodium distachyon [annual false brome]
ref|XP_006279331.1|  hypothetical protein CARUB_v10012717mg             109   1e-23   Capsella rubella
ref|XP_006650049.1|  PREDICTED: probably inactive leucine-rich re...    109   1e-23   Oryza brachyantha
ref|NP_001050035.1|  Os03g0335500                                       109   1e-23   
ref|XP_003567498.1|  PREDICTED: probably inactive leucine-rich re...    108   2e-23   Brachypodium distachyon [annual false brome]
ref|NP_195809.1|  leucine-rich receptor-like protein kinase             108   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010451924.1|  PREDICTED: probably inactive leucine-rich re...    108   3e-23   
emb|CDP13903.1|  unnamed protein product                                107   7e-23   Coffea canephora [robusta coffee]
ref|XP_010490496.1|  PREDICTED: probably inactive leucine-rich re...    107   9e-23   
gb|EAZ26832.1|  hypothetical protein OsJ_10748                          106   1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|KFK24685.1|  hypothetical protein AALP_AA8G011600                    106   1e-22   Arabis alpina [alpine rockcress]
ref|XP_008776998.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    106   1e-22   
dbj|BAK06250.1|  predicted protein                                      106   2e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY27220.1|  BnaA09g35820D                                          104   5e-22   Brassica napus [oilseed rape]
ref|XP_009415955.1|  PREDICTED: probably inactive leucine-rich re...    104   5e-22   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX72142.1|  BnaC08g27320D                                          104   7e-22   
ref|XP_001769840.1|  predicted protein                                  104   7e-22   
emb|CDY04822.1|  BnaAnng00040D                                          104   8e-22   
ref|XP_010424006.1|  PREDICTED: probably inactive leucine-rich re...    104   8e-22   
ref|XP_010424007.1|  PREDICTED: probably inactive leucine-rich re...    104   8e-22   
ref|XP_009589224.1|  PREDICTED: probably inactive leucine-rich re...    103   1e-21   
ref|XP_010670069.1|  PREDICTED: probably inactive leucine-rich re...    102   2e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009789234.1|  PREDICTED: probably inactive leucine-rich re...    102   4e-21   Nicotiana sylvestris
ref|XP_011076585.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    102   5e-21   Sesamum indicum [beniseed]
ref|XP_002990711.1|  hypothetical protein SELMODRAFT_132189             100   1e-20   
dbj|BAB85306.1|  putative receptor-like protein kinase                99.8    2e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EAY76307.1|  hypothetical protein OsI_04242                        99.8    2e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_002439964.1|  hypothetical protein SORBIDRAFT_09g023480        99.4    4e-20   Sorghum bicolor [broomcorn]
ref|XP_004961741.1|  PREDICTED: probably inactive leucine-rich re...  95.9    6e-19   
ref|XP_002458686.1|  hypothetical protein SORBIDRAFT_03g038240        95.5    7e-19   Sorghum bicolor [broomcorn]
emb|CDX85183.1|  BnaC07g24940D                                        95.5    7e-19   
ref|XP_001759642.1|  predicted protein                                94.4    2e-18   
ref|XP_004970391.1|  PREDICTED: probably inactive leucine-rich re...  94.4    2e-18   Setaria italica
ref|XP_008659447.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  88.6    5e-18   Zea mays [maize]
ref|XP_008649763.1|  PREDICTED: probably inactive leucine-rich re...  92.8    5e-18   Zea mays [maize]
ref|NP_001055909.1|  Os05g0491400                                     89.0    5e-18   
ref|XP_004970305.1|  PREDICTED: somatic embryogenesis receptor ki...  88.6    7e-18   
ref|NP_001055847.2|  Os05g0478300                                     92.4    8e-18   
emb|CDY14823.1|  BnaC04g48200D                                        91.3    1e-17   Brassica napus [oilseed rape]
gb|EAY98521.1|  hypothetical protein OsI_20433                        87.8    1e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_004491185.1|  PREDICTED: somatic embryogenesis receptor ki...  87.4    2e-17   Cicer arietinum [garbanzo]
tpg|DAA57062.1|  TPA: putative leucine-rich repeat receptor-like ...  91.3    2e-17   
ref|XP_009142052.1|  PREDICTED: probable inactive leucine-rich re...  90.5    2e-17   Brassica rapa
emb|CDY47962.1|  BnaA04g24400D                                        90.5    2e-17   Brassica napus [oilseed rape]
emb|CAH66725.1|  H0404F02.1                                           90.9    3e-17   Oryza sativa [red rice]
gb|AEW49518.1|  putative LRR-RLK protein XIAO                         90.9    3e-17   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK02926.1|  predicted protein                                    90.9    3e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE61543.1|  hypothetical protein OsJ_15867                        90.9    3e-17   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ86449.1|  predicted protein                                    90.9    3e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACU19288.1|  unknown                                               86.7    3e-17   Glycine max [soybeans]
gb|ACU22741.1|  unknown                                               86.7    3e-17   Glycine max [soybeans]
ref|XP_003519488.1|  PREDICTED: somatic embryogenesis receptor ki...  86.7    4e-17   Glycine max [soybeans]
ref|NP_001241394.1|  somatic embryogenesis receptor kinase 1-like...  86.7    4e-17   Glycine max [soybeans]
gb|KHN38434.1|  BRASSINOSTEROID INSENSITIVE 1-associated receptor...  86.3    4e-17   Glycine soja [wild soybean]
ref|XP_007141567.1|  hypothetical protein PHAVU_008G206700g           87.0    4e-17   Phaseolus vulgaris [French bean]
gb|AFW85540.1|  putative leucine-rich repeat receptor-like protei...  89.7    7e-17   
ref|NP_001047431.1|  Os02g0615500                                     89.7    8e-17   
gb|ACI95776.1|  PAN1                                                  89.0    9e-17   Zea mays [maize]
ref|XP_008646984.1|  PREDICTED: uncharacterized protein LOC100501...  89.0    1e-16   
gb|KHG13399.1|  hypothetical protein F383_10003                       89.0    1e-16   Gossypium arboreum [tree cotton]
gb|EEE57372.1|  hypothetical protein OsJ_07527                        89.4    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004508778.1|  PREDICTED: LRR receptor-like serine/threonin...  88.2    1e-16   Cicer arietinum [garbanzo]
ref|XP_004508779.1|  PREDICTED: LRR receptor-like serine/threonin...  88.2    1e-16   
ref|XP_004246027.1|  PREDICTED: LRR receptor-like serine/threonin...  88.2    1e-16   Solanum lycopersicum
ref|XP_009343456.1|  PREDICTED: LRR receptor-like serine/threonin...  88.2    1e-16   Pyrus x bretschneideri [bai li]
ref|XP_002462033.1|  hypothetical protein SORBIDRAFT_02g013100        88.6    2e-16   Sorghum bicolor [broomcorn]
ref|XP_010235160.1|  PREDICTED: probable LRR receptor-like serine...  87.4    2e-16   
ref|NP_001150725.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  84.7    2e-16   
emb|CDP14870.1|  unnamed protein product                              87.8    2e-16   Coffea canephora [robusta coffee]
ref|XP_006586717.1|  PREDICTED: LRR receptor-like serine/threonin...  87.4    2e-16   Glycine max [soybeans]
ref|XP_006394359.1|  hypothetical protein EUTSA_v10003855mg           87.4    3e-16   Eutrema salsugineum [saltwater cress]
gb|EEE64100.1|  hypothetical protein OsJ_18931                        87.8    3e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001775671.1|  predicted protein                                87.8    3e-16   
ref|NP_001239788.1|  LRR receptor-like serine/threonine-protein k...  87.4    3e-16   Glycine max [soybeans]
ref|XP_002864814.1|  leucine-rich repeat family protein               87.0    3e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_011025618.1|  PREDICTED: somatic embryogenesis receptor ki...  84.0    3e-16   Populus euphratica
ref|XP_009403261.1|  PREDICTED: probable inactive leucine-rich re...  87.0    3e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002437981.1|  hypothetical protein SORBIDRAFT_10g005850        87.4    3e-16   Sorghum bicolor [broomcorn]
ref|XP_009421476.1|  PREDICTED: receptor-like protein kinase HSL1     87.4    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN41747.1|  LRR receptor-like serine/threonine-protein kinase...  86.7    4e-16   Glycine soja [wild soybean]
ref|XP_007210873.1|  hypothetical protein PRUPE_ppa003105mg           86.7    4e-16   Prunus persica
ref|XP_008453173.1|  PREDICTED: LRR receptor-like serine/threonin...  86.7    4e-16   Cucumis melo [Oriental melon]
gb|KHG29212.1|  LRR receptor-like serine/threonine-protein kinase...  86.7    4e-16   
ref|XP_006428061.1|  hypothetical protein CICLE_v10027485mg           86.7    5e-16   
ref|XP_003617091.1|  Somatic embryogenesis receptor kinase            83.2    5e-16   
gb|EYU29140.1|  hypothetical protein MIMGU_mgv1a022602mg              86.3    5e-16   
gb|ACJ85954.1|  unknown                                               83.2    5e-16   
ref|XP_004299405.1|  PREDICTED: LRR receptor-like serine/threonin...  86.3    5e-16   
ref|XP_010420958.1|  PREDICTED: somatic embryogenesis receptor ki...  83.2    6e-16   
emb|CDP18612.1|  unnamed protein product                              86.3    6e-16   
gb|KJB25051.1|  hypothetical protein B456_004G175500                  85.1    6e-16   
gb|KCW51007.1|  hypothetical protein EUGRSUZ_J00633                   82.8    6e-16   
ref|XP_004138149.1|  PREDICTED: LRR receptor-like serine/threonin...  86.3    6e-16   
ref|XP_009407942.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  86.3    7e-16   
ref|XP_004973571.1|  PREDICTED: probable LRR receptor-like serine...  86.3    7e-16   
ref|XP_008239850.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    7e-16   
ref|XP_008664634.1|  PREDICTED: probable LRR receptor-like serine...  86.7    7e-16   
ref|XP_008664637.1|  PREDICTED: probable LRR receptor-like serine...  86.3    7e-16   
ref|XP_008669002.1|  PREDICTED: probable LRR receptor-like serine...  86.7    7e-16   
ref|XP_010242337.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    7e-16   
ref|XP_002301998.2|  leucine-rich repeat family protein               86.7    8e-16   
ref|XP_001777608.1|  predicted protein                                85.9    8e-16   
ref|XP_006493852.1|  PREDICTED: somatic embryogenesis receptor ki...  85.9    8e-16   
gb|KCW78418.1|  hypothetical protein EUGRSUZ_D02582                   85.5    9e-16   
ref|NP_181758.1|  leucine-rich repeat protein kinase family protein   85.9    9e-16   
ref|XP_006579547.1|  PREDICTED: LRR receptor-like serine/threonin...  85.5    1e-15   
ref|XP_010054034.1|  PREDICTED: LRR receptor-like serine/threonin...  85.5    1e-15   
ref|XP_009614181.1|  PREDICTED: LRR receptor-like serine/threonin...  85.5    1e-15   
ref|XP_009596436.1|  PREDICTED: LRR receptor-like serine/threonin...  85.1    1e-15   
ref|XP_007158112.1|  hypothetical protein PHAVU_002G125100g           85.5    1e-15   
gb|KJB47371.1|  hypothetical protein B456_008G023200                  85.9    1e-15   
ref|XP_010454429.1|  PREDICTED: somatic embryogenesis receptor ki...  82.4    1e-15   
gb|KJB25050.1|  hypothetical protein B456_004G175500                  85.5    1e-15   
ref|XP_006293826.1|  hypothetical protein CARUB_v10022811mg           85.5    1e-15   
ref|XP_002519895.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  85.5    1e-15   
ref|XP_006293827.1|  hypothetical protein CARUB_v10022811mg           85.5    1e-15   
gb|AFK45363.1|  unknown                                               82.0    1e-15   
ref|XP_011028955.1|  PREDICTED: probable LRR receptor-like serine...  85.9    1e-15   
gb|EPS73511.1|  hypothetical protein M569_01245                       85.1    1e-15   
gb|EPS73860.1|  hypothetical protein M569_00895                       82.0    2e-15   
ref|XP_010517745.1|  PREDICTED: probable inactive leucine-rich re...  85.1    2e-15   
ref|XP_009769350.1|  PREDICTED: probable inactive leucine-rich re...  85.1    2e-15   
ref|XP_009596435.1|  PREDICTED: LRR receptor-like serine/threonin...  84.7    2e-15   
ref|XP_010506042.1|  PREDICTED: probable inactive leucine-rich re...  85.1    2e-15   
ref|XP_004961662.1|  PREDICTED: somatic embryogenesis receptor ki...  81.6    2e-15   
gb|KJB25049.1|  hypothetical protein B456_004G175500                  84.7    2e-15   
ref|XP_010493229.1|  PREDICTED: somatic embryogenesis receptor ki...  81.6    2e-15   
ref|XP_004512361.1|  PREDICTED: LRR receptor-like serine/threonin...  84.7    2e-15   
ref|XP_002445573.1|  hypothetical protein SORBIDRAFT_07g021820        85.1    2e-15   
ref|XP_007040925.1|  Leucine-rich repeat protein kinase family pr...  84.3    2e-15   
ref|XP_002451097.1|  hypothetical protein SORBIDRAFT_05g024090        84.7    2e-15   
tpg|DAA47958.1|  TPA: putative leucine-rich repat protein kinase ...  84.0    2e-15   
ref|XP_002303477.2|  hypothetical protein POPTR_0003s10410g           84.3    2e-15   
ref|XP_009793727.1|  PREDICTED: LRR receptor-like serine/threonin...  84.3    2e-15   
gb|KDP39728.1|  hypothetical protein JCGZ_02748                       84.3    2e-15   
ref|XP_007037206.1|  Leucine-rich repeat protein kinase family pr...  84.3    2e-15   
ref|XP_002533978.1|  lrr receptor protein kinase, putative            84.0    3e-15   
ref|XP_007040924.1|  Leucine-rich repeat protein kinase family pr...  84.3    3e-15   
ref|XP_001763904.1|  predicted protein                                84.7    3e-15   
ref|XP_011086853.1|  PREDICTED: somatic embryogenesis receptor ki...  81.3    3e-15   
ref|XP_006603947.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...  84.0    3e-15   
ref|XP_006377415.1|  hypothetical protein POPTR_0011s05710g           84.7    3e-15   
ref|XP_009607517.1|  PREDICTED: LRR receptor-like serine/threonin...  84.3    3e-15   
ref|XP_006288424.1|  hypothetical protein CARUB_v10001683mg           81.6    3e-15   
ref|XP_009391272.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.3    3e-15   
gb|KHN30771.1|  Protein NSP-INTERACTING KINASE 1                      84.0    3e-15   
ref|XP_009391273.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.3    3e-15   
ref|XP_009773743.1|  PREDICTED: LRR receptor-like serine/threonin...  84.0    3e-15   
dbj|BAJ91470.1|  predicted protein                                    84.0    3e-15   
ref|XP_003555046.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...  84.0    3e-15   
ref|XP_011028007.1|  PREDICTED: LRR receptor-like serine/threonin...  83.6    3e-15   
ref|XP_009780720.1|  PREDICTED: LRR receptor-like serine/threonin...  84.0    4e-15   
ref|XP_001785654.1|  predicted protein                                84.0    4e-15   
gb|EPS65172.1|  hypothetical protein M569_09607                       79.7    4e-15   
ref|XP_007037205.1|  Leucine-rich repeat protein kinase family pr...  84.0    4e-15   
ref|XP_004964648.1|  PREDICTED: putative leucine-rich repeat rece...  84.3    4e-15   
ref|XP_002436858.1|  hypothetical protein SORBIDRAFT_10g010020        80.5    4e-15   
ref|XP_004976562.1|  PREDICTED: probable LRR receptor-like serine...  84.3    4e-15   
gb|KHN48658.1|  LRR receptor-like serine/threonine-protein kinase...  83.6    4e-15   
ref|XP_008373495.1|  PREDICTED: LRR receptor-like serine/threonin...  83.6    4e-15   
ref|XP_010904696.1|  PREDICTED: somatic embryogenesis receptor ki...  80.5    4e-15   
gb|EYU35887.1|  hypothetical protein MIMGU_mgv1a003189mg              83.6    5e-15   
ref|XP_011028003.1|  PREDICTED: LRR receptor-like serine/threonin...  83.6    5e-15   
emb|CDY00321.1|  BnaA06g22220D                                        83.6    5e-15   
ref|XP_002318612.2|  hypothetical protein POPTR_0012s07290g           83.2    5e-15   
emb|CDX84346.1|  BnaC03g51540D                                        83.6    5e-15   
ref|XP_002965655.1|  hypothetical protein SELMODRAFT_167872           83.6    5e-15   
ref|XP_011071714.1|  PREDICTED: LRR receptor-like serine/threonin...  83.6    5e-15   
ref|XP_011071715.1|  PREDICTED: LRR receptor-like serine/threonin...  83.6    5e-15   
ref|XP_002971685.1|  hypothetical protein SELMODRAFT_172211           83.6    5e-15   
gb|AFO67894.1|  leucine-rich repeat receptor-like kinase              83.2    5e-15   
ref|XP_009151389.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    6e-15   
ref|XP_007025533.1|  HAESA-like 1 isoform 2                           84.0    6e-15   
ref|XP_007025532.1|  HAESA-like 1 isoform 1                           84.0    6e-15   
ref|XP_009369360.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    6e-15   
ref|XP_010325645.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    6e-15   
gb|KFK26321.1|  hypothetical protein AALP_AA8G232500                  80.1    7e-15   
ref|XP_007028918.1|  Leucine-rich repeat protein kinase family pr...  83.2    7e-15   
tpg|DAA39565.1|  TPA: putative leucine-rich repat protein kinase ...  83.6    7e-15   
ref|NP_001169585.1|  uncharacterized protein LOC100383466             83.6    7e-15   
ref|XP_011025617.1|  PREDICTED: somatic embryogenesis receptor ki...  80.5    7e-15   
ref|XP_002511511.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  83.2    7e-15   
ref|XP_008652405.1|  PREDICTED: probable LRR receptor-like serine...  83.2    8e-15   
emb|CDX93126.1|  BnaA03g38480D                                        82.8    8e-15   
emb|CDX70962.1|  BnaC03g10460D                                        79.7    8e-15   
ref|XP_009136223.1|  PREDICTED: somatic embryogenesis receptor ki...  82.8    8e-15   
ref|XP_010525796.1|  PREDICTED: putative leucine-rich repeat rece...  83.6    8e-15   
emb|CDX92412.1|  BnaA10g14510D                                        79.7    9e-15   
ref|XP_010092461.1|  putative LRR receptor-like serine/threonine-...  83.2    9e-15   
ref|XP_011042612.1|  PREDICTED: LRR receptor-like serine/threonin...  82.8    9e-15   
ref|XP_009120732.1|  PREDICTED: somatic embryogenesis receptor ki...  79.7    9e-15   
gb|EYU37463.1|  hypothetical protein MIMGU_mgv1a003320mg              82.8    1e-14   
gb|ABK93925.1|  unknown                                               82.8    1e-14   
ref|XP_009136222.1|  PREDICTED: somatic embryogenesis receptor ki...  82.8    1e-14   
gb|KDP31199.1|  hypothetical protein JCGZ_11575                       82.4    1e-14   
gb|EEC68243.1|  hypothetical protein OsI_36258                        79.7    1e-14   
emb|CDX89615.1|  BnaC03g45290D                                        82.4    1e-14   
ref|XP_010528022.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      82.8    1e-14   
ref|XP_010256230.1|  PREDICTED: LRR receptor-like serine/threonin...  82.4    1e-14   
ref|XP_008374516.1|  PREDICTED: LRR receptor-like serine/threonin...  82.4    1e-14   
ref|XP_010550651.1|  PREDICTED: LRR receptor-like serine/threonin...  82.4    1e-14   
emb|CDY16593.1|  BnaC09g36800D                                        79.3    1e-14   
ref|XP_010256225.1|  PREDICTED: LRR receptor-like serine/threonin...  82.4    1e-14   
ref|XP_006400679.1|  hypothetical protein EUTSA_v10014631mg           79.3    1e-14   
ref|XP_011018089.1|  PREDICTED: probable LRR receptor-like serine...  82.4    1e-14   
gb|EAZ43742.1|  hypothetical protein OsJ_28366                        82.8    1e-14   
gb|EAZ08110.1|  hypothetical protein OsI_30375                        82.8    1e-14   
ref|XP_006339232.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  79.3    1e-14   
ref|XP_010232495.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...  82.8    1e-14   
ref|XP_009343197.1|  PREDICTED: LRR receptor-like serine/threonin...  82.4    1e-14   
ref|XP_007210869.1|  hypothetical protein PRUPE_ppa003168mg           82.4    1e-14   
ref|XP_011072724.1|  PREDICTED: receptor-like protein kinase isof...  82.8    1e-14   
gb|KHG04550.1|  hypothetical protein F383_29256                       82.4    1e-14   
ref|XP_006365392.1|  PREDICTED: LRR receptor-like serine/threonin...  82.0    1e-14   
gb|KJB16403.1|  hypothetical protein B456_002G229000                  82.0    2e-14   
ref|XP_011001223.1|  PREDICTED: receptor-like protein kinase HSL1     82.8    2e-14   
ref|NP_001062569.1|  Os09g0110100                                     82.4    2e-14   
emb|CDY46500.1|  BnaA02g27500D                                        79.3    2e-14   
ref|XP_011072726.1|  PREDICTED: receptor-like protein kinase isof...  82.4    2e-14   
ref|XP_007138218.1|  hypothetical protein PHAVU_009G190400g           82.0    2e-14   
gb|KDP38737.1|  hypothetical protein JCGZ_04090                       82.0    2e-14   
ref|XP_002994468.1|  hypothetical protein SELMODRAFT_432388           79.3    2e-14   
ref|XP_007138217.1|  hypothetical protein PHAVU_009G190400g           82.0    2e-14   
ref|XP_002309372.1|  leucine-rich repeat family protein               82.0    2e-14   
ref|XP_009418102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  82.0    2e-14   
ref|XP_009418103.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  81.6    2e-14   
ref|XP_008238033.1|  PREDICTED: LRR receptor-like serine/threonin...  81.6    2e-14   
emb|CDY16762.1|  BnaA09g06200D                                        81.6    2e-14   
emb|CDX99771.1|  BnaC02g35490D                                        79.0    2e-14   
ref|NP_201077.2|  leucine-rich repeat protein kinase-like protein     81.6    2e-14   
ref|XP_002978742.1|  hypothetical protein SELMODRAFT_109609           81.3    2e-14   
ref|XP_010927978.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  81.6    2e-14   
ref|XP_003602344.1|  Kinase-like protein                              82.0    2e-14   
ref|XP_002975503.1|  hypothetical protein SELMODRAFT_103488           81.3    2e-14   
ref|XP_002992346.1|  hypothetical protein SELMODRAFT_26650            77.4    3e-14   
ref|XP_002881831.1|  leucine-rich repeat family protein               81.6    3e-14   
dbj|BAG93736.1|  unnamed protein product                              79.3    3e-14   
ref|XP_010502426.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      81.6    3e-14   
gb|EMT29112.1|  Putative LRR receptor-like serine/threonine-prote...  80.5    3e-14   
ref|XP_010248541.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  81.3    3e-14   
emb|CDX88826.1|  BnaA03g08230D                                        78.2    3e-14   
ref|XP_003554189.2|  PREDICTED: probable inactive leucine-rich re...  81.3    3e-14   
ref|XP_009131837.1|  PREDICTED: somatic embryogenesis receptor ki...  78.2    3e-14   
ref|XP_009112029.1|  PREDICTED: LRR receptor-like serine/threonin...  81.3    3e-14   
ref|XP_001768500.1|  predicted protein                                81.3    3e-14   
emb|CAB79770.1|  receptor-like kinase homolog                         81.3    3e-14   
ref|XP_010276978.1|  PREDICTED: probable LRR receptor-like serine...  81.6    3e-14   
ref|XP_011033358.1|  PREDICTED: probable LRR receptor-like serine...  81.3    3e-14   
ref|XP_004300401.1|  PREDICTED: LRR receptor-like serine/threonin...  81.3    3e-14   
ref|XP_010276980.1|  PREDICTED: probable LRR receptor-like serine...  81.3    3e-14   
emb|CDX87267.1|  BnaC09g05820D                                        80.9    3e-14   
ref|XP_010276982.1|  PREDICTED: probable LRR receptor-like serine...  81.3    3e-14   
ref|XP_002876917.1|  nsp-interacting kinase 2                         81.3    3e-14   
gb|KHG18466.1|  Receptor-like protein kinase HSL1                     81.6    3e-14   
ref|XP_002446972.1|  hypothetical protein SORBIDRAFT_06g026090        81.6    4e-14   
ref|XP_006595408.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  81.3    4e-14   
ref|XP_003527058.1|  PREDICTED: LRR receptor-like serine/threonin...  80.9    4e-14   
gb|KHN19373.1|  LRR receptor-like serine/threonine-protein kinase...  80.9    4e-14   
ref|XP_010244265.1|  PREDICTED: probable LRR receptor-like serine...  81.3    4e-14   
ref|XP_010265781.1|  PREDICTED: probable inactive leucine-rich re...  80.9    4e-14   
gb|EPS72631.1|  hypothetical protein M569_02128                       80.9    4e-14   
ref|XP_008647816.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  80.5    4e-14   
ref|XP_006581953.1|  PREDICTED: LRR receptor-like serine/threonin...  80.9    4e-14   
ref|XP_010672728.1|  PREDICTED: probable inactive leucine-rich re...  80.9    4e-14   
ref|XP_007047392.1|  Leucine-rich repeat protein kinase family pr...  80.9    4e-14   
gb|AIZ46839.1|  leucine-rich repeat receptor-like protein CLAVATA2    80.9    5e-14   
ref|XP_009129052.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      78.2    5e-14   
ref|XP_006411490.1|  hypothetical protein EUTSA_v10017834mg           80.5    5e-14   
ref|XP_002305776.1|  leucine-rich repeat receptor-like protein ki...  81.3    5e-14   
ref|XP_007047393.1|  Leucine-rich repeat protein kinase family pr...  80.9    5e-14   
ref|XP_008658830.1|  PREDICTED: uncharacterized LOC100382590 isof...  80.5    5e-14   
ref|XP_011047703.1|  PREDICTED: receptor-like protein kinase HSL1     80.9    5e-14   
gb|ACN30679.1|  unknown                                               80.5    5e-14   
ref|XP_003569550.1|  PREDICTED: probable LRR receptor-like serine...  80.5    5e-14   
ref|XP_007225784.1|  hypothetical protein PRUPE_ppa011206mg           77.4    5e-14   
ref|XP_008225155.1|  PREDICTED: receptor-like protein kinase HSL1     80.9    5e-14   
ref|XP_004969518.1|  PREDICTED: probable LRR receptor-like serine...  80.5    6e-14   
ref|XP_008658828.1|  PREDICTED: uncharacterized LOC100382590 isof...  80.5    6e-14   
ref|XP_011079162.1|  PREDICTED: somatic embryogenesis receptor ki...  77.4    6e-14   
ref|XP_006441549.1|  hypothetical protein CICLE_v10018710mg           80.9    6e-14   
ref|XP_008389928.1|  PREDICTED: somatic embryogenesis receptor ki...  77.4    6e-14   
ref|XP_006659455.1|  PREDICTED: probable LRR receptor-like serine...  80.1    6e-14   
ref|XP_008647814.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  80.5    6e-14   
gb|AFW76897.1|  putative leucine-rich repeat receptor-like protei...  80.5    6e-14   
ref|XP_002456123.1|  hypothetical protein SORBIDRAFT_03g030925        77.0    6e-14   
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...  80.9    6e-14   
ref|XP_009152132.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...  80.5    6e-14   
ref|XP_008222348.1|  PREDICTED: somatic embryogenesis receptor ki...  77.8    6e-14   
ref|XP_007141566.1|  hypothetical protein PHAVU_008G206700g           77.4    6e-14   
emb|CDY48073.1|  BnaA06g33550D                                        80.1    7e-14   
ref|NP_001147975.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  80.1    7e-14   
ref|XP_006854236.1|  hypothetical protein AMTR_s00048p00228530        80.1    7e-14   
emb|CDX83534.1|  BnaC07g22740D                                        80.1    7e-14   
ref|XP_008389927.1|  PREDICTED: somatic embryogenesis receptor ki...  77.0    7e-14   
dbj|BAD10033.1|  somatic embryogenesis receptor kinase-like protein   79.7    7e-14   
ref|XP_011027770.1|  PREDICTED: receptor-like protein kinase HSL1     80.5    7e-14   
gb|AIZ00999.1|  brassinosteroid insensitive1-associated receptor ...  80.1    7e-14   
ref|XP_010514169.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  80.1    7e-14   
gb|KDO59946.1|  hypothetical protein CISIN_1g0130042mg                79.3    7e-14   
ref|XP_006591868.1|  PREDICTED: receptor-like protein kinase HSL1...  80.5    7e-14   
ref|XP_010677519.1|  PREDICTED: LRR receptor-like serine/threonin...  80.1    7e-14   
emb|CBI30696.3|  unnamed protein product                              80.1    7e-14   
ref|NP_001241340.1|  receptor-like protein kinase HSL1-like           80.5    8e-14   



>ref|XP_011073820.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=1009

 Score =   182 bits (462),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +3

Query  198  SGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  377
            +G  G E+LQLNDDVLGLIV KSG QDP   L +W+EDD+SPCAW F+KC+P N RVSEV
Sbjct  22   TGCFGGETLQLNDDVLGLIVLKSGFQDPFKSLDSWNEDDESPCAWKFIKCNPGNNRVSEV  81

Query  378  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  557
             L GLGLSGKIGRGLEKL+ L VLSL+SNN +G I P+L L+ NL+ LNLSKNS+SG VP
Sbjct  82   SLDGLGLSGKIGRGLEKLQSLKVLSLSSNNLTGSIIPELALIPNLERLNLSKNSLSGNVP  141

Query  558  DSLGNMSSLQFLDLSGNSLSGPV  626
             SL ++SSLQFLDLS NSLSGP+
Sbjct  142  SSLSDVSSLQFLDLSQNSLSGPL  164



>ref|XP_009589223.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Nicotiana tomentosiformis]
Length=1012

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  201  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  380
            G+   E+LQLNDDVLGLIVFKS + DP S L +W+EDD+SPCAW F+KC+P NGRVSE++
Sbjct  24   GSLADETLQLNDDVLGLIVFKSALLDPNSKLLSWNEDDNSPCAWEFIKCNPMNGRVSELN  83

Query  381  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  560
            L+GL LSGKIGRGLEKL+ L VLSL++NNF+G ISP+LGLL NL+ LNLS+N +SG +P 
Sbjct  84   LNGLSLSGKIGRGLEKLQSLQVLSLSNNNFTGPISPELGLLINLENLNLSQNGLSGNIPA  143

Query  561  SLGNMSSLQFLDLSGNSLSGPV  626
            S+  M+SLQFLDLS NSLSGPV
Sbjct  144  SISKMTSLQFLDLSENSLSGPV  165


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +3

Query  363  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  542
            ++ E  L G   SG++   +    HLN L L+ N F+G I   +  L  L  L LS N I
Sbjct  250  QLKEFLLQGNQFSGELPSDIGFCPHLNKLDLSENLFTGAIPESVQKLNALSFLTLSNNMI  309

Query  543  SGTVPDSLGNMSSLQFLDLSGNSLSG  620
            +G  P  + NMSSL++LD SGNSL G
Sbjct  310  NGDFPQWISNMSSLEYLDFSGNSLEG  335



>emb|CBI39439.3| unnamed protein product [Vitis vinifera]
Length=803

 Score =   178 bits (451),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  222  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  401
            +Q+NDDVLGLIVFKSG+ DP+S L +WSEDDDSPC+W FV+C+P+ GRVSEV + GLGLS
Sbjct  8    IQINDDVLGLIVFKSGLHDPSSRLDSWSEDDDSPCSWEFVQCNPSTGRVSEVSVDGLGLS  67

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  581
            GKIGRGLEKL++L VLSL+ NNFSG ISP+L L+T L+ LNLS NS+SG +P SL NM+S
Sbjct  68   GKIGRGLEKLQNLKVLSLSFNNFSGSISPELALITGLERLNLSHNSLSGRIPSSLSNMTS  127

Query  582  LQFLDLSGNSLSGPV  626
            ++FLDLS NSL+GP+
Sbjct  128  IRFLDLSHNSLAGPI  142



>ref|XP_002265846.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=1012

 Score =   179 bits (453),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  222  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  401
            +Q+NDDVLGLIVFKSG+ DP+S L +WSEDDDSPC+W FV+C+P+ GRVSEV + GLGLS
Sbjct  34   IQINDDVLGLIVFKSGLHDPSSRLDSWSEDDDSPCSWEFVQCNPSTGRVSEVSVDGLGLS  93

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  581
            GKIGRGLEKL++L VLSL+ NNFSG ISP+L L+T L+ LNLS NS+SG +P SL NM+S
Sbjct  94   GKIGRGLEKLQNLKVLSLSFNNFSGSISPELALITGLERLNLSHNSLSGRIPSSLSNMTS  153

Query  582  LQFLDLSGNSLSGPV  626
            ++FLDLS NSL+GP+
Sbjct  154  IRFLDLSHNSLAGPI  168



>ref|XP_007034091.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY05017.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1011

 Score =   178 bits (452),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = +3

Query  135  IYIMGFRsmlllvflsvlsvTSGAGGAE-SLQLNDDVLGLIVFKSGVQDPASHLATWSED  311
            + +MGFR +++ + LS+  +    G  + S+QLNDDVLGLIVFKS ++DP+S+L +W+ED
Sbjct  4    MVVMGFRQLVVFLLLSMAVLHGCMGNDDASIQLNDDVLGLIVFKSDIKDPSSYLDSWNED  63

Query  312  DDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPq  491
            D+SPC+W F++C+P NGRVSEV L+GLGLSGKIG+GL+KL++L VLSL+ NNFSG ISP+
Sbjct  64   DNSPCSWRFIQCNPVNGRVSEVSLNGLGLSGKIGKGLQKLQYLKVLSLSHNNFSGSISPE  123

Query  492  lglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
            LGL+ +L+ LNLS NS+SG +P S  NM+S++FLDLSGNSLSG V
Sbjct  124  LGLIGSLERLNLSHNSLSGRIPSSFVNMNSIRFLDLSGNSLSGSV  168



>emb|CDP14623.1| unnamed protein product [Coffea canephora]
Length=1020

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +3

Query  210  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  389
              +SL LNDDVLGLIVFKS + DP SHL +WSEDD SPCAW FVKC+P NGRVSEV L G
Sbjct  35   AEDSLPLNDDVLGLIVFKSAIYDPFSHLESWSEDDSSPCAWEFVKCNPRNGRVSEVSLDG  94

Query  390  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  569
            LGLSGK+GRGLEKL+ L VLSL++NN +G ISP+  L+T L+ LNLS+N++ G +P S+ 
Sbjct  95   LGLSGKMGRGLEKLQDLKVLSLSNNNLTGSISPEFALITGLERLNLSQNNLRGNIPSSVA  154

Query  570  NMSSLQFLDLSGNSLSGPV  626
            NMSS+QFLDLS N LSGP+
Sbjct  155  NMSSIQFLDLSENLLSGPI  173



>ref|XP_006840189.1| hypothetical protein AMTR_s00089p00108500 [Amborella trichopoda]
 gb|ERN01864.1| hypothetical protein AMTR_s00089p00108500 [Amborella trichopoda]
Length=975

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  219  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            SLQLNDDVLGLIVFK+G+QDP S L++WSEDDDSPC WNFV+C   +GRV+EV L GL L
Sbjct  33   SLQLNDDVLGLIVFKAGIQDPTSSLSSWSEDDDSPCHWNFVQCDRNSGRVTEVSLDGLSL  92

Query  399  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  578
            SGKIGRGLEKL++L  LSL++NNFSG I+P+L  + +L+ LNLS+NS+SG++P SLGNMS
Sbjct  93   SGKIGRGLEKLQNLQALSLSNNNFSGTINPELARIESLRRLNLSRNSLSGSIPPSLGNMS  152

Query  579  SLQFLDLSGNSLSGPV  626
            S+Q LD S NSLSG +
Sbjct  153  SIQVLDFSENSLSGTI  168



>ref|XP_009765958.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=1012

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  201  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  380
            G+   E+LQLNDDVLGLIVFKS + DP S L +W+EDD+SPCAW F+KC+P NGRVSE++
Sbjct  24   GSLAGETLQLNDDVLGLIVFKSTLLDPNSKLLSWNEDDNSPCAWEFIKCNPMNGRVSELN  83

Query  381  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  560
            L+GL LSGKIGRGLEKL+ L VLSL++NNF+G ISP+L LLTNL+ LNLS+N ++G +P 
Sbjct  84   LNGLSLSGKIGRGLEKLQSLQVLSLSNNNFTGPISPELALLTNLENLNLSQNGLTGNIPP  143

Query  561  SLGNMSSLQFLDLSGNSLSGPV  626
            S+  ++SLQFLDLS NSLSGPV
Sbjct  144  SISKITSLQFLDLSQNSLSGPV  165


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +3

Query  363  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  542
            ++ E+ L G   SGK+   +    HLN L L+ N F+G I   +  L  L  L+LS N I
Sbjct  250  QLKELLLQGNQFSGKLPSDIGYCPHLNKLDLSENLFTGAIPESVQKLNALSFLSLSNNMI  309

Query  543  SGTVPDSLGNMSSLQFLDLSGNSLSG  620
            +G  P  + NMSSL++LD SGNS+ G
Sbjct  310  NGDFPQWISNMSSLEYLDFSGNSIEG  335


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +3

Query  366  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  545
            ++++DL     +G I   ++KL  L+ LSL++N  +G     +  +++L+ L+ S NSI 
Sbjct  275  LNKLDLSENLFTGAIPESVQKLNALSFLSLSNNMINGDFPQWISNMSSLEYLDFSGNSIE  334

Query  546  GTVPDSLGNMSSLQFLDLSGNSLSGPV  626
            GT+PDS+G++  L++L LSGN LSG +
Sbjct  335  GTLPDSIGDLKMLKYLSLSGNKLSGKI  361



>ref|XP_006364689.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=1011

 Score =   176 bits (445),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  219  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            ++QLNDDVLGLIVFKS + DP S L +WSEDD+SPCAW ++KC+P NGRV+E++L+GL L
Sbjct  27   TMQLNDDVLGLIVFKSALLDPYSKLLSWSEDDNSPCAWEYIKCNPMNGRVTELNLNGLSL  86

Query  399  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  578
            SGKIGRGLEKL+ L VLSL++NNF+G ISP+L LLTNL+ LN S N +SG +P S  NM+
Sbjct  87   SGKIGRGLEKLQSLKVLSLSNNNFTGAISPELALLTNLENLNFSHNGLSGNIPGSFSNMT  146

Query  579  SLQFLDLSGNSLSGPV  626
            SLQFLDLS N+LSGPV
Sbjct  147  SLQFLDLSENALSGPV  162


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +3

Query  363  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  542
            ++ E  L G   SG +   +    HLN L L++N F+G I   L  +  L  L+LS N I
Sbjct  247  QLKECLLQGNHFSGDLPADIGFCPHLNRLDLSNNQFTGQIPMSLQRVNVLSFLSLSNNMI  306

Query  543  SGTVPDSLGNMSSLQFLDLSGNSLSG  620
            +G  P  + NMSSL++LDLSGNSL G
Sbjct  307  NGDFPQWISNMSSLEYLDLSGNSLEG  332



>ref|XP_010528265.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=1011

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  207  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  386
            G A S QLNDDVLGLIVFK+ + DP+SHL +W+EDD SPC+W ++KC+PA GRVSE+ L 
Sbjct  23   GDAGSFQLNDDVLGLIVFKADINDPSSHLESWNEDDYSPCSWKYIKCNPATGRVSEISLD  82

Query  387  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  566
            GLGLSGKIGRG++KL+HL VLSL+ NNF+G I PQ+GL+T LQ LNLS N +SG +P SL
Sbjct  83   GLGLSGKIGRGVQKLQHLKVLSLSDNNFTGNIIPQIGLITGLQKLNLSHNRLSGIIPSSL  142

Query  567  GNMSSLQFLDLSGNSLSGPV  626
            G++SSL+FLDLS NSLSG +
Sbjct  143  GSISSLKFLDLSENSLSGTI  162



>ref|XP_004152295.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN53091.1| Receptor protein kinase [Cucumis sativus]
Length=1007

 Score =   173 bits (438),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +3

Query  225  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  404
            QLNDD+LGLIVFKS +QDP+S L++WSEDDDSPC+W F+KC+P NGRVSEV + GLGLSG
Sbjct  31   QLNDDILGLIVFKSDLQDPSSVLSSWSEDDDSPCSWKFIKCNPINGRVSEVSIDGLGLSG  90

Query  405  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  584
            +IGRGLEKL+HL VLSL+ NNF+G +SPQL L  +L  +N S NS+SG +P SL +MSS+
Sbjct  91   RIGRGLEKLQHLKVLSLSGNNFTGNLSPQLVLPPSLDRVNFSGNSLSGRIPVSLISMSSI  150

Query  585  QFLDLSGNSLSGPV  626
            +FLD S N LSGP+
Sbjct  151  RFLDFSDNLLSGPL  164



>ref|XP_007139297.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris]
 gb|ESW11291.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris]
Length=1018

 Score =   173 bits (438),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = +3

Query  225  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  404
            QLNDDVLGLIVFKS +QDP+SHLA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLSG
Sbjct  43   QLNDDVLGLIVFKSDLQDPSSHLASWNEDDVNPCSWQFVQCNPESGRVSEVSLDGLGLSG  102

Query  405  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  584
            KIGRGLEKL+HL VLSL+ NN SG ISP L L   LQ LNLS N++SG++P S  NM+S+
Sbjct  103  KIGRGLEKLQHLTVLSLSHNNLSGGISPSLTLSNTLQRLNLSHNALSGSIPTSFVNMNSI  162

Query  585  QFLDLSGNSLSGPV  626
            +FLDLS NS SG +
Sbjct  163  KFLDLSENSFSGSI  176



>ref|XP_004247993.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=1012

 Score =   173 bits (438),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +3

Query  219  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            ++QLNDDVLGLIVFKS + DP S L +WSEDD+SPCAW ++KC+P NGRV+E++L+GL L
Sbjct  27   TMQLNDDVLGLIVFKSALLDPYSKLLSWSEDDNSPCAWEYIKCNPMNGRVNELNLNGLSL  86

Query  399  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  578
            SGKIGRGLEKL+ L VLSL++NNF+G ISP+L LLTNL+ LN S N +SG +P S   M+
Sbjct  87   SGKIGRGLEKLQSLKVLSLSNNNFTGAISPELALLTNLENLNFSHNGLSGNIPGSFSKMT  146

Query  579  SLQFLDLSGNSLSGPV  626
            SLQFLDLS N+LSGPV
Sbjct  147  SLQFLDLSENALSGPV  162


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +3

Query  363  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  542
            ++ E  L G   SG +   +    HLN L L++N F+G I   L  +  L  L+LS N I
Sbjct  247  QLKECLLQGNHFSGDLPADIGYCPHLNRLDLSNNQFTGQIPMSLQKVNALSFLSLSNNMI  306

Query  543  SGTVPDSLGNMSSLQFLDLSGNSLSG  620
            +G  P  + NMSSL++LDLSGNSL G
Sbjct  307  NGDFPQWISNMSSLEYLDLSGNSLEG  332



>ref|XP_004156987.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040-like [Cucumis 
sativus]
Length=1007

 Score =   173 bits (438),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +3

Query  225  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  404
            QLNDD+LGLIVFKS +QDP+S L++WSEDDDSPC+W F+KC+P NGRVSEV + GLGLSG
Sbjct  31   QLNDDILGLIVFKSDLQDPSSVLSSWSEDDDSPCSWKFIKCNPINGRVSEVSIDGLGLSG  90

Query  405  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  584
            +IGRGLEKL+HL VLSL+ NNF+G +SPQL L  +L  +N S NS+SG +P SL +MSS+
Sbjct  91   RIGRGLEKLQHLKVLSLSGNNFTGNLSPQLVLPPSLDRVNFSGNSLSGRIPVSLISMSSI  150

Query  585  QFLDLSGNSLSGPV  626
            +FLD S N LSGP+
Sbjct  151  RFLDFSDNLLSGPL  164



>ref|XP_008453972.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=1010

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  219  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            S QLNDD+LGLIVFKS + DP+S L++WSEDDDSPC+W F+KC+P NGRVSEV + GLGL
Sbjct  29   SPQLNDDILGLIVFKSDLHDPSSALSSWSEDDDSPCSWKFIKCNPINGRVSEVSIDGLGL  88

Query  399  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  578
            SG+IGRGLEKL+HL VLSL+ NNF+G ++PQL L  +L  +N S+NS+SG +P SL +MS
Sbjct  89   SGRIGRGLEKLQHLKVLSLSGNNFTGNLNPQLALPPSLDRVNFSRNSLSGRIPVSLISMS  148

Query  579  SLQFLDLSGNSLSGPV  626
            S++FLD S N LSGP+
Sbjct  149  SVRFLDFSDNLLSGPL  164



>ref|XP_010268319.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=1009

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +3

Query  219  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            SLQLNDDVLGLIVFK+ + DP+S L +W+EDD++PC+W +V+C P++GRV+E+ L GLGL
Sbjct  32   SLQLNDDVLGLIVFKTDLHDPSSLLGSWNEDDNTPCSWKYVRCDPSSGRVTELSLDGLGL  91

Query  399  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  578
            SGKIGRGLEKL++L VLSL+ NNF+G ISP+L L+ +L TLNLS NS+SG +P  LGNMS
Sbjct  92   SGKIGRGLEKLQNLQVLSLSHNNFTGDISPELSLIGSLTTLNLSHNSLSGRIPVELGNMS  151

Query  579  SLQFLDLSGNSLSGPV  626
            +L+FLDLS NSLSGP+
Sbjct  152  ALRFLDLSENSLSGPL  167



>gb|KHN13843.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=1007

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = +3

Query  222  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  401
            +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLNDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  581
            GKIGRGLEKL+HL VLSL+ NN SG ISP L L  +L+ LNLS N +SG++P S  NM+S
Sbjct  91   GKIGRGLEKLQHLTVLSLSHNNLSGSISPSLTLSNSLERLNLSHNVLSGSIPTSFVNMNS  150

Query  582  LQFLDLSGNSLSGPV  626
            ++FLDLS NS SGP+
Sbjct  151  IKFLDLSENSFSGPM  165



>ref|XP_003518672.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=1007

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  222  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  401
            +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLDDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  581
            GKIGRGLEKL+HL VLSL+ N+ SG ISP L L  +L+ LNLS N++SG++P S  NM+S
Sbjct  91   GKIGRGLEKLQHLTVLSLSHNSLSGSISPSLTLSNSLERLNLSHNALSGSIPTSFVNMNS  150

Query  582  LQFLDLSGNSLSGPV  626
            ++FLDLS NS SGPV
Sbjct  151  IRFLDLSENSFSGPV  165



>ref|XP_003552656.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=1007

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = +3

Query  222  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  401
            +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLNDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  581
            GKIGRGLEKL+HL VLSL+ NN SG ISP L L  +L+ LNLS N +SG++P S  NM+S
Sbjct  91   GKIGRGLEKLQHLTVLSLSHNNLSGSISPSLTLSNSLERLNLSHNVLSGSIPTSFVNMNS  150

Query  582  LQFLDLSGNSLSGPV  626
            ++FLDLS NS SGP+
Sbjct  151  IKFLDLSENSFSGPM  165



>gb|KHN27185.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=1007

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  222  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  401
            +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLDDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  581
            GKIGRGLEKL+HL VLSL+ N+ SG ISP L L  +L+ LNLS N++SG++P S  NM+S
Sbjct  91   GKIGRGLEKLQHLTVLSLSHNSLSGSISPSLTLSNSLERLNLSHNALSGSIPTSFVNMNS  150

Query  582  LQFLDLSGNSLSGPV  626
            ++FLDLS NS SGPV
Sbjct  151  IRFLDLSENSFSGPV  165



>gb|KJB37929.1| hypothetical protein B456_006G227000 [Gossypium raimondii]
Length=988

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +3

Query  201  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  380
            G   + S+QLNDDVLGLIVFKS ++DP+S+L +W+EDD+SPC+W F+KC+P NGRVSEV 
Sbjct  28   GDDESSSVQLNDDVLGLIVFKSDIKDPSSYLESWNEDDNSPCSWRFIKCNPNNGRVSEVS  87

Query  381  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  560
            L GLGLSGKIG+GL+KLE+L VLSL+ NNFSG+I    G+L +L+ L+LS N++SG++P 
Sbjct  88   LDGLGLSGKIGKGLQKLEYLKVLSLSRNNFSGIIGRAFGVLNSLERLDLSYNNLSGSIPS  147

Query  561  SLGNMSSLQFLDLSGNSLSGPV  626
            +  NM+S++FLDLS NSLSG +
Sbjct  148  TFVNMNSIRFLDLSRNSLSGSI  169



>ref|XP_002518223.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF44166.1| receptor protein kinase, putative [Ricinus communis]
Length=1007

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  219  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            ++QLNDDVLGLIVFKS + DP+S L++WSEDDDSPC+W F++C+ ANGRVS V L GLGL
Sbjct  27   TIQLNDDVLGLIVFKSDLVDPSSTLSSWSEDDDSPCSWKFIECNSANGRVSHVSLDGLGL  86

Query  399  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  578
            SGK+G+GL+KL+HL VLSL+ NNFSG ISP L L+ +L++LNLS NS+SG +P S  NM+
Sbjct  87   SGKLGKGLQKLQHLKVLSLSHNNFSGEISPDLPLIPSLESLNLSHNSLSGLIPSSFVNMT  146

Query  579  SLQFLDLSGNSLSGPV  626
            +++FLDLS NSLSGP+
Sbjct  147  TVRFLDLSENSLSGPL  162



>gb|KHG00472.1| hypothetical protein F383_20103 [Gossypium arboreum]
Length=989

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  201  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  380
            G   + S+QLNDDVLGLIVFKS ++DP+S+L +W+EDD+SPC+W F+KC+P NGRVSEV 
Sbjct  29   GDDESSSVQLNDDVLGLIVFKSDIKDPSSYLESWNEDDNSPCSWRFIKCNPNNGRVSEVS  88

Query  381  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  560
            L GLGLSGKIG+GL+KL +L VLSL+ N+FSG I    G+L +L+ L+LS N++SG++P 
Sbjct  89   LDGLGLSGKIGKGLQKLMYLKVLSLSRNDFSGTIGRAFGVLNSLERLDLSYNNLSGSIPS  148

Query  561  SLGNMSSLQFLDLSGNSLSGPV  626
            +  NM+S++FLDLSGNSLSG +
Sbjct  149  TFVNMNSIRFLDLSGNSLSGSI  170



>gb|EYU32740.1| hypothetical protein MIMGU_mgv1a000860mg [Erythranthe guttata]
Length=957

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = +3

Query  204  AGGAES-LQLNDDVLGLIVFKSGVQ-DPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  377
            AGGA + LQLNDDVLGLIVFKSG   DP   L +W+EDDDSPCAW FVKC+  N RVSEV
Sbjct  22   AGGATTTLQLNDDVLGLIVFKSGFHSDPLKSLDSWNEDDDSPCAWRFVKCNAGNSRVSEV  81

Query  378  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  557
             L GL LSGKIGRGLEKL+ L VLSL++NN +G ++P L L+ NL+ LNLS+NS+SG VP
Sbjct  82   SLDGLSLSGKIGRGLEKLQSLKVLSLSNNNLTGAVNPGLALIPNLERLNLSRNSLSGDVP  141

Query  558  DSLGNMSSLQFLDLSGNSLSGPV  626
             S  + SSLQFLDLS N LSGP+
Sbjct  142  SSFSDASSLQFLDLSQNLLSGPL  164



>ref|XP_010023583.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW59891.1| hypothetical protein EUGRSUZ_H02618 [Eucalyptus grandis]
Length=1012

 Score =   164 bits (416),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = +3

Query  207  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  386
            G   S QLNDDVLGLIVFKS + DP+S L +WSEDD SPC+W +V+C P  GRV++V L 
Sbjct  32   GDDVSAQLNDDVLGLIVFKSDLTDPSSSLVSWSEDDASPCSWRYVQCDPLTGRVAQVSLD  91

Query  387  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  566
            GLGLSGKIGRGLEKL+ L VLSL+ NNF+G ISPQL L + LQ LNLS+N +SG  P SL
Sbjct  92   GLGLSGKIGRGLEKLDRLKVLSLSRNNFTGSISPQLSLPSGLQRLNLSRNGLSGPFPTSL  151

Query  567  GNMSSLQFLDLSGNSLSGPV  626
             N+SS++FLDLS NS SGP+
Sbjct  152  VNVSSIRFLDLSENSFSGPL  171



>ref|XP_011000023.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=1006

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 131/163 (80%), Gaps = 2/163 (1%)
 Frame = +3

Query  144  MGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDDD  317
            MGF  +LL   +S ++   G  G++S  +Q+NDDVLGLIVFKS ++DP+S+L++W+EDDD
Sbjct  1    MGFSHLLLYFLVSSVASLRGCTGSDSVPIQINDDVLGLIVFKSDLRDPSSYLSSWNEDDD  60

Query  318  SPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlg  497
            SPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+H+  LSL+ NNFSG  S + G
Sbjct  61   SPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHVKTLSLSHNNFSGDFSLEFG  120

Query  498  lltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
            L+++L++LNLS NS+SG +P  L NMSS++FLDLS NS SGP+
Sbjct  121  LISSLESLNLSHNSLSGLIPSFLDNMSSIKFLDLSENSFSGPL  163



>ref|XP_010107246.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXC14270.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=1023

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = +3

Query  219  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            ++QLNDDVLGLIVFKS +QDP+SHL++W+EDDD+PC+W FV+C+P   RVSE+ L  LGL
Sbjct  34   AVQLNDDVLGLIVFKSDIQDPSSHLSSWNEDDDTPCSWKFVRCNPVTNRVSEISLDNLGL  93

Query  399  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlgl--ltnlqtlnlSKNSISGTVPDSLGN  572
            SG+IG+GLEKL+HL  LSL+ NNFSG ++P+       +L+ LNLS+N +SG +P SL  
Sbjct  94   SGRIGKGLEKLQHLKALSLSGNNFSGDVTPEKLALPTNSLEILNLSRNRLSGRIPSSLVK  153

Query  573  MSSLQFLDLSGNSLSGPV  626
            MS ++ LDLS N LSGPV
Sbjct  154  MSLIRVLDLSENLLSGPV  171



>ref|XP_002321093.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE99408.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1006

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 130/163 (80%), Gaps = 2/163 (1%)
 Frame = +3

Query  144  MGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDDD  317
            MGF  +LL   +S ++   G  G++S  +Q+NDDVLGLIVFKS + DP+S+L++W+EDDD
Sbjct  1    MGFSHLLLYFLVSSVASLRGCTGSDSVPIQINDDVLGLIVFKSDLSDPSSYLSSWNEDDD  60

Query  318  SPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlg  497
            SPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+H+  LSL+ NNFSG  S + G
Sbjct  61   SPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHVKTLSLSHNNFSGDFSLEFG  120

Query  498  lltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
            L+++L++LNLS NS+SG +P  L NMSSL+FLDLS NS +GP+
Sbjct  121  LISSLESLNLSHNSLSGLIPSFLDNMSSLKFLDLSENSFTGPL  163


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = +3

Query  366  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  545
            + E+ L G   SG +   +    HLN L L+SN FSG +   L  L+++   +LSKN ++
Sbjct  248  LKELHLQGNRFSGPLPVDIGLCRHLNRLDLSSNLFSGALPESLQGLSSINYFSLSKNMLT  307

Query  546  GTVPDSLGNMSSLQFLDLSGNSLSGPV  626
            G  P  +G++S+L++LDLS N+L+G +
Sbjct  308  GEFPRWIGSLSNLEYLDLSSNALTGSI  334



>ref|XP_008337525.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=1009

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 114/135 (84%), Gaps = 1/135 (1%)
 Frame = +3

Query  225  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  404
            QLN+DVLGL+VFKS + DP+S+LA+W+ED++SPC+W +V+C+PA GRVS++ L GLGL G
Sbjct  32   QLNNDVLGLLVFKSDIHDPSSYLASWNEDENSPCSWEYVQCNPATGRVSQLSLEGLGLKG  91

Query  405  KIGRGLEKLEHLNVLSLASNNFSGVISPqlgll-tnlqtlnlSKNSISGTVPDSLGNMSS  581
            KIG+GL+ L++L VLSL+SNNFSG ISP+   L  NL+ LNLS NS+SG +P +L NMSS
Sbjct  92   KIGKGLQNLQNLKVLSLSSNNFSGDISPEKLALPPNLEKLNLSHNSLSGLIPTNLFNMSS  151

Query  582  LQFLDLSGNSLSGPV  626
            ++FLDLS NSLSGP+
Sbjct  152  IKFLDLSENSLSGPL  166



>ref|XP_011042759.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
 ref|XP_011042760.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=1012

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 130/164 (79%), Gaps = 2/164 (1%)
 Frame = +3

Query  141  IMGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDD  314
            +MG+  +LL + +SV+    G  G++S  +Q+NDDV GLIVFK+ + DP S+L++W+EDD
Sbjct  6    VMGYSHLLLYLLVSVVVSLKGCMGSDSGPIQMNDDVFGLIVFKADLIDPFSYLSSWNEDD  65

Query  315  DSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPql  494
            DSPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+HL  LSL+ NNFSG IS +L
Sbjct  66   DSPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHLKTLSLSQNNFSGGISHEL  125

Query  495  glltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
            G L+NL+ LNLS NSISG +P  L NMSS++FLDLS NS SGP+
Sbjct  126  GFLSNLERLNLSHNSISGLIPSFLDNMSSIKFLDLSENSFSGPL  169



>ref|XP_002302895.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE82168.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1012

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +3

Query  141  IMGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDD  314
            +MG+  +LL + +S++    G  G++S  +Q+NDDV GLIVFK+ + DP+S+L++W+EDD
Sbjct  6    VMGYSHLLLYLLVSIVVSLEGCMGSDSVPIQINDDVFGLIVFKADLIDPSSYLSSWNEDD  65

Query  315  DSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPql  494
            DSPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+HL  LSL+ NNFSG IS +L
Sbjct  66   DSPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHLKTLSLSQNNFSGGISLEL  125

Query  495  glltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
            G L+NL+ LNLS NS+SG +P  L NMSS++FLDLS NS SGP+
Sbjct  126  GFLSNLERLNLSHNSLSGLIPSFLDNMSSIKFLDLSENSFSGPL  169



>ref|XP_009371148.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=1009

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 114/135 (84%), Gaps = 1/135 (1%)
 Frame = +3

Query  225  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  404
            QLN DVLGL+VFKS + DP+S+LA+W+ED++SPC+W +V+C+PA GRVS++ L GLGL G
Sbjct  32   QLNSDVLGLLVFKSDIHDPSSYLASWNEDENSPCSWEYVQCNPATGRVSQLSLEGLGLRG  91

Query  405  KIGRGLEKLEHLNVLSLASNNFSGVISPqlgll-tnlqtlnlSKNSISGTVPDSLGNMSS  581
            KIG+GL+ L++L VLSL+SNNFSG ISP+   L +NL+ LNLS NS+SG +P +L NMSS
Sbjct  92   KIGKGLQNLQNLKVLSLSSNNFSGDISPEKLALPSNLEKLNLSHNSLSGIIPTNLFNMSS  151

Query  582  LQFLDLSGNSLSGPV  626
            ++FLDLS NSLSGP+
Sbjct  152  IKFLDLSENSLSGPL  166



>ref|XP_003621730.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Medicago truncatula]
 gb|AES77948.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1016

 Score =   161 bits (408),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = +3

Query  195  TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  374
            T  A    ++QLNDDVLGLIVFKS +QDP+S+L++W+EDD +PC+W +VKC+P   RVSE
Sbjct  52   TCFANNDVTIQLNDDVLGLIVFKSDLQDPSSYLSSWNEDDINPCSWQYVKCNPQTQRVSE  111

Query  375  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  554
            + L GLGLSGK+GR LEKL+HL  LSL+ NNFSG ISP L L   LQ LNLS NS SG +
Sbjct  112  LSLDGLGLSGKLGRSLEKLQHLVTLSLSHNNFSGTISPSLTLSNTLQKLNLSHNSFSGPL  171

Query  555  PDSLGNMSSLQFLDLSGNSLSG  620
            P S  NMSS++F+DLS NS +G
Sbjct  172  PLSFVNMSSIRFIDLSHNSFAG  193



>ref|XP_010514517.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 113/138 (82%), Gaps = 1/138 (1%)
 Frame = +3

Query  207  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  386
            G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  387  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  566
            GL L+GKIGRG++KL+HL VLSL++NNF+G I+  L    NL+ L+LS N++SG +P SL
Sbjct  87   GLALTGKIGRGIQKLQHLKVLSLSNNNFTGNIN-ALSTNNNLRKLDLSHNNLSGQIPSSL  145

Query  567  GNMSSLQFLDLSGNSLSG  620
            G++SSLQ LDL+GNS SG
Sbjct  146  GSISSLQHLDLTGNSFSG  163



>gb|KFK33718.1| hypothetical protein AALP_AA5G051000 [Arabis alpina]
Length=1018

 Score =   160 bits (404),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 114/134 (85%), Gaps = 2/134 (1%)
 Frame = +3

Query  219  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            S+QLNDDVLGLIVFKS +QDP+SHL++W+EDD+SPC+W++VKC+P   RV+E+ L+GL L
Sbjct  30   SIQLNDDVLGLIVFKSDLQDPSSHLSSWNEDDNSPCSWSYVKCNPKTSRVTELSLNGLSL  89

Query  399  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  578
            +GKIGRG++KL+HL VLSL++NNF+G I   L    NL+ L+LS N++SG++P S G++S
Sbjct  90   TGKIGRGIQKLQHLKVLSLSNNNFTGNII-ALSKNNNLKKLDLSNNNLSGSIP-SFGSIS  147

Query  579  SLQFLDLSGNSLSG  620
            SLQ+LDL+GNS SG
Sbjct  148  SLQYLDLTGNSFSG  161



>ref|XP_006494521.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=1003

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 114/139 (82%), Gaps = 3/139 (2%)
 Frame = +3

Query  219  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            S++LNDD+LGLIVFKS ++DP+S+L +W EDD+SPC+W F++C+P NGRVS V L GLGL
Sbjct  40   SIELNDDILGLIVFKSELKDPSSNLQSWKEDDNSPCSWKFIQCNPVNGRVSHVSLDGLGL  99

Query  399  SGKIG-RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL--G  569
            SGKIG RGL KL+HL VLSL+ N+F+G I+P+LGL+ +L+ LN S NS+SG +P SL   
Sbjct  100  SGKIGTRGLRKLQHLKVLSLSHNDFTGNINPELGLIASLERLNFSHNSLSGQIPPSLLNL  159

Query  570  NMSSLQFLDLSGNSLSGPV  626
            NM +++FLDLS N LSGPV
Sbjct  160  NMMNMKFLDLSNNLLSGPV  178



>ref|XP_006421080.1| hypothetical protein CICLE_v10004238mg [Citrus clementina]
 gb|ESR34320.1| hypothetical protein CICLE_v10004238mg [Citrus clementina]
Length=1003

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 114/139 (82%), Gaps = 3/139 (2%)
 Frame = +3

Query  219  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            S++LNDD+LGLIVFKS ++DP+S+L +W EDD+SPC+W F++C+P NGRVS V L GLGL
Sbjct  40   SIELNDDILGLIVFKSELKDPSSNLQSWKEDDNSPCSWKFIQCNPINGRVSHVSLDGLGL  99

Query  399  SGKIG-RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL--G  569
            SGKIG RGL KL+HL VLSL+ N+F+G I+P+LGL+ +L+ LN S NS+SG +P SL   
Sbjct  100  SGKIGTRGLRKLQHLKVLSLSHNDFTGNINPELGLIASLERLNFSHNSLSGQIPPSLLNL  159

Query  570  NMSSLQFLDLSGNSLSGPV  626
            NM +++FLDLS N LSGPV
Sbjct  160  NMMNMKFLDLSNNLLSGPV  178



>ref|XP_010425587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 113/138 (82%), Gaps = 1/138 (1%)
 Frame = +3

Query  207  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  386
            G  +++QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDTIQLNDDVLGLIVFKSDLDDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  387  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  566
            GL L+GKIGRG++KL+HL VLSL++NNF+G ++  L    NL+ L+LS N++SG +P SL
Sbjct  87   GLALTGKIGRGIQKLQHLKVLSLSNNNFTGNLN-ALSTNNNLRKLDLSHNNLSGQIPSSL  145

Query  567  GNMSSLQFLDLSGNSLSG  620
            G++SSLQ LDL+GNS +G
Sbjct  146  GSISSLQHLDLTGNSFTG  163



>ref|XP_004296675.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=1006

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 112/134 (84%), Gaps = 1/134 (1%)
 Frame = +3

Query  222  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  401
            +QLN DVLGL+VFKS + DP+S+L++W+EDDDSPC+WNF++C+P+ GRVS+++L GLGL 
Sbjct  26   VQLNYDVLGLLVFKSDLHDPSSYLSSWNEDDDSPCSWNFIQCNPSTGRVSQLNLDGLGLK  85

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlgll-tnlqtlnlSKNSISGTVPDSLGNMS  578
            GK G+GL+ L+HL VLSL+ NNF+G +SP+   L  +LQTLNLS+NS SG VP +L N S
Sbjct  86   GKPGKGLQNLQHLKVLSLSGNNFTGELSPEKLALPPSLQTLNLSRNSFSGLVPTTLVNFS  145

Query  579  SLQFLDLSGNSLSG  620
            S++FLDLS NSLSG
Sbjct  146  SIRFLDLSQNSLSG  159



>ref|XP_006290541.1| hypothetical protein CARUB_v10016623mg [Capsella rubella]
 gb|EOA23439.1| hypothetical protein CARUB_v10016623mg [Capsella rubella]
Length=1017

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = +3

Query  207  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  386
            G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  387  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  566
            GL L+GKI RG++KL+HL VLSL++NNF+G I+  L    NL+ L+LS N++SG +  SL
Sbjct  87   GLALTGKINRGIQKLQHLKVLSLSNNNFTGNIN-ALSTNNNLRKLDLSHNNLSGQILSSL  145

Query  567  GNMSSLQFLDLSGNSLSG  620
            G+M+SLQ LDL+GNS SG
Sbjct  146  GSMTSLQHLDLTGNSFSG  163



>ref|XP_009111587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=1014

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 109/138 (79%), Gaps = 4/138 (3%)
 Frame = +3

Query  207  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  386
            G   S+QLNDDVLGLIV KS + DP+SHLA+W+EDD SPC+W++VKC+P   RV+E+ L 
Sbjct  25   GDTNSIQLNDDVLGLIVLKSDLHDPSSHLASWNEDDASPCSWSYVKCNPKTSRVTELSLS  84

Query  387  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  566
            GLGL+GKIGRG++KL+HL  LSL++NNF+G I   L    NLQ L+LS N++SGT+P SL
Sbjct  85   GLGLTGKIGRGIQKLQHLKTLSLSNNNFTGNIM-SLSNNNNLQKLDLSHNNLSGTIPSSL  143

Query  567  GNMSSLQFLDLSGNSLSG  620
            G   S+++LDL+GNS SG
Sbjct  144  G---SIKYLDLTGNSFSG  158



>ref|XP_002875419.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51678.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. 
lyrata]
Length=1014

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 110/135 (81%), Gaps = 1/135 (1%)
 Frame = +3

Query  216  ESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLG  395
            +S+QLNDDVLGLIVFKS + DP SHL +W+EDD++PC+W++VKC+P   RV+E+ L+GL 
Sbjct  29   DSIQLNDDVLGLIVFKSDLNDPFSHLQSWNEDDNTPCSWSYVKCNPKTSRVTELSLNGLA  88

Query  396  LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  575
            L+GKI RG++KL+ L VLSL++NNF+G I+  L    NLQ L+LS N++SG +P SLG++
Sbjct  89   LTGKINRGIQKLQRLKVLSLSNNNFTGNIN-ALSTNNNLQKLDLSHNNLSGQIPSSLGSI  147

Query  576  SSLQFLDLSGNSLSG  620
            SSLQ LDL+GNS SG
Sbjct  148  SSLQHLDLTGNSFSG  162



>gb|EPS70115.1| hypothetical protein M569_04636, partial [Genlisea aurea]
Length=976

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 108/132 (82%), Gaps = 2/132 (2%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFKS V D  + LA+W+EDD+SPCAW FV+C P +GRV+ V L G+GLSGKI
Sbjct  2    NDDVLGLIVFKSAVVDARNRLASWNEDDESPCAWRFVECDPGSGRVTAVSLDGVGLSGKI  61

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  590
            GRGLEKL++L  LSL+ NNFSG +SP+L LL NLQ LNLS N ++G++P S+  +S LQF
Sbjct  62   GRGLEKLQYLRTLSLSGNNFSGSVSPELLLLPNLQKLNLSGNGLAGSLPPSV--VSKLQF  119

Query  591  LDLSGNSLSGPV  626
            LDLSGN+LSGP+
Sbjct  120  LDLSGNALSGPL  131


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +3

Query  360  GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  539
             R+  VDL G  LSG I  G+  +  L  LSL  N FSG +   +G   +L  L+LSKN 
Sbjct  191  ARLRTVDLSGNLLSGSIPGGISVVRSLKQLSLHGNQFSGPLPEDIGFCPHLTHLDLSKNQ  250

Query  540  ISGTVPDSLGNM-SSLQFLDLSGNSLSG  620
             +GT+P+SL N+ ++LQ LDLS N L+G
Sbjct  251  FTGTIPESLQNLTTTLQHLDLSNNFLTG  278



>emb|CDY20032.1| BnaA09g02190D [Brassica napus]
Length=1014

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 108/138 (78%), Gaps = 4/138 (3%)
 Frame = +3

Query  207  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  386
            G   S+QLNDDVLGLIV KS + DP+SHLA+W+EDD SPC+W++VKC+P   RV+E+ L 
Sbjct  25   GDTNSIQLNDDVLGLIVLKSDLHDPSSHLASWNEDDASPCSWSYVKCNPKTSRVTELSLS  84

Query  387  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  566
            GLGL+GKIGRG++KL+HL  LSL++NNF+G I   L    NLQ L+LS N++SGT+P SL
Sbjct  85   GLGLTGKIGRGIQKLQHLKTLSLSNNNFTGNIM-SLSNNNNLQKLDLSHNNLSGTIPSSL  143

Query  567  GNMSSLQFLDLSGNSLSG  620
            G   S ++LDL+GNS SG
Sbjct  144  G---STKYLDLTGNSFSG  158



>ref|NP_189443.2| probably inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
 sp|Q9LRT1.1|Y3804_ARATH RecName: Full=Probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01126.1| receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59324.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE77394.1| probably inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
Length=1016

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 109/138 (79%), Gaps = 1/138 (1%)
 Frame = +3

Query  207  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  386
            G  +S+QLNDDVLGLIVFKS + DP SHL +W+EDD++PC+W++VKC+P   RV E+ L 
Sbjct  26   GDTDSIQLNDDVLGLIVFKSDLNDPFSHLESWTEDDNTPCSWSYVKCNPKTSRVIELSLD  85

Query  387  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  566
            GL L+GKI RG++KL+ L VLSL++NNF+G I+  L    +LQ L+LS N++SG +P SL
Sbjct  86   GLALTGKINRGIQKLQRLKVLSLSNNNFTGNIN-ALSNNNHLQKLDLSHNNLSGQIPSSL  144

Query  567  GNMSSLQFLDLSGNSLSG  620
            G+++SLQ LDL+GNS SG
Sbjct  145  GSITSLQHLDLTGNSFSG  162



>ref|XP_010555906.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Tarenaya hassleriana]
Length=993

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 113/142 (80%), Gaps = 2/142 (1%)
 Frame = +3

Query  207  GGAESLQL-NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  383
            G   S+QL NDDVLGLIVFK+ ++DP+S+L +W+EDD SPC+W ++KC+P  GR+SEV L
Sbjct  24   GDVGSVQLLNDDVLGLIVFKADIEDPSSNLESWNEDDYSPCSWKYIKCNPVTGRISEVSL  83

Query  384  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  563
             GL LSGKIGRG++KL++L VLSL+ N+F+G+I   LG +++L+ L+LSKNS SG++PD 
Sbjct  84   DGLALSGKIGRGIQKLQYLKVLSLSDNDFTGIIPASLGSISSLKFLDLSKNSFSGSLPDD  143

Query  564  -LGNMSSLQFLDLSGNSLSGPV  626
             L N SSL++L L+ N L GP+
Sbjct  144  FLTNCSSLRYLSLAKNMLDGPI  165



>ref|XP_004492049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=1011

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = +3

Query  219  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            ++QLNDDVLGLI+FKS + DP SHL++W+EDD +PC+W ++KC+P N RV EV L GL L
Sbjct  33   AIQLNDDVLGLILFKSDLHDPFSHLSSWNEDDANPCSWQYIKCNPQNTRVIEVSLDGLSL  92

Query  399  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  578
            SGK+GRG EKL+HL  LSL+ NN SG ISP L L   LQ LNLS NS  G +P S  NMS
Sbjct  93   SGKLGRGFEKLQHLVSLSLSHNNLSGNISPFLTLSNTLQKLNLSHNSFHGEIPISFINMS  152

Query  579  SLQFLDLSGNSLSGPV  626
            S++ LDLS NS +G +
Sbjct  153  SIRLLDLSHNSFNGQI  168



>ref|XP_010555905.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Tarenaya hassleriana]
Length=1017

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = +3

Query  207  GGAESLQL-NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  383
            G   S+QL NDDVLGLIVFK+ ++DP+S+L +W+EDD SPC+W ++KC+P  GR+SEV L
Sbjct  24   GDVGSVQLLNDDVLGLIVFKADIEDPSSNLESWNEDDYSPCSWKYIKCNPVTGRISEVSL  83

Query  384  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  563
             GL LSGKIGRG++KL++L VLSL+ N+F+G + P++GLL+NLQ LNLS+N +SG +P S
Sbjct  84   DGLALSGKIGRGIQKLQYLKVLSLSDNDFTGNVIPEIGLLSNLQNLNLSQNRLSGIIPAS  143

Query  564  LGNMSSLQFLDLSGNSLSG  620
            LG++SSL+FLDLS NS SG
Sbjct  144  LGSISSLKFLDLSKNSFSG  162



>ref|XP_006395381.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum]
 gb|ESQ32667.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum]
Length=1018

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 112/138 (81%), Gaps = 1/138 (1%)
 Frame = +3

Query  207  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  386
            G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDDDSPC+W++VKC+P   RV+E+ L 
Sbjct  25   GDIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDDSPCSWSYVKCNPKTSRVTELSLD  84

Query  387  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  566
            GL L+GKIGRG++KL+HL VLSL++NNF+G I   L    +LQ L+LS N++SG +P SL
Sbjct  85   GLALTGKIGRGIQKLQHLKVLSLSNNNFTGSII-DLSNNNDLQKLDLSHNNLSGQIPSSL  143

Query  567  GNMSSLQFLDLSGNSLSG  620
            G+ SSL++LDL+GNS SG
Sbjct  144  GSRSSLRYLDLTGNSFSG  161



>ref|XP_009151898.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
 emb|CDX86452.1| BnaA06g31690D [Brassica napus]
Length=1011

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 106/138 (77%), Gaps = 4/138 (3%)
 Frame = +3

Query  207  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  386
            G  +S QLNDDVLGLIVFKS + DP+SHL++W+EDD SPC+W +VKC+P   RV+E+ L 
Sbjct  25   GDLDSTQLNDDVLGLIVFKSDLHDPSSHLSSWNEDDISPCSWTYVKCNPKTSRVTELSLS  84

Query  387  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  566
            GL L+GKIGRG++KL+HL VLSL++NN +G I+  L     LQ L+LS NS+SG +P SL
Sbjct  85   GLSLTGKIGRGIQKLQHLKVLSLSNNNLTGNIA-ALSNNNRLQKLDLSHNSLSGQIPSSL  143

Query  567  GNMSSLQFLDLSGNSLSG  620
               +SL+ LDL+GNS SG
Sbjct  144  ---TSLRHLDLTGNSFSG  158



>emb|CDY00141.1| BnaC09g01600D [Brassica napus]
Length=1013

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 106/138 (77%), Gaps = 4/138 (3%)
 Frame = +3

Query  207  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  386
            G   S+QLNDDVLGLIV KS + DP+SHLA+W+EDD SPC+W++VKC+P   RV+++ L 
Sbjct  25   GDNNSIQLNDDVLGLIVLKSDLHDPSSHLASWNEDDASPCSWSYVKCNPKTSRVTDLSLS  84

Query  387  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  566
            GLGL+G IGRG++KL+HL  LSL++NNF+G I   L    NLQ L+LS N++SGT+P SL
Sbjct  85   GLGLTGTIGRGIQKLQHLKTLSLSNNNFTGNIM-SLSNNNNLQRLDLSHNNLSGTIPFSL  143

Query  567  GNMSSLQFLDLSGNSLSG  620
            G   S + LDL+GNS SG
Sbjct  144  G---SAKHLDLTGNSFSG  158



>ref|XP_010502811.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 113/138 (82%), Gaps = 1/138 (1%)
 Frame = +3

Query  207  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  386
            G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDSIQLNDDVLGLIVFKSDLDDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  387  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  566
            GL L+GKIGRG++KL+HL VLSL++NNF+G ++  L    NL+ L+LS N++SG +P SL
Sbjct  87   GLALTGKIGRGIQKLQHLKVLSLSNNNFNGNLN-ALSTNNNLRKLDLSHNNLSGQIPSSL  145

Query  567  GNMSSLQFLDLSGNSLSG  620
            G++SSLQ LDL+GNS SG
Sbjct  146  GSISSLQHLDLTGNSFSG  163



>gb|KDP37890.1| hypothetical protein JCGZ_05772 [Jatropha curcas]
Length=1001

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 104/143 (73%), Gaps = 2/143 (1%)
 Frame = +3

Query  198  SGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  377
            + A     ++LNDDVLGLIVFK  + DP S L +W+EDDDSPC+W F+ C+P  GRVS V
Sbjct  22   AKANDEVPIKLNDDVLGLIVFKYDLIDPFSSLTSWNEDDDSPCSWKFISCNPVTGRVSHV  81

Query  378  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  557
             L  L LSGK+ +GL+KL+HL VLSL+ NNFSG I     ++  L+ LNLS NS+SG +P
Sbjct  82   LLDNLSLSGKLSKGLQKLQHLEVLSLSYNNFSGEIITDFPVIPTLENLNLSHNSLSGQLP  141

Query  558  DSLGNMSSLQFLDLSGNSLSGPV  626
             S+  M+S++FLDLS NSLSGP+
Sbjct  142  LSV--MTSIKFLDLSYNSLSGPL  162



>gb|KJB67930.1| hypothetical protein B456_010G218400 [Gossypium raimondii]
Length=698

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP   L++W+EDDD+PC W  +KC+P + RV+E++L G  LSG+
Sbjct  38   LNDDVLGLIVFKADIQDPTQKLSSWNEDDDTPCNWKGIKCNPRSNRVTELNLDGFSLSGR  97

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +LE L  LSLA+NN SG ISP +  L +L  ++LS+NS++G++PD       SL
Sbjct  98   IGRGLLQLEFLRKLSLANNNLSGTISPNMVKLESLIAIDLSENSLTGSIPDDFFKQCGSL  157

Query  585  QFLDLSGNSLSGPV  626
            +++ L+ N  SG +
Sbjct  158  RYISLANNHFSGKI  171



>gb|KJB67929.1| hypothetical protein B456_010G218400 [Gossypium raimondii]
Length=983

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 99/137 (72%), Gaps = 1/137 (1%)
 Frame = +3

Query  219  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            S  LNDDVLGLIVFK+ +QDP   L++W+EDDD+PC W  +KC+P + RV+E++L G  L
Sbjct  37   SPSLNDDVLGLIVFKADIQDPTQKLSSWNEDDDTPCNWKGIKCNPRSNRVTELNLDGFSL  96

Query  399  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNM  575
            SG+IGRGL +LE L  LSLA+NN SG ISP +  L +L  ++LS+NS++G++PD      
Sbjct  97   SGRIGRGLLQLEFLRKLSLANNNLSGTISPNMVKLESLIAIDLSENSLTGSIPDDFFKQC  156

Query  576  SSLQFLDLSGNSLSGPV  626
             SL+++ L+ N  SG +
Sbjct  157  GSLRYISLANNHFSGKI  173



>ref|XP_008244427.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Prunus mume]
Length=1009

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 116/135 (86%), Gaps = 1/135 (1%)
 Frame = +3

Query  225  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  404
            QLN+DVLGL+VFKS + DP+S+LA+W+EDDDSPC+W+FV+C+PA GRVS++ L GLGL G
Sbjct  32   QLNNDVLGLLVFKSDLHDPSSYLASWNEDDDSPCSWDFVQCNPATGRVSQLSLEGLGLLG  91

Query  405  KIGRGLEKLEHLNVLSLASNNFSGVISPqlgll-tnlqtlnlSKNSISGTVPDSLGNMSS  581
            +IG+GL+ L+HL VLSL++NNFSG IS +   L  NL++LNLS+NS+SG +P +L NMSS
Sbjct  92   RIGKGLQNLQHLKVLSLSNNNFSGDISTEKLALPPNLESLNLSRNSLSGLLPTALVNMSS  151

Query  582  LQFLDLSGNSLSGPV  626
            ++FLDLS NSLSGP+
Sbjct  152  IKFLDLSENSLSGPL  166



>ref|XP_007225370.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica]
 gb|EMJ26569.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica]
Length=986

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 116/135 (86%), Gaps = 1/135 (1%)
 Frame = +3

Query  225  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  404
            QLN+DVLGL+VFKS + DP+S+LA+W+EDDDSPC+W+FV+C+PA GRVS++ L GLGL G
Sbjct  9    QLNNDVLGLLVFKSDLHDPSSYLASWNEDDDSPCSWDFVQCNPATGRVSQLSLEGLGLLG  68

Query  405  KIGRGLEKLEHLNVLSLASNNFSGVISPqlgll-tnlqtlnlSKNSISGTVPDSLGNMSS  581
            +IG+GL+ L+HL VLSL++NNFSG IS +   L  NL++LNLS+NS+SG +P +L NMSS
Sbjct  69   RIGKGLQNLQHLKVLSLSNNNFSGDISTEKLALPPNLESLNLSRNSLSGLLPTALVNMSS  128

Query  582  LQFLDLSGNSLSGPV  626
            ++FLDLS NSLSGP+
Sbjct  129  IKFLDLSENSLSGPL  143



>ref|XP_010673272.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 105/145 (72%), Gaps = 2/145 (1%)
 Frame = +3

Query  195  TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  374
            +  A     + LNDDVLGLIVFKS + DP + L++W+EDD S C+W +++C+P+ GRV  
Sbjct  22   SQAANEDSEVGLNDDVLGLIVFKSDLHDPPA-LSSWTEDDGSSCSWKYIQCNPSTGRVIG  80

Query  375  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  554
            + L GLGLSG++G+GL+KL+ L VLSLA NN +G ISP+L  L  L TL+LS N  +G +
Sbjct  81   LSLTGLGLSGRLGKGLQKLQELKVLSLAKNNLTGEISPELAQLPKLHTLDLSFNKFTGQI  140

Query  555  PDSLGNM-SSLQFLDLSGNSLSGPV  626
            P S  N+ SSL++LDL+ N LSGP+
Sbjct  141  PTSFSNLGSSLRYLDLTQNVLSGPL  165



>gb|KHG03607.1| hypothetical protein F383_26757 [Gossypium arboreum]
Length=987

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ + DP   L++W+EDDD+PC W  +KC+P + RV+E++L G  LSG+
Sbjct  44   LNDDVLGLIVFKADILDPTQKLSSWNEDDDTPCNWKGIKCNPRSNRVTELNLDGFSLSGR  103

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +LE L  LSLA+NN SG ISP +  L +L  ++LS+NS++G++PD       SL
Sbjct  104  IGRGLLQLEFLRKLSLANNNLSGTISPNMVKLESLIAIDLSENSLTGSIPDEFFKQCGSL  163

Query  585  QFLDLSGNSLSGPV  626
            +++ L+ N  SG +
Sbjct  164  RYISLANNQFSGKI  177



>ref|XP_010931370.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=968

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +3

Query  213  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  392
            A S  LNDDVLGLIVFK+ +QDPAS LA+W+EDDD PC W  VKC P   RV+E++L G 
Sbjct  19   ATSGALNDDVLGLIVFKADLQDPASKLASWNEDDDDPCGWTGVKCSPRTNRVTELNLDGF  78

Query  393  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LG  569
             LSGKIGRGL +L+ L  LSL+ NNFSG ++P L  L +L +++LS+N +SG++PD    
Sbjct  79   SLSGKIGRGLLQLQSLRKLSLSRNNFSGSLNPNLSHLESLWSVDLSENHLSGSIPDEFFR  138

Query  570  NMSSLQFLDLSGNSLSGPV  626
               SL+ + L+ N  SG +
Sbjct  139  QCRSLRSVSLANNDFSGEI  157



>ref|XP_008350571.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=485

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+ DP + LA+WSEDD SPC W  VKC P  GRV+EV L G  LSG I
Sbjct  24   NDDVLGLIVFKAGLSDPEAKLASWSEDDGSPCNWAGVKCDPTTGRVAEVVLDGFSLSGHI  83

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +L++L  LSL+ NNF+G I+P L  L +LQ ++LS+NS+SG++P+       SL 
Sbjct  84   GRGLLRLQNLKKLSLSDNNFTGFINPDLPHLGSLQVIDLSRNSLSGSIPEEFFKQCGSLG  143

Query  588  FLDLSGNSLSGPV  626
             +  +GN+L+G +
Sbjct  144  VVSFAGNNLTGRI  156



>ref|XP_009403616.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LND+VLGLIVFK+ ++DP + LA+W+EDD +PC+W  V+C PA  RVS + L  L LSG 
Sbjct  30   LNDEVLGLIVFKAALEDPTAALASWNEDDSTPCSWAHVECDPATSRVSRLALDSLSLSGP  89

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  587
            + RGL++L  L  LSL++NN SG I P L LL  L++L+LS+N+ SG +PD L  + S++
Sbjct  90   LPRGLDRLPALVALSLSNNNLSGPIPPGLSLLPALRSLDLSRNAFSGGLPDDLARLPSIR  149

Query  588  FLDLSGNSLSGPV  626
             LDLS N+LSGP+
Sbjct  150  SLDLSSNALSGPL  162



>ref|XP_009372024.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=965

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+ DP + LA+WSEDD SPC W  VKC P  GRV+EV L G  LSG I
Sbjct  24   NDDVLGLIVFKAGLSDPEAKLASWSEDDGSPCNWAGVKCDPTTGRVAEVVLDGFSLSGHI  83

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +L++L  LSL+ NNF+G I+P L  L +L+ ++LS+NS+SG++P+       SL+
Sbjct  84   GRGLLRLQNLQKLSLSDNNFTGFINPDLPHLGSLRVIDLSRNSLSGSIPEEFFKQCGSLR  143

Query  588  FLDLSGNSLSGPV  626
             +  +GN+L+G +
Sbjct  144  VVSFAGNNLTGRI  156



>ref|XP_002275275.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=969

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 101/158 (64%), Gaps = 25/158 (16%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP S LA+W+EDDDSPC W  VKC+P + RV+++ L G  LSGK
Sbjct  26   LNDDVLGLIVFKADIQDPNSKLASWNEDDDSPCNWVGVKCNPRSNRVTDLVLDGFSLSGK  85

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD---------  560
            IGRGL +L+ L  LSLA NN +G I P L  L NL+ ++LS+NS+SGT+PD         
Sbjct  86   IGRGLLQLQFLRKLSLAKNNITGSIGPNLARLQNLRFIDLSENSLSGTIPDDFFKQCGSL  145

Query  561  ----------------SLGNMSSLQFLDLSGNSLSGPV  626
                            S+G+ S+L  +D S N  SGP+
Sbjct  146  HAISLAKNKFSGKIPESVGSCSTLAAIDFSSNQFSGPL  183



>ref|XP_009416321.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=969

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLI FK+G++DP S LA+W+E+D+ PC W+ +KC P + RV+ V L G  LSGK
Sbjct  26   LNDDVLGLIAFKAGIEDPRSKLASWNENDNDPCNWDGIKCDPKSNRVAVVALDGFALSGK  85

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            +GRGL +L+ L+ LSL+ NNFSG ++P    L +L+TL+LS N++SGT+PD   G   S+
Sbjct  86   LGRGLLRLQFLDTLSLSVNNFSGSVTPAFLRLESLRTLDLSANNLSGTIPDGFFGQCRSI  145

Query  585  QFLDLSGNSLSGPV  626
            + + L+ NS+SG +
Sbjct  146  RDISLAKNSISGKI  159



>gb|KJB73018.1| hypothetical protein B456_011G209800 [Gossypium raimondii]
Length=975

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 98/137 (72%), Gaps = 1/137 (1%)
 Frame = +3

Query  219  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            S  LNDDVLGLIVFK+ +QDP+  L++W+EDDD+PC W  VKC+P + RV+E++L G  L
Sbjct  28   SPSLNDDVLGLIVFKADIQDPSQKLSSWNEDDDTPCNWFGVKCNPRSSRVTELNLDGFTL  87

Query  399  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNM  575
            SG+IGRGL +L+ L  LSLA NN SG ISP L  L +L+ ++LS+NS+SG +PD      
Sbjct  88   SGRIGRGLLQLKFLRKLSLARNNLSGTISPNLAKLESLRIIDLSENSLSGFIPDDFFKQC  147

Query  576  SSLQFLDLSGNSLSGPV  626
             SL+ + L+ N  SG +
Sbjct  148  GSLRSISLANNRFSGKI  164



>gb|KHG09451.1| hypothetical protein F383_09289 [Gossypium arboreum]
Length=975

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 98/137 (72%), Gaps = 1/137 (1%)
 Frame = +3

Query  219  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            S  LNDDVLGLIVFK+ +QDP+  L++W+EDDD+PC W  VKC+P + RV+E++L G  L
Sbjct  28   SPSLNDDVLGLIVFKADIQDPSQKLSSWNEDDDTPCNWFGVKCNPRSSRVTELNLDGFTL  87

Query  399  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNM  575
            SG+IGRGL +L+ L  LSLA NN SG ISP L  L +L+ ++LS+NS+SG +PD      
Sbjct  88   SGRIGRGLLQLKFLRKLSLARNNLSGTISPNLAKLESLRIIDLSENSLSGFIPDDFFKQC  147

Query  576  SSLQFLDLSGNSLSGPV  626
             SL+ + L+ N  SG +
Sbjct  148  GSLRSISLANNRFSGKI  164



>ref|XP_011002596.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            +NDDVLGLIVFK+G+QDP S L++W+EDDDSPC W  VKC P   RV+E+ L G  LSG 
Sbjct  23   INDDVLGLIVFKAGLQDPESKLSSWNEDDDSPCNWVGVKCDPNTHRVTELVLDGFSLSGH  82

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L VLSLA+NNF+G I+P L  L  LQ ++LS+NS+SG++PD       SL
Sbjct  83   IGRGLLRLQFLQVLSLANNNFNGTINPDLPRLGGLQVIDLSENSLSGSIPDGFFQQCGSL  142

Query  585  QFLDLSGNSLSGPV  626
            + +  + N L+G +
Sbjct  143  RSVSFARNDLTGMI  156



>ref|XP_006486161.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=975

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP   L++WSEDDD+PC W  VKC P + RV E+ L+GL L+G+
Sbjct  32   LNDDVLGLIVFKADIQDPNGKLSSWSEDDDTPCNWFGVKCSPRSNRVIELTLNGLSLTGR  91

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L  LSL+SNN +G ISP L  L NL+ ++LS NS+SG++PD       SL
Sbjct  92   IGRGLLQLQFLRKLSLSSNNLTGSISPNLAKLQNLRVIDLSGNSLSGSIPDEFFKQCGSL  151

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N  SG +
Sbjct  152  RVISLAKNRFSGKI  165



>ref|XP_006435929.1| hypothetical protein CICLE_v10030625mg [Citrus clementina]
 gb|ESR49169.1| hypothetical protein CICLE_v10030625mg [Citrus clementina]
Length=997

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP   L++WSEDDD+PC W  VKC P + RV E+ L+GL L+G+
Sbjct  54   LNDDVLGLIVFKADIQDPNGKLSSWSEDDDTPCNWFGVKCSPRSNRVIELTLNGLSLTGR  113

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L  LSL+SNN +G ISP L  L NL+ ++LS NS+SG++PD       SL
Sbjct  114  IGRGLLQLQFLRKLSLSSNNLTGSISPNLAKLQNLRVIDLSGNSLSGSIPDEFFKQCGSL  173

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N  SG +
Sbjct  174  RVISLAKNRFSGKI  187



>gb|KDO67528.1| hypothetical protein CISIN_1g002321mg [Citrus sinensis]
Length=936

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP   L++WSEDDD+PC W  VKC P + RV E+ L+GL L+G+
Sbjct  32   LNDDVLGLIVFKADIQDPNGKLSSWSEDDDTPCNWFGVKCSPRSNRVIELTLNGLSLTGR  91

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L  LSL+SNN +G ISP L  L NL+ ++LS NS+SG++PD       SL
Sbjct  92   IGRGLLQLQFLRKLSLSSNNLTGSISPNLAKLQNLRVIDLSGNSLSGSIPDEFFKQCGSL  151

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N  SG +
Sbjct  152  RVISLAKNRFSGKI  165



>ref|XP_007220278.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica]
 gb|EMJ21477.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica]
Length=969

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP   LATWSEDDDSPC W+ VKCHP + RV E+ L    LSG 
Sbjct  25   LNDDVLGLIVFKADIQDPKGKLATWSEDDDSPCKWDGVKCHPRSNRVIELSLDDFSLSGH  84

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  584
            IGRGL +L+ L  LSL+ NN +G ++P +  + NL+ L+LS+NS SG VP D      SL
Sbjct  85   IGRGLLQLQSLRKLSLSKNNLTGSLTPNIAHIDNLRALDLSENSFSGPVPEDFFRQCGSL  144

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N +SG +
Sbjct  145  RTISLAKNKISGKI  158



>ref|XP_008233886.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Prunus mume]
Length=975

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP   LATWSEDDDSPC W+ VKCHP + RV E+ L    LSG 
Sbjct  31   LNDDVLGLIVFKADIQDPKGKLATWSEDDDSPCKWDGVKCHPRSNRVIELSLDDFSLSGH  90

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  584
            +GRGL +L+ L  LSL+ NN +G ++P +  + NL+ L+LS+NS SG VP D      SL
Sbjct  91   VGRGLLQLQSLRKLSLSKNNLTGSLTPNIAHIDNLRALDLSENSFSGPVPEDFFRQCGSL  150

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N +SG +
Sbjct  151  RTISLAKNKISGKI  164



>ref|XP_002323672.2| hypothetical protein POPTR_0016s14410g [Populus trichocarpa]
 gb|EEF05433.2| hypothetical protein POPTR_0016s14410g [Populus trichocarpa]
Length=965

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            +NDDVLGLIVFK+G+QDP S L++W+EDDDSPC W  VKC P   RV+E+ L G  LSG 
Sbjct  23   INDDVLGLIVFKAGLQDPESKLSSWNEDDDSPCNWVGVKCDPNTHRVTELVLDGFSLSGH  82

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L VLSLA+NNF+G I+P L  L  LQ ++LS+N +SG++PD       SL
Sbjct  83   IGRGLLRLQFLQVLSLANNNFNGTINPDLPRLGGLQVIDLSENGLSGSIPDGFFQQCGSL  142

Query  585  QFLDLSGNSLSG  620
            + +  + N L+G
Sbjct  143  RSVSFARNDLTG  154



>ref|XP_007207150.1| hypothetical protein PRUPE_ppa000904mg [Prunus persica]
 gb|EMJ08349.1| hypothetical protein PRUPE_ppa000904mg [Prunus persica]
Length=965

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G++DP + L +WSEDD++PC+W  VKC P   RVSE+ L G  LSG +
Sbjct  24   NDDVLGLIVFKAGLRDPKAKLTSWSEDDNNPCSWVGVKCDPRTNRVSELVLDGFSLSGHV  83

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +L+ L +LSLA+NNF+G I+P L  L +LQ ++LS+NS+SG +PD       SL+
Sbjct  84   GRGLLRLQFLQILSLANNNFTGTINPDLPHLGSLQVIDLSQNSLSGPIPDEFFMQCGSLR  143

Query  588  FLDLSGNSLSGPV  626
             +  + N+L+G +
Sbjct  144  VVSFARNNLTGQI  156



>ref|XP_008244834.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Prunus mume]
Length=965

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G++DP + L +WSEDD++PC+W  VKC P   RVSE+ L G  LSG +
Sbjct  24   NDDVLGLIVFKAGLRDPKAKLTSWSEDDNNPCSWVGVKCDPRTNRVSELVLDGFSLSGHV  83

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +L+ L +LSLA+NNF+G I+P L  L +LQ ++LS+NS+SG +PD       SL+
Sbjct  84   GRGLLRLQFLQILSLANNNFTGTINPDLPHLGSLQVIDLSQNSLSGPIPDEFFMQCGSLR  143

Query  588  FLDLSGNSLSGPV  626
             +  + N+L+G +
Sbjct  144  VVSFARNNLTGQI  156



>ref|XP_002309183.1| hypothetical protein POPTR_0006s10910g [Populus trichocarpa]
 gb|EEE92706.1| hypothetical protein POPTR_0006s10910g [Populus trichocarpa]
Length=965

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+QDP S L++W+EDDDSPC+W  VKC P   RV+E+ L G  LSG I
Sbjct  25   NDDVLGLIVFKAGLQDPESKLSSWNEDDDSPCSWVGVKCEPNTHRVTELFLDGFSLSGHI  84

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +L+ L VLSLA+N F+G I+P L  L  LQ ++LS NS+SG++PD       SL+
Sbjct  85   GRGLLRLQFLQVLSLANNKFNGTINPDLPRLGGLQVIDLSDNSLSGSIPDGFFQQCGSLR  144

Query  588  FLDLSGNSLSGPV  626
             +  + N L+G +
Sbjct  145  SVSFARNDLTGMI  157



>ref|XP_008788529.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Phoenix dactylifera]
Length=968

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIV K+ ++DPAS LA+W+EDDD PC W  V C P   RV+E++L G  LSGK
Sbjct  24   LNDDVLGLIVLKADLEDPASKLASWNEDDDDPCGWVGVTCSPRTNRVTELNLDGFSLSGK  83

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L  LSL+ NNFSG ++P L  L +L +++LS+N++SG++PD       SL
Sbjct  84   IGRGLLQLQSLRKLSLSKNNFSGSLNPNLSQLESLSSVDLSENNLSGSIPDEFFRQCRSL  143

Query  585  QFLDLSGNSLSGPV  626
              + L+ N+ SG +
Sbjct  144  SSISLANNAFSGEI  157


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 55/91 (60%), Gaps = 8/91 (9%)
 Frame = +3

Query  378  DLHGL--------GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSK  533
            ++HGL         LSG +   L +L+ L VL L+ N  +G I P++G   +L  LNL K
Sbjct  402  NIHGLQFLNLSWNSLSGSMPASLGELKSLQVLDLSGNRLNGSIPPEIGEAVSLNELNLHK  461

Query  534  NSISGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
            NS++G +P  +GN SSL  L LS N+L+GPV
Sbjct  462  NSLTGGIPTQIGNCSSLASLILSQNNLTGPV  492



>gb|ACN33819.1| unknown [Zea mays]
 tpg|DAA55768.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1043

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +3

Query  222  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  401
            + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  34   MAVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWARVECDPATSRVLRLALDGLALS  93

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  581
            G++ RGL++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++S
Sbjct  94   GRMPRGLDRLGALQDLSLARNNLSGPLPPGLSLLGSLRSLDLSYNAFSGPLPDDVARLAS  153

Query  582  LQFLDLSGNSLSGPV  626
            L++LDL+GN+ SGP+
Sbjct  154  LRYLDLTGNAFSGPL  168


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = +3

Query  363  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  542
            R+  +DL     SG +  G+ +L +L  LSL+ N F G +   +G   +L T++LS N+ 
Sbjct  226  RLRTLDLSHNLFSGPVTDGIARLHNLKTLSLSGNRFFGAVPADIGRCPHLSTIDLSSNAF  285

Query  543  SGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
             G +PDS+G ++SL +L  SGN LSG V
Sbjct  286  DGHLPDSIGQLASLVYLSASGNRLSGDV  313



>ref|XP_010253067.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=970

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP S L +W+EDDDSPC W  VKC P   RVSE+ L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLQDPESKLISWNEDDDSPCNWVGVKCDPRTNRVSELVLDGFSLSGR  84

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG-NMSSL  584
            IGRGL +L+ L  LSL++NNF+G I+P L  L  L+ ++LS NS+SG+ PD       SL
Sbjct  85   IGRGLLQLQFLRKLSLSNNNFTGSINPNLARLEGLRIIDLSDNSLSGSTPDDFFLQCGSL  144

Query  585  QFLDLSGNSLSGPV  626
            + +  + N+LSG +
Sbjct  145  RAISFAKNNLSGQI  158



>ref|XP_008672259.1| PREDICTED: uncharacterized protein LOC100216746 isoform X1 [Zea 
mays]
Length=1150

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +3

Query  222  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  401
            + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  141  MAVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWARVECDPATSRVLRLALDGLALS  200

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  581
            G++ RGL++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++S
Sbjct  201  GRMPRGLDRLGALQDLSLARNNLSGPLPPGLSLLGSLRSLDLSYNAFSGPLPDDVARLAS  260

Query  582  LQFLDLSGNSLSGPV  626
            L++LDL+GN+ SGP+
Sbjct  261  LRYLDLTGNAFSGPL  275


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = +3

Query  363  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  542
            R+  +DL     SG +  G+ +L +L  LSL+ N F G +   +G   +L T++LS N+ 
Sbjct  333  RLRTLDLSHNLFSGPVTDGIARLHNLKTLSLSGNRFFGAVPADIGRCPHLSTIDLSSNAF  392

Query  543  SGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
             G +PDS+G ++SL +L  SGN LSG V
Sbjct  393  DGHLPDSIGQLASLVYLSASGNRLSGDV  420



>ref|XP_011019006.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGL+VFK+G+QDP S L++W+EDDDSPC+W  VKC P   RV+E+ L G  LSG 
Sbjct  24   LNDDVLGLMVFKAGLQDPESKLSSWNEDDDSPCSWVGVKCEPNTHRVTELFLDGFSLSGH  83

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L VLSLA+N F+G ++P L  L  LQ ++LS NS+SG++PD       SL
Sbjct  84   IGRGLLRLQFLQVLSLANNKFNGTVNPDLPRLGGLQVIDLSDNSLSGSIPDGFFQQCGSL  143

Query  585  QFLDLSGNSLSG  620
            + +  + N L+G
Sbjct  144  RSVSFARNDLTG  155



>ref|XP_008792235.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=968

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIV K+ +QDP S L +WSEDDD PC W  VKC+P   RV+E++L G  LSGK
Sbjct  24   LNDDVLGLIVLKADLQDPTSKLLSWSEDDDDPCGWIGVKCNPRTNRVTELNLDGFSLSGK  83

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L  LSL+ NNFSG ++P L  L +L +++LS+N++SG++PD       SL
Sbjct  84   IGRGLLQLQSLRKLSLSRNNFSGSLNPNLSQLESLWSVDLSENNLSGSIPDVFFRQCRSL  143

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N  SG +
Sbjct  144  RSISLANNDFSGEI  157



>ref|XP_011019007.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGL+VFK+G+QDP S L++W+EDDDSPC+W  VKC P   RV+E+ L G  LSG 
Sbjct  24   LNDDVLGLMVFKAGLQDPESKLSSWNEDDDSPCSWVGVKCEPNTHRVTELFLDGFSLSGH  83

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L VLSLA+N F+G ++P L  L  LQ ++LS NS+SG++PD       SL
Sbjct  84   IGRGLLRLQFLQVLSLANNKFNGTVNPDLPRLGGLQVIDLSDNSLSGSIPDGFFQQCGSL  143

Query  585  QFLDLSGNSLSG  620
            + +  + N L+G
Sbjct  144  RSVSFARNDLTG  155



>ref|XP_009406870.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
 ref|XP_009406871.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=969

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+GV+DP S LA+W+EDD  PC W  V+C   + RV+E+ L G  LSGK
Sbjct  26   LNDDVLGLIVFKAGVEDPRSKLASWNEDDVDPCNWAGVRCDAKSNRVTELALDGFALSGK  85

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            +GRGL  L+ L  LSL+ NNFSG +SP L  L +L+TL+LS N +SGT+PD   G   S+
Sbjct  86   LGRGLLWLQFLETLSLSMNNFSGSLSPDLLRLESLRTLDLSANHLSGTIPDGFFGQCRSI  145

Query  585  QFLDLSGNSLSGPV  626
            + + L+ NS+SG +
Sbjct  146  RDISLAKNSISGKI  159



>ref|NP_191196.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 emb|CAB88040.1| putative protein [Arabidopsis thaliana]
 dbj|BAB85646.1| inflorescence and root apices receptor-like kinase [Arabidopsis 
thaliana]
 dbj|BAB85647.1| inflorescence and root apices receptor-like kinase [Arabidopsis 
thaliana]
 gb|ACN59335.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE79514.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=964

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+WN VKCHP   RV+E++L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFSLSGR  84

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPql-glltnlqtlnlSKNSISGTVPDS-LGNMSS  581
            IGRGL +L+ L+ LSL++NN +G+I+P +   L NL+ ++LS N +SG++PD       S
Sbjct  85   IGRGLLQLQFLHKLSLSNNNLTGIINPNMLLSLVNLKVVDLSSNGLSGSLPDEFFRQCGS  144

Query  582  LQFLDLSGNSLSGPV  626
            L+ L L+ N L+G +
Sbjct  145  LRVLSLAKNKLTGKI  159



>ref|XP_010253073.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=970

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 98/158 (62%), Gaps = 25/158 (16%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP S L +W+EDDDSPC W  VKC P   RVSE+ L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLQDPDSKLISWNEDDDSPCNWVGVKCDPKTNRVSELVLEGFSLSGR  84

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD---------  560
            IGRG+ +L+ L  LSL++NNF+G I+P L  L  L+ ++LS N +SG +PD         
Sbjct  85   IGRGVLQLKFLRKLSLSNNNFTGTINPNLARLEGLRVIDLSDNRLSGPIPDDFFRQCGSL  144

Query  561  ----------------SLGNMSSLQFLDLSGNSLSGPV  626
                            +LG+ S+L  L+ S N LSGP+
Sbjct  145  REMSFARNNLSGQIPQNLGSCSTLATLNFSSNQLSGPL  182



>ref|XP_002972654.1| hypothetical protein SELMODRAFT_98598 [Selaginella moellendorffii]
 gb|EFJ25875.1| hypothetical protein SELMODRAFT_98598 [Selaginella moellendorffii]
Length=927

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 94/137 (69%), Gaps = 4/137 (3%)
 Frame = +3

Query  210  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  389
            G E++  NDDVLGL+VFK+G+QDP   LA+WSE D SPC W  ++C  A+GRV  V L G
Sbjct  40   GDETVSWNDDVLGLLVFKAGLQDPRGSLASWSEADSSPCNWTGIRCGSASGRVESVSLDG  99

Query  390  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  569
            L LSG IGRGL KLE L  LSL++NN SG + P   L   L  ++L KN +SG +P  +G
Sbjct  100  LALSGTIGRGLLKLERLKTLSLSANNLSGNVVP--ELFRMLDFVDLKKNRLSGELPSPMG  157

Query  570  NMSSLQFLDLSGNSLSG  620
              +S++++DLS N+ +G
Sbjct  158  --ASIRYVDLSDNAFTG  172



>ref|XP_002459131.1| hypothetical protein SORBIDRAFT_03g046350 [Sorghum bicolor]
 gb|EES04251.1| hypothetical protein SORBIDRAFT_03g046350 [Sorghum bicolor]
Length=1059

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = +3

Query  222  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  401
            + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  33   MAVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWARVECDPATSRVLRLALDGLALS  92

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  581
            G + RGL++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++S
Sbjct  93   GSMPRGLDRLPALQDLSLARNNLSGPLPPGLSLLGSLRSLDLSYNAFSGPLPDDVARLAS  152

Query  582  LQFLDLSGNSLSGPV  626
            L++LDL+GN+ SGP+
Sbjct  153  LRYLDLTGNAFSGPL  167


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 0/88 (0%)
 Frame = +3

Query  363  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  542
            R+  +DL     SG +  G+ +L +L  LSL+ N FSG +   +GL  +L T++LS N+ 
Sbjct  225  RLRTLDLSRNQFSGPVTDGIARLHNLKTLSLSGNRFSGAVPADIGLCPHLSTIDLSSNAF  284

Query  543  SGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
             G +PDS+G + SL +L  SGN LSG V
Sbjct  285  DGHLPDSIGQLGSLVYLSASGNRLSGDV  312



>ref|XP_010921154.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Elaeis guineensis]
Length=969

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  +KC P   RV+E+ L+G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPDSKLVSWNEDDDDPCCWTGIKCDPKTNRVTELSLNGFSLSGK  85

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L  LSL+ NNFSG +S  L  L +L+ L+LS+N +SG +PD   G   S+
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGTLSSDLLRLESLRNLDLSENKLSGPIPDDFFGQCRSI  145

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N+  G +
Sbjct  146  RAISLAKNAFFGAI  159


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +3

Query  435  HLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSL  614
            +L VL L+SN FSG I P +  + +LQ LNLS NS SG++P+ LG + SL+ LDLSGN L
Sbjct  383  NLQVLVLSSNAFSGKIPPPVSNVRSLQFLNLSWNSFSGSIPEGLGKLKSLEVLDLSGNRL  442

Query  615  SGPV  626
            +G +
Sbjct  443  NGSI  446



>ref|XP_010922754.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=968

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +3

Query  213  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  392
            A S  LNDDVLGLIVFK+ +QDP S L +W+EDD+ PC W  + C+P   RV+E++L G 
Sbjct  19   AMSGALNDDVLGLIVFKADLQDPTSKLTSWNEDDNDPCGWMGITCNPTTNRVTELNLDGF  78

Query  393  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LG  569
             LSGKIGRGL +L+ L  LSL+ NNFSG ++P L  L +L T++LS+N++SG++PD    
Sbjct  79   SLSGKIGRGLLQLQSLRKLSLSKNNFSGSLNPNLSRLESLWTVDLSENNLSGSIPDEFFQ  138

Query  570  NMSSLQFLDLSGNSLSGPV  626
               SL+ + L+ N+ SG +
Sbjct  139  QCRSLRTILLANNAFSGEI  157



>ref|XP_010921155.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Elaeis guineensis]
Length=945

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  +KC P   RV+E+ L+G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPDSKLVSWNEDDDDPCCWTGIKCDPKTNRVTELSLNGFSLSGK  85

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L  LSL+ NNFSG +S  L  L +L+ L+LS+N +SG +PD   G   S+
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGTLSSDLLRLESLRNLDLSENKLSGPIPDDFFGQCRSI  145

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N+  G +
Sbjct  146  RAISLAKNAFFGAI  159



>ref|XP_003521989.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=970

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 95/136 (70%), Gaps = 1/136 (1%)
 Frame = +3

Query  222  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  401
            L  NDDVLGLI+FK+G+QDP   L+TW+EDD SPC W  VKC PAN RVS + L G  LS
Sbjct  28   LSFNDDVLGLIMFKAGLQDPKGKLSTWNEDDYSPCHWVGVKCDPANNRVSSLVLDGFSLS  87

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS-  578
            G I RGL +L+ L +LSL+ NNF+G I+P L  + +L  ++LS+N++SG +PD +     
Sbjct  88   GHIDRGLLRLQFLQILSLSRNNFTGTIAPDLLTIGDLLVVDLSENNLSGPIPDGIFQQCW  147

Query  579  SLQFLDLSGNSLSGPV  626
            SL+ +  + N+L+G V
Sbjct  148  SLRVVSFANNNLTGKV  163



>gb|EAY77289.1| hypothetical protein OsI_05265 [Oryza sativa Indica Group]
Length=1013

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 100/144 (69%), Gaps = 0/144 (0%)
 Frame = +3

Query  195  TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  374
             + A     + +N++VLGL+VFKS + DP+  LATW+E D +PC W  V+C PA  RV  
Sbjct  15   AAAADSTMPMPVNEEVLGLVVFKSALSDPSGALATWTESDATPCGWAHVECDPATSRVLR  74

Query  375  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  554
            + L GLGLSG++ RGL++L  L  LS+A NN SG + P L LL +L++++LS N+ SG +
Sbjct  75   LALDGLGLSGRMPRGLDRLAALQSLSVARNNLSGELPPGLSLLASLRSIDLSYNAFSGPL  134

Query  555  PDSLGNMSSLQFLDLSGNSLSGPV  626
            P  +  ++SL++LDL+GN+ SGP+
Sbjct  135  PGDVPLLASLRYLDLTGNAFSGPL  158



>ref|XP_002878081.1| hypothetical protein ARALYDRAFT_907079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54340.1| hypothetical protein ARALYDRAFT_907079 [Arabidopsis lyrata subsp. 
lyrata]
Length=964

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+WN VKCHP   RV+E++L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFSLSGR  84

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPq-lglltnlqtlnlSKNSISGTVPDS-LGNMSS  581
            IGRGL +L+ L+ LSL++NN +G+I+P  L  L NL+ ++LS N +SG++PD       S
Sbjct  85   IGRGLLQLQFLHKLSLSNNNLTGIINPNLLLSLVNLKVVDLSSNGLSGSLPDGFFRQCGS  144

Query  582  LQFLDLSGNSLSGPV  626
            L+ L L+ N L+G +
Sbjct  145  LRVLSLAKNKLTGKI  159



>ref|XP_002267737.3| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=993

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+QDP S L +W+EDD++PC W  VKC     RVSE+ L    LSG+I
Sbjct  51   NDDVLGLIVFKAGLQDPESKLISWNEDDNNPCNWAGVKCDRQTNRVSELLLDNFSLSGRI  110

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +L+ L +LSL+ NNF+G I+P L  + +L+ ++LS+N++SG +PD       SL 
Sbjct  111  GRGLLRLQFLRILSLSKNNFTGTINPSLARIASLRVIDLSENNLSGPIPDEFFRQCGSLI  170

Query  588  FLDLSGNSLSGPV  626
             + L+GN LSG +
Sbjct  171  VVSLAGNKLSGQI  183



>dbj|BAB92869.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 gb|EAZ14887.1| hypothetical protein OsJ_04818 [Oryza sativa Japonica Group]
Length=1013

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 100/144 (69%), Gaps = 0/144 (0%)
 Frame = +3

Query  195  TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  374
             + A     + +N++VLGL+VFKS + DP+  LATW+E D +PC W  V+C PA  RV  
Sbjct  15   AAAADSTMPMPVNEEVLGLVVFKSALSDPSGALATWTESDATPCGWAHVECDPATSRVLR  74

Query  375  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  554
            + L GLGLSG++ RGL++L  L  LS+A NN SG + P L LL +L++++LS N+ SG +
Sbjct  75   LALDGLGLSGRMPRGLDRLAALQSLSVARNNLSGELPPGLSLLASLRSIDLSYNAFSGPL  134

Query  555  PDSLGNMSSLQFLDLSGNSLSGPV  626
            P  +  ++SL++LDL+GN+ SGP+
Sbjct  135  PGDVPLLASLRYLDLTGNAFSGPL  158



>ref|XP_007011288.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY20098.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=982

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 96/137 (70%), Gaps = 1/137 (1%)
 Frame = +3

Query  219  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            S  LNDDVLGLIVFK+ + DP   L++W+EDDD+PC W  VKC+P   RV+E++L G  L
Sbjct  35   SPSLNDDVLGLIVFKADILDPNQKLSSWNEDDDTPCNWFGVKCNPRLNRVTELNLDGFSL  94

Query  399  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNM  575
            SG+IGRGL +LE L  LSLA NN +G ISP L  L +L+ ++LS+NS+SG++PD      
Sbjct  95   SGRIGRGLLQLEFLRKLSLAKNNLTGSISPNLAKLESLRIIDLSENSLSGSIPDDFFKQC  154

Query  576  SSLQFLDLSGNSLSGPV  626
             S++ + L+ N  SG +
Sbjct  155  GSVRSISLANNRFSGKI  171



>ref|XP_010929848.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=1011

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 97/141 (69%), Gaps = 0/141 (0%)
 Frame = +3

Query  204  AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  383
            A G     LND+VLGLIVFKS ++DP + LA+WSE D +PC W  V+C PA   V  + L
Sbjct  27   ADGDLPTPLNDEVLGLIVFKSALEDPTAALASWSETDANPCGWAHVECDPATSHVLRLYL  86

Query  384  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  563
              L LSG + RGL++L +L  LS+++NN SG++   L LL  L +L+LS+N+ SG +P  
Sbjct  87   DSLSLSGPLPRGLDRLPYLETLSISNNNLSGLLPAGLSLLPRLHSLDLSRNAFSGRLPQD  146

Query  564  LGNMSSLQFLDLSGNSLSGPV  626
            LGN+ SL+ +DLS NSLSGP+
Sbjct  147  LGNIPSLRSVDLSSNSLSGPI  167



>ref|NP_001290509.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At3g28040 precursor [Elaeis guineensis]
 gb|AAO26311.1| receptor-like protein kinase [Elaeis guineensis]
Length=938

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +++P S L +W+EDDD PC W  +KC P   RV+E+ L+G  LSGK
Sbjct  26   LNDDVLGLIVFKADLREPDSKLVSWNEDDDEPCCWTGIKCEPKTNRVTELSLNGFSLSGK  85

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L  LSL+ NNFSG +S  L  L +L+ L+LS+N +SG +PD   G   S+
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGTLSSDLLRLESLRNLDLSENKLSGPIPDDFFGQCRSI  145

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N+  G +
Sbjct  146  RAISLAKNAFFGAI  159



>ref|XP_004971314.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=1029

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +3

Query  222  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  401
            + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  38   MPVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWRRVECDPATSRVLRLSLDGLALS  97

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  581
            G + RGL++L  L  L+LA NN SG + P L LLT+L++L+LS N+ SG +PD +  ++S
Sbjct  98   GPMPRGLDRLPALQELTLARNNLSGPLPPGLSLLTSLRSLDLSYNAFSGPLPDDVALLAS  157

Query  582  LQFLDLSGNSLSGPV  626
            L++LDL+GN+ SGP+
Sbjct  158  LRYLDLTGNAFSGPL  172



>ref|XP_002520879.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF41588.1| ATP binding protein, putative [Ricinus communis]
Length=963

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 98/140 (70%), Gaps = 1/140 (1%)
 Frame = +3

Query  210  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  389
            G+ +  LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L  
Sbjct  22   GSLTPSLNDDVLGLIVFKADLQDPKGKLSSWNQDDDTPCNWVGVKCNPRSNRVTELTLDD  81

Query  390  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-L  566
              LSG+IGRGL +L+ L+ LSLA NN SG ISP L  L NL+ ++LS+NS+SG +PD   
Sbjct  82   FSLSGRIGRGLLQLQFLHKLSLARNNLSGNISPNLARLANLRIIDLSENSLSGPIPDDFF  141

Query  567  GNMSSLQFLDLSGNSLSGPV  626
                SL+ + L+ N  SG +
Sbjct  142  QQCGSLRVISLAKNKFSGKI  161



>ref|XP_010427454.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Camelina sativa]
 ref|XP_010427455.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Camelina sativa]
Length=967

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+
Sbjct  28   LNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGR  87

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPq-lglltnlqtlnlSKNSISGTVPDS-LGNMSS  581
            IGRGL +L+ L+ LSL++NN +GVI+P  L  L NL+ ++LS N++SG++PD       S
Sbjct  88   IGRGLLQLQFLHKLSLSNNNLTGVINPNFLLSLVNLKVVDLSSNALSGSLPDEFFKQCGS  147

Query  582  LQFLDLSGNSLSGPV  626
            L+ L L+ N L+G +
Sbjct  148  LRVLSLAKNKLTGKI  162



>ref|XP_009402208.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=974

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ + DP S LA+W+ED+D PC W  VKC+    RV+E+ L G  LSGK
Sbjct  32   LNDDVLGLIVFKADILDPLSKLASWNEDEDDPCGWTGVKCNAKTNRVTELSLVGFSLSGK  91

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ +  L L+ NNFSG ++P+L  L +L+ ++LS+N++SG +PD   G   SL
Sbjct  92   IGRGLLQLQSIQKLYLSKNNFSGSLNPKLSQLESLRVVDLSENNLSGVIPDEFFGQCRSL  151

Query  585  QFLDLSGNSLSGPV  626
            + L L+ N+ +G +
Sbjct  152  RSLSLANNAFTGHI  165



>gb|KFK34877.1| Leucine-rich repeat protein kinase family protein [Arabis alpina]
Length=964

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ ++DP   LA+WSEDD SPC+WN VKCHP   RV+E+ L G  LSG+
Sbjct  26   LNDDVLGLIVFKADLRDPEQKLASWSEDDYSPCSWNGVKCHPRTNRVTELTLDGFSLSGR  85

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPq-lglltnlqtlnlSKNSISGTVPDS-LGNMSS  581
            IGRGL +L+ L+ LS+++NN +G+I+P  L  L NL+ ++LS N +SG++PD       S
Sbjct  86   IGRGLLQLQFLHKLSMSNNNLTGIINPNLLLSLVNLKVVDLSSNGLSGSLPDGFFRQCGS  145

Query  582  LQFLDLSGNSLSGPV  626
            L+   L+ N L G +
Sbjct  146  LRVFSLAKNELMGKI  160



>ref|XP_006357297.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=971

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 94/139 (68%), Gaps = 1/139 (1%)
 Frame = +3

Query  213  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  392
            A +L  NDD+LGL+VFK+ VQDP   L +W+E+DDSPC WN + C+P + RVS++ L G 
Sbjct  23   ALNLSFNDDILGLMVFKADVQDPQGKLVSWNEEDDSPCGWNGIHCNPRSNRVSQIVLDGF  82

Query  393  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLG  569
            GLSGKI RGL +L+ L  LSLA NNF+G IS  +  L  L+ L+LS+N++ GT+P D   
Sbjct  83   GLSGKISRGLMRLQFLRKLSLAKNNFTGSISSSVVQLAYLRILDLSENNLFGTIPGDFFE  142

Query  570  NMSSLQFLDLSGNSLSGPV  626
                L+ + L+ N  SG V
Sbjct  143  QCGPLRSISLAKNKFSGKV  161



>ref|XP_004137674.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 ref|XP_004160330.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN58686.1| hypothetical protein Csa_3G728030 [Cucumis sativus]
Length=959

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+QDP   L TW+EDD++PC W  VKC+P   RVSE+ L G  LSG I
Sbjct  24   NDDVLGLIVFKAGLQDPMGKLVTWNEDDETPCNWFGVKCNPKTNRVSELVLDGFSLSGHI  83

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG-NMSSLQ  587
            GRGL +L+ L +LSLA+NNF+G I+  L  L NLQ ++LS NS+SG +P+ L     S++
Sbjct  84   GRGLLRLQFLQILSLANNNFTGTINSALSHLGNLQVIDLSDNSLSGPIPEQLFLQCGSIR  143

Query  588  FLDLSGNSLSGPV  626
             L  + N+L G +
Sbjct  144  VLSFARNNLIGNI  156



>ref|XP_010067617.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW65785.1| hypothetical protein EUGRSUZ_G03140 [Eucalyptus grandis]
Length=972

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ VQDP   LA+W EDDD+PC W   KC+P + RV E++L G  LSG 
Sbjct  27   LNDDVLGLIVFKADVQDPKGKLASWDEDDDNPCNWVGCKCNPRSNRVVELNLDGFSLSGH  86

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            +GRGL +L+ L  LSLA NN +G IS  +  + NL+ L+LS+NS+SGT+PD       SL
Sbjct  87   LGRGLLQLQFLRKLSLAKNNLTGSISSSIARIDNLRVLDLSENSLSGTIPDEFFRQCGSL  146

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N  SG +
Sbjct  147  RSVSLASNKFSGKI  160



>ref|XP_011001391.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=963

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L GL LSG+
Sbjct  28   LNDDVLGLIVFKADLQDPMRKLSSWNQDDDTPCNWFGVKCNPRSNRVAELTLDGLSLSGR  87

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSL  584
            IGRGL +L+ L+ LSL+ NN +G I P L  L NL+ ++LS+NS+SGT+ + L    ++L
Sbjct  88   IGRGLLQLQFLHKLSLSRNNLTGSIDPNLTRLENLRIIDLSENSLSGTISEDLFKECAAL  147

Query  585  QFLDLSGNSLSGPV  626
            + L L+ N  SG +
Sbjct  148  RDLSLANNKFSGKI  161



>ref|XP_008456960.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=925

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 94/137 (69%), Gaps = 1/137 (1%)
 Frame = +3

Query  219  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            +L LN DVLGLIVFK+ VQDP   LA+W+EDDDSPC W  V+C P + RV E++L+G  L
Sbjct  28   NLSLNGDVLGLIVFKAAVQDPKLKLASWNEDDDSPCNWTGVQCSPRSKRVIELNLNGFSL  87

Query  399  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNM  575
            SG++GRGL +LE L  LSL++NN SG ISP    + NLQ ++LS N+ SG V D      
Sbjct  88   SGRLGRGLFQLEFLQRLSLSNNNLSGNISPNFARVENLQMIDLSGNNFSGAVSDDFFRQC  147

Query  576  SSLQFLDLSGNSLSGPV  626
             SL+ + L+ N+ SG +
Sbjct  148  RSLRVISLANNNFSGKI  164



>gb|AAL49790.1| unknown protein [Arabidopsis thaliana]
Length=964

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LN DVLGLIVFK+ ++DP   LA+W+EDD +PC+WN VKCHP   RV+E++L G  LSG+
Sbjct  25   LNGDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFSLSGR  84

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPql-glltnlqtlnlSKNSISGTVPDS-LGNMSS  581
            IGRGL +L+ L+ LSL++NN +G+I+P +   L NL+ ++LS N +SG++PD       S
Sbjct  85   IGRGLLQLQFLHKLSLSNNNLTGIINPNMLLSLVNLKVVDLSSNGLSGSLPDEFFRQCGS  144

Query  582  LQFLDLSGNSLSGPV  626
            L+ L L+ N L+G +
Sbjct  145  LRVLSLAKNKLTGKI  159



>ref|XP_002988156.1| hypothetical protein SELMODRAFT_40688, partial [Selaginella moellendorffii]
 gb|EFJ10948.1| hypothetical protein SELMODRAFT_40688, partial [Selaginella moellendorffii]
Length=864

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 90/130 (69%), Gaps = 4/130 (3%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGL+VFK+G+QDP   LA+WSE D SPC W  ++C  A+GRV  V L GL LSG I
Sbjct  1    NDDVLGLLVFKAGLQDPRGSLASWSEADSSPCNWTGIRCGSASGRVESVSLDGLALSGTI  60

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  590
            GRGL KLE L  LSL++NN SG + P   L   L  ++L KN +SG +P  +G  +S+++
Sbjct  61   GRGLLKLERLKTLSLSANNLSGNVVP--ELFRMLDFVDLKKNRLSGELPSPMG--ASIRY  116

Query  591  LDLSGNSLSG  620
            +DLS N+ +G
Sbjct  117  VDLSDNAFTG  126



>ref|XP_009623562.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana tomentosiformis]
Length=893

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 98/140 (70%), Gaps = 1/140 (1%)
 Frame = +3

Query  210  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  389
            GA +  LNDDVLGLIVFKS V+DP   L +W+E+DDSPC WN + C+P + RVS+V L G
Sbjct  19   GALNPSLNDDVLGLIVFKSDVEDPDGKLKSWNEEDDSPCNWNGINCNPRSNRVSDVVLDG  78

Query  390  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSL  566
             GLSG+I RGL +L+ L+ LSLA+NN +G IS  L  L NL+ L+LS+NS+SG +P D  
Sbjct  79   FGLSGRISRGLLRLKFLHKLSLANNNLTGSISVSLSQLANLKILDLSQNSLSGPIPGDYF  138

Query  567  GNMSSLQFLDLSGNSLSGPV  626
                 L+ + L+ N+ SG +
Sbjct  139  EKCGPLRSISLAKNNFSGEI  158



>ref|XP_006429586.1| hypothetical protein CICLE_v10010994mg [Citrus clementina]
 gb|ESR42826.1| hypothetical protein CICLE_v10010994mg [Citrus clementina]
Length=969

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G++DP   L +WSEDDD+PC W  VKC P   RV  + L G  LSG I
Sbjct  28   NDDVLGLIVFKAGLEDPKEKLTSWSEDDDNPCNWVGVKCDPKTKRVVGLTLDGFSLSGHI  87

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +L+ L VLSL++NNF+G I+  L     LQ ++ S+N++SG +PD       SL+
Sbjct  88   GRGLLRLQFLQVLSLSNNNFTGTINADLASFGTLQVVDFSENNLSGLIPDEFFRQCGSLR  147

Query  588  FLDLSGNSLSGPV  626
             +  + N+L+GP+
Sbjct  148  EVSFANNNLTGPI  160



>gb|KDO64103.1| hypothetical protein CISIN_1g002094mg [Citrus sinensis]
Length=967

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G++DP   L +WSEDDD+PC W  VKC P   RV  + L G  LSG I
Sbjct  26   NDDVLGLIVFKAGLEDPKEKLTSWSEDDDNPCNWVGVKCDPKTKRVVGLTLDGFSLSGHI  85

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +L+ L VLSL++NNF+G I+  L     LQ ++ S+N++SG +PD       SL+
Sbjct  86   GRGLLRLQFLQVLSLSNNNFTGTINADLASFGTLQVVDFSENNLSGLIPDEFFRQCGSLR  145

Query  588  FLDLSGNSLSGPV  626
             +  + N+L+GP+
Sbjct  146  EVSFANNNLTGPI  158



>ref|XP_006481196.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=967

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G++DP   L +WSEDDD+PC W  VKC P   RV  + L G  LSG I
Sbjct  26   NDDVLGLIVFKAGLEDPKEKLTSWSEDDDNPCNWVGVKCDPKTKRVVGLTLDGFSLSGHI  85

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +L+ L VLSL++NNF+G I+  L     LQ ++ S+N++SG +PD       SL+
Sbjct  86   GRGLLRLQFLQVLSLSNNNFTGTINADLASFGTLQVVDFSENNLSGLIPDEFFRQCGSLR  145

Query  588  FLDLSGNSLSGPV  626
             +  + N+L+GP+
Sbjct  146  EVSFANNNLTGPI  158



>ref|XP_004246289.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=965

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDV+GLIVFK+G+ DP S LA+W+EDD +PC W  + C+P + RVSE+ L    LSG I
Sbjct  24   NDDVMGLIVFKAGLTDPKSKLASWTEDDPTPCNWVGINCYPQSNRVSEILLDNFSLSGHI  83

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GR L +L+ L VLSL+ NNF+G I+P L  + +L+ ++LS N++SG++PD  L   +SLQ
Sbjct  84   GRSLLRLQFLKVLSLSHNNFTGNINPILSQIPSLRVIDLSHNTLSGSIPDEFLQQCTSLQ  143

Query  588  FLDLSGNSLSGPV  626
             +  + N+L+G +
Sbjct  144  SVSFANNNLTGQI  156



>ref|XP_002528692.1| Brassinosteroid LRR receptor kinase precursor, putative [Ricinus 
communis]
 gb|EEF33681.1| Brassinosteroid LRR receptor kinase precursor, putative [Ricinus 
communis]
Length=968

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+QDP S L +W+ED ++PC W  VKC P   RV+E+ L G  LSG I
Sbjct  27   NDDVLGLIVFKAGLQDPESKLTSWNEDSENPCNWVGVKCDPKTQRVTELALDGFFLSGHI  86

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +L+ L +LSL++NNF+G I+P L  L  LQ ++LS+N +SG +PD       SL+
Sbjct  87   GRGLIRLQFLQILSLSNNNFTGTINPDLSQLGGLQVIDLSRNKLSGFIPDEFFKQCGSLR  146

Query  588  FLDLSGNSLSGPV  626
             +  + N+LSG +
Sbjct  147  SVSFAKNNLSGQI  159



>ref|XP_004502826.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=970

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 98/136 (72%), Gaps = 3/136 (2%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGLS  401
            LNDDVLGLIVFK+ +QDP   L +W+EDD+S C  +W  VKC+P + RV E++L+G  LS
Sbjct  23   LNDDVLGLIVFKADIQDPKGKLTSWNEDDESACGGSWVGVKCNPRSNRVVEINLNGFSLS  82

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMS  578
            G+IGRGL++L+ L  L LA+NN +G I+P + ++ NL+ L+LSKN++SG VPD       
Sbjct  83   GRIGRGLQRLQFLRRLYLANNNLTGNIAPNIAIIDNLRVLDLSKNNLSGVVPDDFFRQCG  142

Query  579  SLQFLDLSGNSLSGPV  626
            S++ + L+GN  SG +
Sbjct  143  SMRVVSLAGNMFSGNI  158



>ref|XP_002325929.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF00311.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=963

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L GL LSG+
Sbjct  28   LNDDVLGLIVFKADLQDPMRKLSSWNQDDDTPCNWFGVKCNPRSNRVAELTLDGLSLSGR  87

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV-PDSLGNMSSL  584
            IGRGL +L+ L+ LSL+ NN +G I+P L  L NL+ ++LS+NS+SGT+  D     ++L
Sbjct  88   IGRGLLQLQFLHKLSLSRNNLTGSINPNLTRLENLRIIDLSENSLSGTISEDFFKECAAL  147

Query  585  QFLDLSGNSLSGPV  626
            + L L+ N  SG +
Sbjct  148  RDLSLANNKFSGKI  161



>dbj|BAJ85468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1052

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            +N++VLGL+VF+S + DP+  LA W+E D +PC W  V+C PA  RV  + L GLGLS  
Sbjct  30   VNEEVLGLVVFRSALTDPSGALAAWAESDATPCGWPHVECDPATSRVLRLALDGLGLSSD  89

Query  408  IG--RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  581
             G  RGL++L  L  LSLA NN SG + P L LL +L+ L+LS+N++SG +PD L  ++S
Sbjct  90   SGVPRGLDRLPRLQSLSLARNNLSGALRPGLSLLPSLRLLDLSRNALSGALPDDLPLLAS  149

Query  582  LQFLDLSGNSLSGPV  626
            L++LDLS N+LSGP+
Sbjct  150  LRYLDLSSNALSGPL  164



>ref|NP_001170194.1| uncharacterized protein LOC100384143 precursor [Zea mays]
 gb|ACN36181.1| unknown [Zea mays]
Length=403

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 96/136 (71%), Gaps = 1/136 (1%)
 Frame = +3

Query  222  LQLNDDVLGLIVFKSGVQDPASHLATWS-EDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            + +N++VLGL+VFKS + DP S LATW+  D  +PCAW  V+C PA  RV  + L GL L
Sbjct  33   MPVNEEVLGLVVFKSALSDPTSALATWTGSDATTPCAWARVECDPATSRVLRLALDGLAL  92

Query  399  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  578
            SG++ R L++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++
Sbjct  93   SGRMPRDLDRLPALQYLSLARNNISGPLPPGLSLLASLRSLDLSYNAFSGPLPDDIARLA  152

Query  579  SLQFLDLSGNSLSGPV  626
            SL+ LDL+GN+ SGP+
Sbjct  153  SLRSLDLTGNAFSGPL  168



>ref|XP_006290555.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
 gb|EOA23453.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
Length=939

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E++L G  LSG+
Sbjct  27   LNDDVLGLIVFKADLRDPQQKLASWNEDDYTPCSWTGVKCHPRTNRVTELNLDGFSLSGR  86

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPq-lglltnlqtlnlSKNSISGTVPDS-LGNMSS  581
            IGRGL +LE L+ LSL++NN +G+I+P  L  L NL+ ++LS N++SG++ D       S
Sbjct  87   IGRGLLQLEFLHKLSLSNNNLTGIINPNLLLSLVNLKVVDLSSNALSGSLSDGFFRQCGS  146

Query  582  LQFLDLSGNSLSGPV  626
            L+ L L+ N L+G +
Sbjct  147  LRVLSLAKNKLTGKI  161



>ref|XP_002467905.1| hypothetical protein SORBIDRAFT_01g036160 [Sorghum bicolor]
 gb|EER94903.1| hypothetical protein SORBIDRAFT_01g036160 [Sorghum bicolor]
Length=972

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 89/130 (68%), Gaps = 1/130 (1%)
 Frame = +3

Query  234  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  413
            DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C    GRVS + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVSDPDGRLATWSEDDERPCAWGGVTCDARTGRVSALSLAGFGLSGKLG  91

Query  414  RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSLQF  590
            RGL +LE L  LSLA NN SG +  +L  L  LQTL+LS N+ +G +P+ L G   SL+ 
Sbjct  92   RGLLRLEALQSLSLARNNLSGDVPAELARLPALQTLDLSANAFAGAIPEGLFGRCRSLRD  151

Query  591  LDLSGNSLSG  620
            + L+GN+ SG
Sbjct  152  VSLAGNAFSG  161



>ref|XP_001771841.1| predicted protein [Physcomitrella patens]
 gb|EDQ63270.1| predicted protein [Physcomitrella patens]
Length=963

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            ++DDVLGL+ FK+G+ DP   L +W +DD SPCAW  + C    GRVSE++L GL L+G+
Sbjct  4    MSDDVLGLMAFKAGLSDPTGALHSWRQDDASPCAWVGIVCDRLTGRVSELNLVGLFLAGQ  63

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  587
            IGRGL KL+ L +L+L+SNNF+G I  ++  L  L+ LN+S N ++G +   L N SSL 
Sbjct  64   IGRGLAKLDELQILNLSSNNFTGSIDTEVAGLPMLRKLNVSNNQLNGVITPLLTNNSSLM  123

Query  588  FLDLSGNSLSGPV  626
             LDLS N+L+GP+
Sbjct  124  VLDLSSNALTGPM  136



>ref|XP_009757206.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=894

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 87/139 (63%), Gaps = 23/139 (17%)
 Frame = +3

Query  210  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  389
            GA +  LNDDVLGLIVFKS VQDP   L +W+E+DDSPC WN + C+P + RVS+V L G
Sbjct  19   GALNPSLNDDVLGLIVFKSDVQDPDGKLKSWNEEDDSPCNWNGINCNPRSNRVSDVVLDG  78

Query  390  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  569
             GLSG+I RGL +L+ L  LSLA+NN +G IS                         SL 
Sbjct  79   FGLSGRISRGLLRLQFLYKLSLANNNLTGSISVV-----------------------SLS  115

Query  570  NMSSLQFLDLSGNSLSGPV  626
             +++L+ LDLS NSLSGP+
Sbjct  116  QLANLKILDLSENSLSGPI  134


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +3

Query  396  LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  575
            LSG I   LEKLE L VL+L+ N  SG +   +    NL TL++S N+++GTVP ++G +
Sbjct  299  LSGTIPTSLEKLESLKVLNLSQNAISGSLPESISSCVNLLTLDVSHNNLTGTVPKTVGQL  358

Query  576  SSLQFLDLSGNSLSGPV  626
              L  LDLS N L G V
Sbjct  359  KLLGILDLSENRLYGTV  375



>ref|XP_011010876.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Populus euphratica]
Length=941

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P   RV+E+ L GL LSG+
Sbjct  30   LNDDVLGLIVFKADLQDPKRKLSSWNQDDDTPCNWFGVKCNPRTNRVTELSLDGLSLSGQ  89

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  584
            IGRGL +L+ L+ LSL+ N  +G I+P L  L NL  ++LS+NS+SGT+P D   +  +L
Sbjct  90   IGRGLMQLQFLDKLSLSRNCLTGSINPNLTRLENLGIIDLSENSLSGTIPEDFFEDCGTL  149

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N  SG +
Sbjct  150  RDISLAKNKFSGKI  163



>ref|XP_011010875.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Populus euphratica]
Length=965

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P   RV+E+ L GL LSG+
Sbjct  30   LNDDVLGLIVFKADLQDPKRKLSSWNQDDDTPCNWFGVKCNPRTNRVTELSLDGLSLSGQ  89

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  584
            IGRGL +L+ L+ LSL+ N  +G I+P L  L NL  ++LS+NS+SGT+P D   +  +L
Sbjct  90   IGRGLMQLQFLDKLSLSRNCLTGSINPNLTRLENLGIIDLSENSLSGTIPEDFFEDCGTL  149

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N  SG +
Sbjct  150  RDISLAKNKFSGKI  163



>ref|XP_008442319.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=958

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  234  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  413
            DDVLGLIVFK+G+QDP   L TW+EDD++PC W  VKC+P   RVSE+ L G  LSG IG
Sbjct  25   DDVLGLIVFKAGLQDPMGKLVTWNEDDETPCNWFGVKCNPKTNRVSELVLDGFSLSGHIG  84

Query  414  RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSLQF  590
            RGL +L+ L +LSLA+NNF+G I+  L  L NLQ ++LS N++SG +P+ L     S++ 
Sbjct  85   RGLLRLQFLQILSLANNNFTGTINSALSHLGNLQVIDLSDNNLSGPIPEQLFQQCGSIRV  144

Query  591  LDLSGNSLSGPV  626
            L  + NSL G +
Sbjct  145  LSFARNSLIGNI  156



>ref|XP_006290556.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
 gb|EOA23454.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
Length=966

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E++L G  LSG+
Sbjct  27   LNDDVLGLIVFKADLRDPQQKLASWNEDDYTPCSWTGVKCHPRTNRVTELNLDGFSLSGR  86

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPq-lglltnlqtlnlSKNSISGTVPDS-LGNMSS  581
            IGRGL +LE L+ LSL++NN +G+I+P  L  L NL+ ++LS N++SG++ D       S
Sbjct  87   IGRGLLQLEFLHKLSLSNNNLTGIINPNLLLSLVNLKVVDLSSNALSGSLSDGFFRQCGS  146

Query  582  LQFLDLSGNSLSGPV  626
            L+ L L+ N L+G +
Sbjct  147  LRVLSLAKNKLTGKI  161



>ref|XP_004984462.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=972

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +3

Query  234  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  413
            DDVLGLIVFK+ V DP   LATWSEDD+  CAW+ V C P  GRVS + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVSDPEGRLATWSEDDERACAWDGVTCEPRTGRVSALSLAGFGLSGKLG  91

Query  414  RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSLQF  590
            RGL +LE L  L+LA NN SG +  +L  L  LQTL+LS N+ +G +P+ L G   +L+ 
Sbjct  92   RGLLRLEALQSLNLAHNNLSGDVPAELARLPALQTLDLSANAFAGAIPEGLFGRCRALRD  151

Query  591  LDLSGNSLSGPV  626
            + L+GN+ SG +
Sbjct  152  VSLAGNAFSGDI  163



>ref|XP_006358746.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=894

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFKS VQDP   L +W+E+DDSPC W+ + C+P + RV+EV L G GLSG+
Sbjct  26   LNDDVLGLIVFKSDVQDPYGKLKSWNEEDDSPCNWDGINCNPRSNRVTEVVLDGFGLSGR  85

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  584
            I RGL +L+ L+ LSLA NN +G IS  L  L  L+ L+LS+N++SG +P D       L
Sbjct  86   ISRGLLRLQFLHRLSLAKNNLTGSISVSLAQLAYLKFLDLSENNLSGNIPGDYFQQCGPL  145

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N +SG +
Sbjct  146  RSISLANNKISGQI  159



>ref|XP_010504542.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=968

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVF++ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLIVFEADLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGR  88

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPq-lglltnlqtlnlSKNSISGTVPDS-LGNMSS  581
            IGRGL +L+ L+ LSL++NN +G+I+P  L  L NL+ ++LS N++SG++PD       S
Sbjct  89   IGRGLLQLQFLHKLSLSNNNLTGIINPNFLLSLVNLKVVDLSSNALSGSLPDGFFKQCGS  148

Query  582  LQFLDLSGNSLSGPV  626
            L+ L L+ N L+G +
Sbjct  149  LRVLSLAKNKLTGKI  163



>ref|XP_004241084.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=971

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 94/139 (68%), Gaps = 1/139 (1%)
 Frame = +3

Query  213  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  392
            A +L  NDD+LGL+VFK+ VQDP   L +W+E+DDSPC W+ + C+P + RVS++ L G 
Sbjct  23   ALNLSFNDDILGLMVFKADVQDPQGKLVSWNEEDDSPCGWDGIHCNPRSNRVSQIVLDGF  82

Query  393  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLG  569
            GLSGKI RGL +L+ L  LSLA NNF+G IS  +  L  L+ L+LS+N++ GT+P D   
Sbjct  83   GLSGKISRGLMRLQFLRKLSLAKNNFTGSISSSVVQLAYLRILDLSENNLFGTIPGDFFE  142

Query  570  NMSSLQFLDLSGNSLSGPV  626
                L+ + L+ N  SG V
Sbjct  143  QCGPLRSISLAKNKFSGKV  161



>ref|XP_008388889.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=469

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP   L +WSEDDDS C+W  VKCHP + RV E++L    LSG 
Sbjct  31   LNDDVLGLIVFKANIQDPKGKLXSWSEDDDSACSWVGVKCHPRSNRVIELNLDDFSLSGH  90

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L  LSL+ NN +G ++P +  + NL+ L+LS+NS SG VP+       SL
Sbjct  91   IGRGLLQLQALRKLSLSKNNLTGSLTPNIAHIDNLRVLDLSENSFSGDVPEEFFRQCGSL  150

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N  SG +
Sbjct  151  RXISLAKNKFSGKI  164



>ref|XP_004146470.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN50740.1| hypothetical protein Csa_5G222990 [Cucumis sativus]
Length=925

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 93/137 (68%), Gaps = 1/137 (1%)
 Frame = +3

Query  219  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            +L LN DVLGLIVFK+ VQDP   LA+W+EDDDSPC W  V+C P + RV E++L+G  L
Sbjct  28   NLSLNGDVLGLIVFKAAVQDPKLKLASWNEDDDSPCNWTGVQCSPRSKRVIELNLNGFSL  87

Query  399  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNM  575
            SG++GRGL +LE L  LSL++NN +G ISP    + NLQ ++LS N+ SG V D      
Sbjct  88   SGRLGRGLFQLEFLQRLSLSNNNLTGNISPNFARVDNLQVIDLSGNNFSGVVSDDFFRQC  147

Query  576  SSLQFLDLSGNSLSGPV  626
             SL+ + L+ N  SG +
Sbjct  148  RSLRVVSLANNKFSGKI  164



>gb|EYU42026.1| hypothetical protein MIMGU_mgv1a000905mg [Erythranthe guttata]
Length=946

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+ DP S L +W+E+DDS C W  VKC P + RVSE+ L G  LSG +
Sbjct  28   NDDVLGLIVFKAGLTDPQSRLTSWNEEDDSACNWVGVKCDPTSNRVSELLLDGFSLSGHL  87

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSLQ  587
            GR L +L+ L VL L+ NNFSG I+P L  +  L+T++LS+NS+SG++P+ +     SL+
Sbjct  88   GRSLIRLQSLKVLQLSRNNFSGTINPILTQIPYLETIDLSQNSLSGSIPEEIFQQCGSLK  147

Query  588  FLDLSGNSLSG  620
             + L+ N+L+G
Sbjct  148  EISLAKNNLTG  158



>ref|XP_010412798.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1231

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLI+FK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+
Sbjct  28   LNDDVLGLILFKADLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGR  87

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPq-lglltnlqtlnlSKNSISGTVPDS-LGNMSS  581
            IGRG+ +L+ L+ LSL++NN +G+I+P  L  L NL+ ++LS N++SG++PD       S
Sbjct  88   IGRGILQLQFLHKLSLSNNNLTGIINPNFLLSLVNLKVVDLSSNALSGSLPDEFFKQCGS  147

Query  582  LQFLDLSGNSLSGPV  626
            L+ L L+ N L+G +
Sbjct  148  LRVLSLAKNKLTGKI  162


 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 93/142 (65%), Gaps = 4/142 (3%)
 Frame = +3

Query  207  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  386
            G   SL+  D  L +  F   ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L 
Sbjct  287  GEMRSLETLD--LSMNKFSGQLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLD  344

Query  387  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPq-lglltnlqtlnlSKNSISGTVPDS  563
            G  LSG+IGRG+ +L+ L+ LSL++NN +G+I+P  L  L NL+ ++LS N++SG++PD 
Sbjct  345  GFSLSGRIGRGILQLQFLHKLSLSNNNLTGIINPNFLLSLVNLKVVDLSSNALSGSLPDG  404

Query  564  -LGNMSSLQFLDLSGNSLSGPV  626
                  SL+ L L+ N L+G +
Sbjct  405  FFKQCGSLRVLSLAKNKLTGKI  426



>ref|XP_008808300.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=939

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 96/156 (62%), Gaps = 25/156 (16%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  VKC P   RV+E+ L G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPDSKLVSWNEDDDDPCHWIGVKCDPKTNRVAELSLDGFSLSGK  85

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD---------  560
            IGRGL +L+ L  LSL+ NNFSG +S  L  L +L+ L+LS+N +SG +PD         
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGSLSSDLLRLESLRNLDLSENKLSGPIPDDFFGQCRFI  145

Query  561  ----------------SLGNMSSLQFLDLSGNSLSG  620
                            ++G+ S+L  LDLS N LSG
Sbjct  146  GAISLAKNAFSGVIPPNVGSCSTLAALDLSSNRLSG  181


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +3

Query  375  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  554
            +DL     SG I   + KL+ L  L L+ N  +G I  ++G   +L+ L L KNS+SG +
Sbjct  387  LDLSSNAFSGSIPESVGKLKSLEFLDLSGNRLNGSIPLEVGGAVSLKELRLEKNSLSGGI  446

Query  555  PDSLGNMSSLQFLDLSGNSLSGPV  626
            P  +GN SSL  LDLS N+L+GP+
Sbjct  447  PTQIGNCSSLATLDLSQNNLTGPI  470



>ref|XP_008782666.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=938

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  VKC P   RV+E+ L G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPGSKLVSWNEDDDDPCHWLGVKCDPKTNRVTELSLVGFFLSGK  85

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L  LSL+ NNFSG +S  L  L +L+ L+LS+N +SG +PD   G   S+
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGTLSSDLLRLESLRNLDLSENKLSGPIPDDFFGQCRSI  145

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N+  G +
Sbjct  146  RSISLAKNAFFGAI  159


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +3

Query  375  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  554
            +DL     SG I  G+ KL+ L VL L+ N  +G I  Q+G   +L+ L L KNS+ G  
Sbjct  387  LDLSSNAFSGSIPEGVGKLKSLEVLDLSGNRLNGSIPSQIGGAASLKELRLGKNSLKGAX  446

Query  555  PDSLGNMSSLQFLDLSGNSLSGPV  626
            P  +GN SSL  LDLS N+L+GP+
Sbjct  447  PTQIGNCSSLTSLDLSQNNLTGPI  470



>ref|XP_004240861.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=894

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFKS +QDP   L +W+E+DD+PC W+ + C+P + RV+EV L G GLSG+
Sbjct  26   LNDDVLGLIVFKSDIQDPYKKLKSWNEEDDTPCNWDGINCNPRSNRVTEVVLDGFGLSGR  85

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  584
            I RGL +L+ L+ LSLA NN +G IS  L  L  L+ L+LS+N++SG +P D       L
Sbjct  86   ISRGLLRLQFLHRLSLAKNNLTGSISVSLAQLAYLKFLDLSENNLSGNIPGDYFQQCGPL  145

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N +SG +
Sbjct  146  RSISLANNKISGQI  159



>ref|XP_006402993.1| hypothetical protein EUTSA_v10005773mg [Eutrema salsugineum]
 gb|ESQ44446.1| hypothetical protein EUTSA_v10005773mg [Eutrema salsugineum]
Length=967

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ ++DP   LA+W+EDD SPC+WN VKCH    RV+E+ L G  LSG+
Sbjct  28   LNDDVLGLIVFKADLRDPEQKLASWNEDDYSPCSWNGVKCHTRTNRVTELTLDGFSLSGR  87

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPq-lglltnlqtlnlSKNSISGTVPDS-LGNMSS  581
            IGRGL +L+ L+ LSL++NN +G+I+P  L  L NL+ ++LS N +SG++PD       S
Sbjct  88   IGRGLLQLQFLHKLSLSNNNLTGIINPNLLLSLVNLKVVDLSSNGLSGSLPDGFFRQCGS  147

Query  582  LQFLDLSGNSLSGPV  626
            L+   L+ N+L+G +
Sbjct  148  LRAFSLAKNTLTGKI  162



>ref|XP_008681357.1| PREDICTED: uncharacterized protein LOC100304322 isoform X1 [Zea 
mays]
 tpg|DAA45233.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=972

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 88/130 (68%), Gaps = 1/130 (1%)
 Frame = +3

Query  234  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  413
            DDVLGLIVFK+ V DP   LATWSEDD+ PCAW+ V C    GRVS + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVSDPDGRLATWSEDDERPCAWDGVTCDARTGRVSALSLAGFGLSGKLG  91

Query  414  RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSLQF  590
            RGL +LE L  LSLA NN SG +   L  L  LQTL+LS N+ +G VP+ L G   SL+ 
Sbjct  92   RGLLRLEALQSLSLARNNLSGDVPADLARLPALQTLDLSANAFAGAVPEGLFGRCRSLRD  151

Query  591  LDLSGNSLSG  620
            + L+ N+ SG
Sbjct  152  VSLANNAFSG  161



>ref|XP_010525412.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=965

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ ++DP   LA+W+EDD SPC W  +KC+P   RV+E++L G  LSG+
Sbjct  28   LNDDVLGLIVFKADLRDPEQKLASWNEDDYSPCNWVGLKCNPRTNRVTELNLDGFSLSGR  87

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L  LSL++NN +G I+P L  L +L+ ++LS N +SG++PD       SL
Sbjct  88   IGRGLLQLQFLRKLSLSNNNLTGNINPNLLSLQDLKIVDLSNNGLSGSIPDGFFRQCGSL  147

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N+LSG +
Sbjct  148  RAISLANNNLSGKI  161


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +3

Query  375  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  554
            +DL G GL G+I  G++ L +L VL L+ N FSG++  ++G    L+ ++LS+NS+SG +
Sbjct  198  LDLSGNGLEGEIPEGIDSLNNLRVLDLSRNRFSGLVPSEIGNCLLLKYVDLSENSLSGNL  257

Query  555  PDSLGNMSSLQFLDLSGNSLSGPV  626
            PDSL  ++   FLDL  N+L G V
Sbjct  258  PDSLQKLNLCYFLDLGKNALEGDV  281



>ref|XP_002319878.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE95801.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=965

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDV GLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L GL LSG+
Sbjct  30   LNDDVFGLIVFKADLQDPKRKLSSWNQDDDTPCNWFGVKCNPRSNRVTELSLDGLSLSGQ  89

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  584
            IGRGL +L+ L+ LSL+ N  +G I+P L  L NL+ ++LS+NS+SGT+P D   +  +L
Sbjct  90   IGRGLMQLQFLHKLSLSRNCLTGSINPNLTRLENLRIIDLSENSLSGTIPEDFFKDCGAL  149

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N  SG +
Sbjct  150  RDISLAKNKFSGKI  163



>ref|XP_006341303.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=982

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDV+GLIV K+G  DP S LA+W+EDD +PC W  + C+P + RVSE+ L    LSG I
Sbjct  41   NDDVMGLIVLKAGFTDPKSKLASWTEDDPTPCNWVGINCYPQSNRVSEILLDNFSLSGHI  100

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GR L +L+ L VLSL++NNF+G I+P L  + +L+ ++LS N++SG++PD      SSLQ
Sbjct  101  GRSLLRLQFLKVLSLSNNNFTGNINPILSQIPSLRVIDLSHNTLSGSIPDEFFQQCSSLQ  160

Query  588  FLDLSGNSLSGPV  626
             +  + N+L+G +
Sbjct  161  SVSFANNNLTGEI  173



>ref|XP_006842493.1| hypothetical protein AMTR_s00077p00091370 [Amborella trichopoda]
 gb|ERN04168.1| hypothetical protein AMTR_s00077p00091370 [Amborella trichopoda]
Length=981

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK  + DP + L++WSEDD+SPC W  ++C+P   RV+E+ L+ L LSGK
Sbjct  29   LNDDVLGLIVFKFDLHDPKNVLSSWSEDDNSPCNWFGIQCNPRTQRVTEILLNDLSLSGK  88

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L  LSL++N FSG ISP L  + +L+ ++ S N+++G +PD       SL
Sbjct  89   IGRGLVRLQFLRKLSLSNNYFSGTISPDLATIQSLRAVDFSGNNLTGEIPDQFFKQCGSL  148

Query  585  QFLDLSGNSLSGPV  626
            +++  + N+  GPV
Sbjct  149  RYVSFARNNFYGPV  162



>ref|XP_009116341.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=959

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 94/135 (70%), Gaps = 2/135 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGL+ FKS ++DP   LA+W+EDD +PCAWN VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLVAFKSDLRDPDQKLASWNEDDYTPCAWNGVKCHPRTNRVTELTLDGFSLSGR  88

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlgllt-nlqtlnlSKNSISGTVPDS-LGNMSS  581
            IGRGL +L+ L+ LSL++NN +G ++P L     +L+ ++LS N +SG++PD       S
Sbjct  89   IGRGLLQLQSLHKLSLSNNNLTGTVNPNLISSLGSLKVVDLSGNGLSGSLPDGFFRQCGS  148

Query  582  LQFLDLSGNSLSGPV  626
            L+   ++ N L+G +
Sbjct  149  LRVFSVAENKLTGKI  163



>gb|EYU35201.1| hypothetical protein MIMGU_mgv1a000839mg [Erythranthe guttata]
Length=967

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 97/138 (70%), Gaps = 2/138 (1%)
 Frame = +3

Query  219  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCA-WNFVKCHPANGRVSEVDLHGLG  395
            S  LNDDVLGLIVFK+ VQDP   LA+W+E+DDSPC  W  VKC+P + RVS++ L G G
Sbjct  24   SPSLNDDVLGLIVFKADVQDPDGKLASWNEEDDSPCNNWVGVKCNPRSNRVSDLVLDGFG  83

Query  396  LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGN  572
            LSGK+GRGL +L+ L  LSL+ NN +G ++     L++L+ L+LS+NS SG++P D    
Sbjct  84   LSGKLGRGLLQLQFLRKLSLSKNNLTGSVTLSFAQLSDLRVLDLSENSFSGSIPSDFFTQ  143

Query  573  MSSLQFLDLSGNSLSGPV  626
              SL+ + L+ N  SGP+
Sbjct  144  CGSLRSISLARNKFSGPI  161


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +3

Query  375  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  554
            +DL G   SG++   ++KL   N L L  N F G +S  +G + +L++L+LS+N +SG +
Sbjct  227  IDLSGNSFSGRLPSTIQKLSLCNNLVLGKNGFEGDLSEWIGEMRSLESLDLSENGLSGRI  286

Query  555  PDSLGNMSSLQFLDLSGNSLSG  620
            PDSLG + SL+ L++S N+L+G
Sbjct  287  PDSLGKLQSLKVLNVSKNALNG  308



>ref|XP_008370260.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=965

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+ DP + LA+W+EDDDSPC+W  VKC P  GRV+EV L G  LSG I
Sbjct  24   NDDVLGLIVFKAGLSDPEAKLASWNEDDDSPCSWVGVKCDPTTGRVAEVVLDGFSLSGHI  83

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +L++L  LSL+ NNF+G I+P L  L +LQ ++LS+NS+SG+VP+       SL+
Sbjct  84   GRGLLRLQNLQRLSLSDNNFTGFINPDLPHLGSLQVIDLSRNSLSGSVPEEFFMQCGSLR  143

Query  588  FLDLSGNSLSGPV  626
             +  + N+L+G +
Sbjct  144  VVSFARNNLTGRI  156



>ref|XP_011084816.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=972

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCA-WNFVKCHPANGRVSEVDLHGLGLSG  404
            LNDDVLGLIVFK+ +QDP   L++W+E+DDSPC  W  VKC+P + RVS++ L G GLSG
Sbjct  25   LNDDVLGLIVFKADIQDPDGKLSSWNEEDDSPCNNWVGVKCNPRSNRVSDLVLDGFGLSG  84

Query  405  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSS  581
            K+GRGL +L+ L  LSLA NN +G IS     L++L+ L+LS+N  SG++P D      S
Sbjct  85   KLGRGLLQLQFLRKLSLAKNNLTGSISLSFSELSDLRVLDLSENGFSGSIPSDFFSQCGS  144

Query  582  LQFLDLSGNSLSGPV  626
            L+ + L+ N  SGP+
Sbjct  145  LRSISLAKNRFSGPI  159



>ref|XP_009349085.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=952

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP   LA+WSEDDDS C+W  +KCHP + RV E++L    LSG 
Sbjct  31   LNDDVLGLIVFKANIQDPKGKLASWSEDDDSACSWVGIKCHPRSNRVIELNLDDFSLSGH  90

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L  LSL+ NN  G ++P +  + NL+ L+LS+NS SG VP+       SL
Sbjct  91   IGRGLLQLQALRKLSLSKNNLIGSLTPNIAHIDNLRVLDLSENSFSGDVPEEFFRQCGSL  150

Query  585  QFLDLSGNSLSG  620
            + + L+ N  SG
Sbjct  151  RVISLAKNKFSG  162



>gb|KDP21644.1| hypothetical protein JCGZ_03315 [Jatropha curcas]
Length=960

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+EV L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLQDPKGKLSSWNQDDDTPCNWVGVKCNPRSNRVTEVMLDGFSLSGR  84

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L+ LSLA NN +G IS  L  L NL+ ++LS NS+SG++ D       SL
Sbjct  85   IGRGLLQLQFLHKLSLARNNLTGSISLNLSRLENLRIIDLSDNSLSGSIQDDFFAQCGSL  144

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N  SG +
Sbjct  145  RAISLAKNKFSGTI  158



>ref|XP_009362809.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=952

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP   LA+WSEDDDS C+W  +KCHP + RV E++L    LSG 
Sbjct  31   LNDDVLGLIVFKANIQDPKGKLASWSEDDDSACSWVGIKCHPRSNRVIELNLDDFSLSGH  90

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L  LSL+ NN  G ++P +  + NL+ L+LS+NS SG VP+       SL
Sbjct  91   IGRGLLQLQALRKLSLSKNNLIGSLTPNIAHIDNLRVLDLSENSFSGDVPEEFFRQCGSL  150

Query  585  QFLDLSGNSLSG  620
            + + L+ N  SG
Sbjct  151  RVISLAKNKFSG  162



>ref|XP_009614707.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana tomentosiformis]
Length=980

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDV+GLIVFK+G  DP S L +W+EDD +PC W  +KC P + RVSE+ L    LSG I
Sbjct  39   NDDVMGLIVFKAGFTDPKSKLTSWTEDDATPCNWVGIKCDPYSNRVSEILLDNFSLSGHI  98

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GR L +L+ L VLSL+ NNF+G I+P L  + +L+ ++LS NS+SG +PD       SLQ
Sbjct  99   GRSLLRLQFLRVLSLSKNNFTGNINPILAQIPSLRVIDLSDNSLSGPIPDEFFRQCGSLQ  158

Query  588  FLDLSGNSLSGPV  626
             +  + N+L+G +
Sbjct  159  AVSFAKNNLTGQI  171



>ref|XP_010103654.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB96537.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=978

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ VQDP   LA+W+EDD+SPC W  V+C+P + RV+E++L G  LSG+
Sbjct  32   LNDDVLGLIVFKADVQDPKGMLASWNEDDNSPCGWMGVRCNPRSKRVTELNLDGFSLSGR  91

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  584
            +GRGL +L+ L  LSLA N+ +G IS  +  + NL+ L+L  NS SG +P D      SL
Sbjct  92   LGRGLLQLQFLRKLSLARNSLNGSISSNIARIDNLRVLDLRDNSFSGDIPEDFFRQCGSL  151

Query  585  QFLDLSGNSLSGPV  626
            + L L+ N  SG +
Sbjct  152  RVLSLAKNKFSGKI  165



>ref|XP_009793754.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=965

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDV+GLIVFK+G  DP S L +W+EDD +PC W  +KC P + RVSE+ L    LSG I
Sbjct  24   NDDVMGLIVFKAGFTDPKSKLTSWTEDDATPCNWVGIKCDPYSNRVSEILLDNFSLSGHI  83

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GR L +L+ L VLSL++NNF+G I+P L  + +L+ ++LS NS+SG++PD       SLQ
Sbjct  84   GRSLLRLQFLRVLSLSNNNFTGNINPILAQIPSLRVIDLSDNSLSGSLPDDFFRQCGSLQ  143

Query  588  FLDLSGNSLSGPV  626
             +  + N+L+G +
Sbjct  144  AVSFAKNNLTGQI  156



>gb|KHN11868.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=969

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G++DP   L+TW+EDD SPC W  VKC  AN RVS + L G  LSG I
Sbjct  31   NDDVLGLIVFKAGLEDPKGKLSTWNEDDYSPCNWVGVKCDLANNRVSSLVLDGFSLSGHI  90

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS-SLQ  587
             RGL +L+ L +LSL+ NNF+G I+P L  + +LQ ++LS+N++ G +PD +     SL+
Sbjct  91   DRGLLRLQFLQILSLSRNNFTGTIAPDLLSIGDLQVVDLSENNLYGPIPDGIFQQCWSLR  150

Query  588  FLDLSGNSLSGPV  626
             +  + N+L+G V
Sbjct  151  VVSFANNNLTGKV  163


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 51/87 (59%), Gaps = 0/87 (0%)
 Frame = +3

Query  366  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  545
            +  +DL    L G+I  G++ L  L  L L SN+F+G +   +G    L+ ++ S NSIS
Sbjct  197  LQSIDLSNNFLEGEIPEGIQNLIDLRELRLGSNHFTGRVPEHIGDCLLLKLVDFSDNSIS  256

Query  546  GTVPDSLGNMSSLQFLDLSGNSLSGPV  626
            G +P+S+  ++S  FL L GNS +G +
Sbjct  257  GRLPESMQKLTSCTFLSLQGNSFTGGI  283



>ref|XP_008655312.1| PREDICTED: uncharacterized protein LOC100384143 isoform X1 [Zea 
mays]
 gb|AFW83919.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1053

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 96/136 (71%), Gaps = 1/136 (1%)
 Frame = +3

Query  222  LQLNDDVLGLIVFKSGVQDPASHLATWS-EDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  398
            + +N++VLGL+VFKS + DP S LATW+  D  +PCAW  V+C PA  RV  + L GL L
Sbjct  33   MPVNEEVLGLVVFKSALSDPTSALATWTGSDATTPCAWARVECDPATSRVLRLALDGLAL  92

Query  399  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  578
            SG++ R L++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++
Sbjct  93   SGRMPRDLDRLPALQYLSLARNNISGPLPPGLSLLASLRSLDLSYNAFSGPLPDDIARLA  152

Query  579  SLQFLDLSGNSLSGPV  626
            SL+ LDL+GN+ SGP+
Sbjct  153  SLRSLDLTGNAFSGPL  168



>ref|XP_003516434.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like isoform X1 [Glycine max]
 ref|XP_006573410.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like isoform X2 [Glycine max]
Length=969

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G++DP   L+TW+EDD SPC W  VKC  AN RVS + L G  LSG I
Sbjct  31   NDDVLGLIVFKAGLEDPKGKLSTWNEDDYSPCNWVGVKCDLANNRVSSLVLDGFSLSGHI  90

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS-SLQ  587
             RGL +L+ L +LSL+ NNF+G I+P L  + +LQ ++LS+N++ G +PD +     SL+
Sbjct  91   DRGLLRLQFLQILSLSRNNFTGTIAPDLLSIGDLQVVDLSENNLYGPIPDGIFQQCWSLR  150

Query  588  FLDLSGNSLSGPV  626
             +  + N+L+G +
Sbjct  151  VVSFANNNLTGKI  163


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 51/87 (59%), Gaps = 0/87 (0%)
 Frame = +3

Query  366  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  545
            +  +DL    L G+I  G++ L  L  L L SN+F+G +   +G    L+ ++ S NSIS
Sbjct  197  LQSIDLSNNFLEGEIPEGIQNLIDLRELRLGSNHFTGRVPEHIGDCLLLKLVDFSDNSIS  256

Query  546  GTVPDSLGNMSSLQFLDLSGNSLSGPV  626
            G +P+S+  ++S  FL L GNS +G +
Sbjct  257  GRLPESMQKLTSCTFLSLQGNSFTGGI  283



>ref|XP_010043193.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW88339.1| hypothetical protein EUGRSUZ_A00726 [Eucalyptus grandis]
Length=962

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+ DP   L+TW+ED + PC W  +KC P + RV+EV L G  LSG I
Sbjct  24   NDDVLGLIVFKAGLHDPKDKLSTWNEDAEYPCDWVGIKCDPRSKRVTEVALDGFSLSGHI  83

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSLQ  587
            GRGL +L+ L VLSL+ NNFSG I+  L  +  LQ L+LS+N+ +G +PD +     SL+
Sbjct  84   GRGLLRLQFLQVLSLSKNNFSGPINTSLTHIGTLQVLDLSENNFTGAIPDEMFQQCGSLR  143

Query  588  FLDLSGNSLSGPV  626
             +  + NSL G +
Sbjct  144  VVSFAKNSLMGRI  156



>ref|XP_007134721.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
 gb|ESW06715.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
Length=982

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLI FK+G++DP   L+TW+ DD SPC W  VKC P N RVS + L G  LSG I
Sbjct  40   NDDVLGLITFKAGLEDPKGKLSTWNADDYSPCNWVGVKCDPVNNRVSSLVLDGFSLSGHI  99

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS-SLQ  587
             RGL KL+ L +LSL+ NNF G I+P L  + +LQ ++LS+N++SG +P+ +     SL+
Sbjct  100  DRGLLKLQFLQILSLSRNNFKGTIAPDLLGIGDLQVVDLSENNLSGLIPNEIFQQCWSLR  159

Query  588  FLDLSGNSLSGPV  626
             L  + N+L+G +
Sbjct  160  VLSFANNNLTGKI  172



>ref|XP_003522510.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=978

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 100/160 (63%), Gaps = 27/160 (17%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGLS  401
            LNDDVLGLIVFK+ ++DP   LA+W+EDD+S C  +W  VKC+P + RV EV+L G  LS
Sbjct  32   LNDDVLGLIVFKADIRDPKGKLASWNEDDESACGGSWVGVKCNPRSNRVVEVNLDGFSLS  91

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI-------------  542
            G+IGRGL++L+ L  LSLA+NN +G I+P +  + NL+ ++LS NS+             
Sbjct  92   GRIGRGLQRLQFLRKLSLANNNLTGGINPNIARIDNLRVIDLSGNSLSGEVSEDVFRQCG  151

Query  543  ------------SGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
                        SG++P +LG  S+L  +DLS N  SG V
Sbjct  152  SLRTVSLARNRFSGSIPSTLGACSALAAIDLSNNQFSGSV  191



>ref|NP_001239730.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At3g28040-like precursor [Glycine max]
 gb|ACM89592.1| leucine-rich repeat transmembrane protein kinase [Glycine max]
 gb|KHN25807.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=971

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 100/160 (63%), Gaps = 27/160 (17%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGLS  401
            LNDDVLGLIVFK+ ++DP   LA+W+EDD+S C  +W  VKC+P + RV EV+L G  LS
Sbjct  25   LNDDVLGLIVFKADIRDPKGKLASWNEDDESACGGSWVGVKCNPRSNRVVEVNLDGFSLS  84

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI-------------  542
            G+IGRGL++L+ L  LSLA+NN +G I+P +  + NL+ ++LS NS+             
Sbjct  85   GRIGRGLQRLQFLRKLSLANNNLTGGINPNIARIDNLRVIDLSGNSLSGEVSDDVFRQCG  144

Query  543  ------------SGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
                        SG++P +LG  S+L  +DLS N  SG V
Sbjct  145  SLRTVSLARNRFSGSIPSTLGACSALASIDLSNNQFSGSV  184



>ref|XP_004305081.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
 ref|XP_011466417.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=956

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+ DP + L++W+E+DD+PC W  VKC   + RVSE+ L G GLSG +
Sbjct  27   NDDVLGLIVFKAGLLDPEAKLSSWNEEDDTPCHWVGVKCDVRSNRVSELALDGFGLSGHV  86

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
             RGL +L+ +  LSL++NNF+G I+P L  +  LQ ++LS+NS+SG++PD       SL+
Sbjct  87   NRGLLRLQVIQRLSLSNNNFTGSINPDLAHIGTLQVIDLSQNSLSGSIPDEFFQQCGSLR  146

Query  588  FLDLSGNSLSGPV  626
             +  + N LSG +
Sbjct  147  VVSFAKNKLSGRI  159



>ref|XP_007140080.1| hypothetical protein PHAVU_008G082500g [Phaseolus vulgaris]
 gb|ESW12074.1| hypothetical protein PHAVU_008G082500g [Phaseolus vulgaris]
Length=968

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G++DP   L++W+EDD+SPC W  VKC P++ RV+ + L G  LSG +
Sbjct  28   NDDVLGLIVFKAGLEDPKRKLSSWNEDDNSPCNWEGVKCDPSSNRVTALVLDGFSLSGHV  87

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
             RGL +L+ L +LSL+ NNF+G+I+P L  L +LQ ++ S N++SG +P+       SL+
Sbjct  88   DRGLLRLQFLQILSLSRNNFTGLINPDLPRLGSLQAVDFSDNNLSGEIPEGFFQQCGSLR  147

Query  588  FLDLSGNSLSGPV  626
             +  + N+L+G +
Sbjct  148  TVSFAKNNLTGKI  160



>ref|XP_010683484.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=972

 Score =   118 bits (296),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+GV+DP + L +W+E DD PC WN VKC P   RV+E+ L G  LSG+I
Sbjct  26   NDDVLGLIVFKAGVKDPDAKLVSWNESDDKPCKWNGVKCDPTTNRVTEITLDGFSLSGQI  85

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSLQ  587
             R L +L+ L  +SL++NN SG ++P+   L NLQ+++LS N++SG +P+ L     SL+
Sbjct  86   SRSLLRLQFLQKISLSNNNLSGTVNPEFAHLWNLQSIDLSGNNLSGFIPNELFQQCGSLK  145

Query  588  FLDLSGNSLSG  620
             +  + N LSG
Sbjct  146  SVSFANNVLSG  156



>ref|XP_004514781.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=946

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 95/139 (68%), Gaps = 1/139 (1%)
 Frame = +3

Query  213  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  392
            +++   N+D+LGLIVFK+G++DP + L+TW+EDD SPC W+ VKC P+  RVS + L G 
Sbjct  23   SQNQPFNEDMLGLIVFKAGLEDPKNKLSTWNEDDYSPCNWDGVKCDPSTNRVSSLILDGF  82

Query  393  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  572
             L G I RGL +L+ L +LSL+ NNF+G I   L  L NL+ ++LS+N++ GT+PD    
Sbjct  83   SLYGHINRGLMRLQFLQILSLSRNNFTGTIKNDLLTLWNLKVVDLSENNLFGTIPDGFFQ  142

Query  573  MS-SLQFLDLSGNSLSGPV  626
               SL+ L  S N+L+G +
Sbjct  143  QCWSLRVLSFSKNNLTGKI  161



>ref|XP_004173348.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
Length=964

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LN+DVLGLIVFK+ ++DP   LA+W+EDDD+PC W  +KC+P + RV E++L G  L+G+
Sbjct  25   LNEDVLGLIVFKADIEDPEGKLASWNEDDDNPCNWVGLKCNPRSNRVVELNLDGFSLNGR  84

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            +GRGL +L+ L  LSLA+NN +G +SP      NL+ ++LS N   G +PD       SL
Sbjct  85   LGRGLLQLQFLRKLSLANNNLTGNLSPNNARFENLRVVDLSGNGFHGMIPDDFFRQCGSL  144

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N +SG +
Sbjct  145  RVISLANNKISGKI  158


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 55/83 (66%), Gaps = 3/83 (4%)
 Frame = +3

Query  378  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  557
            D+    LS  +G+ L  L+   VL L+ N FSG ISP +G+L++LQ LNL KNS  G +P
Sbjct  366  DIKRSSLSTTVGKALVNLQ---VLDLSHNAFSGEISPDIGILSSLQVLNLCKNSFVGAIP  422

Query  558  DSLGNMSSLQFLDLSGNSLSGPV  626
            +S+G + +L FLDLS N L+G +
Sbjct  423  ESIGGLKALVFLDLSENQLNGSI  445



>ref|XP_004138394.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN45839.1| hypothetical protein Csa_6G014590 [Cucumis sativus]
Length=964

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LN+DVLGLIVFK+ ++DP   LA+W+EDDD+PC W  +KC+P + RV E++L G  L+G+
Sbjct  25   LNEDVLGLIVFKADIEDPEGKLASWNEDDDNPCNWVGLKCNPRSNRVVELNLDGFSLNGR  84

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            +GRGL +L+ L  LSLA+NN +G +SP      NL+ ++LS N   G +PD       SL
Sbjct  85   LGRGLLQLQFLRKLSLANNNLTGNLSPNNARFENLRVVDLSGNGFHGMIPDDFFRQCGSL  144

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N +SG +
Sbjct  145  RVISLANNKISGKI  158


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 55/83 (66%), Gaps = 3/83 (4%)
 Frame = +3

Query  378  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  557
            D+    LS  +G+ L  L+   VL L+ N FSG ISP +G+L++LQ LNL KNS  G +P
Sbjct  366  DIKRSSLSTTVGKALVNLQ---VLDLSHNAFSGEISPDIGILSSLQVLNLCKNSFVGAIP  422

Query  558  DSLGNMSSLQFLDLSGNSLSGPV  626
            +S+G + +L FLDLS N L+G +
Sbjct  423  ESIGGLKALVFLDLSENQLNGSI  445



>ref|XP_004492560.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=958

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDD+LGLIVFK+G++DP   L++W+EDD++PC W  VKC P+N +V+ + L G  LSG +
Sbjct  31   NDDILGLIVFKAGLKDPNHKLSSWNEDDNTPCNWEGVKCDPSNNKVTSLVLDGFSLSGHV  90

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
             RGL +L+ L +LSL  NNF+G I+P L  L  LQ ++LS N++ GT+P+       SL+
Sbjct  91   DRGLLRLQFLQILSLKGNNFTGFINPDLPKLGTLQVVDLSDNNLQGTIPEEFFQQCGSLR  150

Query  588  FLDLSGNSLSGPV  626
             +  + N+L+G +
Sbjct  151  TVSFAKNNLTGKI  163



>ref|XP_008369373.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=973

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP   LA+WSE D+SPC W  VKC+P + RV E+ L    LSG 
Sbjct  31   LNDDVLGLIVFKADIQDPKGKLASWSEVDNSPCNWVGVKCNPRSNRVIELSLDDFSLSGH  90

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSL  584
            IGRGL +L+ L  LSL+ NN +G ++P    + NL+ L+LS+NS SG VP+ L     SL
Sbjct  91   IGRGLLQLQALRKLSLSKNNLTGSLTPNFTHIDNLRVLDLSENSFSGGVPEELFRQCGSL  150

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N  SG +
Sbjct  151  RVISLAKNKFSGKI  164



>ref|XP_004308984.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=969

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP + L +W+EDDDSPC W  V C+P +  V E++L G  LSG 
Sbjct  26   LNDDVLGLIVFKADIQDPKAKLGSWNEDDDSPCGWVGVNCNPRSNAVVELNLDGFSLSGH  85

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            IGRGL +L+ L  LSL+ NN +G +S ++  + NL+ L+LS N  SG+VP+       SL
Sbjct  86   IGRGLLQLQSLRKLSLSKNNLTGSLSAKIAHIDNLRVLDLSGNGFSGSVPEEFFRQCGSL  145

Query  585  QFLDLSGNSLSGPV  626
            + + L+GN  SG +
Sbjct  146  RVVSLAGNKFSGKI  159



>ref|XP_009363794.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
 ref|XP_009363882.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=973

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 88/134 (66%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIV K+ +QDP   LA+WSE D SPC W  VKCHP + RV E+ L    LSG 
Sbjct  31   LNDDVLGLIVLKADIQDPKGKLASWSEVDSSPCNWVGVKCHPRSNRVIELSLDDFSLSGH  90

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSL  584
            IGRGL +L+ L  LSL+ NN +G ++P    + NL+ L+LS+NS SG VP+ L     SL
Sbjct  91   IGRGLLQLQALRKLSLSKNNLTGSLTPNFTHIDNLRVLDLSENSFSGGVPEELFRQCGSL  150

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N  SG +
Sbjct  151  RVISLAKNKFSGKI  164



>ref|XP_008456780.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=964

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LN+DVLGLIVFK+ ++DP   LA+W+EDDD+PC W  +KC+P + RV E+ L G  L+G+
Sbjct  25   LNEDVLGLIVFKADIEDPEGKLASWNEDDDNPCNWVGLKCNPRSNRVVELHLDGFALNGR  84

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            +GRGL +L+ L  LSLA+NN +G +SP      NL+ ++LS N   G +PD       SL
Sbjct  85   LGRGLLQLQFLRKLSLANNNLTGNLSPNNARFENLRVVDLSGNGFHGMIPDDFFRQCGSL  144

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N +SG +
Sbjct  145  RVISLANNKISGKI  158


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = +3

Query  378  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  557
            D+    LS  +G+ L  L+   VL L+ N FSG ISP +G+L++LQ LNL KNS  G +P
Sbjct  366  DIKRSSLSTTVGKALANLQ---VLDLSHNAFSGEISPDIGILSSLQVLNLCKNSFVGAIP  422

Query  558  DSLGNMSSLQFLDLSGNSLSGPV  626
            +S+G++ +L FLDLS N L+G +
Sbjct  423  ESIGDLKALVFLDLSENQLNGSI  445



>ref|XP_003533657.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
 gb|KHN29502.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=967

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+ DP   L++W+EDD+SPC W  VKC P++ RV+ + L G  LSG +
Sbjct  28   NDDVLGLIVFKAGLDDPKRKLSSWNEDDNSPCNWEGVKCDPSSNRVTALVLDGFSLSGHV  87

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
             RGL +L+ L +LSL+ NNF+G I+P L LL +LQ ++LS N++SG +P+       SL+
Sbjct  88   DRGLLRLQSLQILSLSRNNFTGSINPDLPLLGSLQVVDLSDNNLSGEIPEGFFQQCGSLR  147

Query  588  FLDLSGNSLSGPV  626
             +  + N+L+G +
Sbjct  148  TVSFAKNNLTGKI  160



>ref|XP_007136420.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris]
 gb|ESW08414.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris]
Length=954

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 98/160 (61%), Gaps = 27/160 (17%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCA--WNFVKCHPANGRVSEVDLHGLGLS  401
            LNDDVLGLIVFK+ ++DP   LA+WSEDD+S C   W  VKC+P + RV E++L G  LS
Sbjct  32   LNDDVLGLIVFKADIRDPKGKLASWSEDDESACGAGWVGVKCNPRSNRVVEINLDGFSLS  91

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI-------------  542
            G+IGRGL++L+ L  LSLA+NN +G I+  +  + +L+ ++LS NS+             
Sbjct  92   GRIGRGLQRLQFLRKLSLANNNLTGGINSNIARIDSLRVIDLSGNSLSGQVSDDVFRQCG  151

Query  543  ------------SGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
                        SG++P +LG  S+L  +DLS N  SG V
Sbjct  152  SLRAVSLARNRFSGSIPSALGACSALAAIDLSNNQFSGSV  191



>ref|XP_010553156.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=969

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 91/135 (67%), Gaps = 2/135 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCA-WNFVKCHPANGRVSEVDLHGLGLSG  404
             NDDVLGLIVFK+G+ DP S LA+W+E+D+ PC  W  V C PA+ RV+E+ L G  LSG
Sbjct  28   FNDDVLGLIVFKAGLHDPGSKLASWNEEDNDPCINWVGVSCDPASNRVTELRLDGFSLSG  87

Query  405  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSS  581
             IGRGL +L+ L  L L++NN SG ++P+   + +LQ ++ S NS+SG +PD       S
Sbjct  88   HIGRGLLRLQSLQTLVLSNNNLSGALNPEFPHMGSLQVVDFSGNSLSGRIPDGFFEQCGS  147

Query  582  LQFLDLSGNSLSGPV  626
            L+ +  + N L+GP+
Sbjct  148  LRSVSFARNRLTGPI  162



>gb|AES79844.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=954

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
             NDD+LGLIVFK+G+QDP   L +W+EDD +PC W  VKC  +N RV+ V L G  LSG 
Sbjct  36   FNDDILGLIVFKAGLQDPKHKLISWNEDDYTPCNWEGVKCDSSNNRVTSVILDGFSLSGH  95

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            I RGL +L+ L  LSL+ NNF+G I+P L  L +LQ ++ S N++ GT+P+       SL
Sbjct  96   IDRGLLRLQFLQTLSLSGNNFTGFINPDLPKLGSLQVVDFSDNNLKGTIPEGFFQQCGSL  155

Query  585  QFLDLSGNSLSGPV  626
            + ++ + N+L+G +
Sbjct  156  KTVNFAKNNLTGNI  169



>gb|EPS70735.1| hypothetical protein M569_04020, partial [Genlisea aurea]
Length=954

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 95/140 (68%), Gaps = 1/140 (1%)
 Frame = +3

Query  210  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  389
            G+ +  LNDDVLGLIVFK+ +QDP   L++W+E+DDS C W  VKC P + RVSE+ L G
Sbjct  1    GSGTPSLNDDVLGLIVFKADIQDPEGKLSSWNEEDDSACNWVSVKCDPRSKRVSELSLDG  60

Query  390  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSL  566
              L+GK+GRGL +L+ L  LSLA NN +G +S  L  L NL+ L+LS N+ SG++P D  
Sbjct  61   FSLTGKLGRGLLQLQFLRKLSLAKNNLTGSLSLSLAQLPNLKFLDLSDNAFSGSIPNDFF  120

Query  567  GNMSSLQFLDLSGNSLSGPV  626
               +SL+ + L+ N  SG +
Sbjct  121  TQCASLRSISLALNRFSGQI  140



>ref|XP_003623626.1| Receptor-like protein kinase [Medicago truncatula]
Length=948

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
             NDD+LGLIVFK+G+QDP   L +W+EDD +PC W  VKC  +N RV+ V L G  LSG 
Sbjct  30   FNDDILGLIVFKAGLQDPKHKLISWNEDDYTPCNWEGVKCDSSNNRVTSVILDGFSLSGH  89

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            I RGL +L+ L  LSL+ NNF+G I+P L  L +LQ ++ S N++ GT+P+       SL
Sbjct  90   IDRGLLRLQFLQTLSLSGNNFTGFINPDLPKLGSLQVVDFSDNNLKGTIPEGFFQQCGSL  149

Query  585  QFLDLSGNSLSGPV  626
            + ++ + N+L+G +
Sbjct  150  KTVNFAKNNLTGNI  163



>emb|CBI25352.3| unnamed protein product [Vitis vinifera]
Length=847

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 93/138 (67%), Gaps = 5/138 (4%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGLIVFK+ +QDP S LA+W+EDDDSPC W  VKC+P + RV+++ L G  LSGK
Sbjct  26   LNDDVLGLIVFKADIQDPNSKLASWNEDDDSPCNWVGVKCNPRSNRVTDLVLDGFSLSGK  85

Query  408  IGRGLEKLE-----HLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  572
            IGRGL +L       L  +  +SN FSG +   +  L  L++L+LS N + G +P  + +
Sbjct  86   IGRGLLQLHVGSCSTLAAIDFSSNQFSGPLPSGIWSLNGLRSLDLSDNLLEGDIPKGIDS  145

Query  573  MSSLQFLDLSGNSLSGPV  626
            + +L+ ++LS N  SGP+
Sbjct  146  LYNLRAINLSKNRFSGPL  163



>gb|KJB71525.1| hypothetical protein B456_011G127000 [Gossypium raimondii]
Length=967

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 90/131 (69%), Gaps = 1/131 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLI FK+G++DP + L +WS DD+ PC W  VKC P   RV+E+ L GL LSG +
Sbjct  27   NDDVLGLIFFKAGLKDPTAKLQSWSADDNDPCNWMGVKCDPTTYRVTELHLDGLSLSGHV  86

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +L  L VLSL+ NN +G I+ +L  + +L+ ++LS NS+SG++PD       SL+
Sbjct  87   GRGLLRLPFLQVLSLSKNNLTGTINSELSRIGSLRVIDLSGNSLSGSIPDDFFTQCGSLR  146

Query  588  FLDLSGNSLSG  620
             +  + N+L+G
Sbjct  147  SISFARNNLTG  157



>ref|XP_007033525.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY04451.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=965

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLI FK+G+ DP + L +WSEDD+ PC W  VKC P   RV+E+ L GL LSG +
Sbjct  24   NDDVLGLIFFKAGLDDPNAKLQSWSEDDNDPCNWMGVKCDPTTYRVTELHLDGLSLSGHV  83

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +L+ L VLSL++NN +G I+ +L  + +L+ ++LS NS+SG +PD       SL 
Sbjct  84   GRGLLRLQFLQVLSLSNNNLTGPINSELSHIGSLKVIDLSGNSLSGLIPDDFFAQCGSLG  143

Query  588  FLDLSGNSLSGPV  626
             +  + N+L+G +
Sbjct  144  SVSFARNNLTGQI  156



>ref|XP_009406353.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1025

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 103/142 (73%), Gaps = 1/142 (1%)
 Frame = +3

Query  204  AGGAE-SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  380
            AGGA+    LND+VLGLIVFKS ++DPA  LATW+E D +PC W+ V+C  A+ RV  +D
Sbjct  31   AGGADLPTPLNDEVLGLIVFKSVLEDPAGALATWNEADATPCNWSHVECGVASSRVVRLD  90

Query  381  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  560
            L  L LSG + RGL++L  L  LSLA NN SG I P L LL +L++L+LS+N+ SG +PD
Sbjct  91   LASLSLSGPLPRGLDRLPALASLSLADNNLSGPIPPGLSLLPSLRSLDLSRNAFSGRLPD  150

Query  561  SLGNMSSLQFLDLSGNSLSGPV  626
             L  +SS++ LDLS NSL+GP+
Sbjct  151  DLSLLSSIRSLDLSSNSLAGPI  172



>ref|XP_011095143.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=979

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+ DP S L +W+E+DDS C W  V+C     RVSE+ L G  LSG +
Sbjct  39   NDDVLGLIVFKAGLTDPLSRLTSWNEEDDSACNWVGVRCDQDTNRVSELILDGFSLSGHL  98

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSLQ  587
            GR L +L+ L VL L+ NNFSG ++P L  + +LQ ++L++NS+SG +P+ L     SL 
Sbjct  99   GRSLIRLQFLRVLQLSRNNFSGSVNPILAQIPSLQVIDLTENSLSGFIPEELFQQCGSLN  158

Query  588  FLDLSGNSLSGPV  626
             + L+ N+L+G +
Sbjct  159  SISLAKNNLTGSI  171



>gb|EEC75203.1| hypothetical protein OsI_11455 [Oryza sativa Indica Group]
Length=971

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 97/143 (68%), Gaps = 1/143 (1%)
 Frame = +3

Query  201  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  380
            G G A +  L+DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ + 
Sbjct  21   GGGPASAAALDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPLTGRVAGLS  80

Query  381  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  560
            L G GLSGK+GRGL +LE L  LSL+ NNFSG +   L  L +LQ+L+LS N+ SG +PD
Sbjct  81   LAGFGLSGKLGRGLLRLESLQSLSLSGNNFSGDLPADLARLPDLQSLDLSANAFSGAIPD  140

Query  561  S-LGNMSSLQFLDLSGNSLSGPV  626
               G+  +L+ + L+ N+ SG V
Sbjct  141  GFFGHCRNLRDVSLANNAFSGDV  163



>ref|XP_010092789.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB52375.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=957

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDV GLIVFK+G+QDP   L +W+EDD++P  W  VKC     RVSE+ L G  LSG I
Sbjct  24   NDDVWGLIVFKAGLQDPEEKLISWNEDDENPSKWVGVKCDSQTNRVSELSLDGFSLSGHI  83

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
             +GL +L+ L  LSL+ NNFSG I+P L  L  LQ ++LS+N +SG +PD       SL+
Sbjct  84   DKGLLRLQFLQKLSLSKNNFSGTINPDLPHLGGLQVIDLSENRLSGQIPDEFFQQCGSLR  143

Query  588  FLDLSGNSLSGPV  626
             +  +GN L+G +
Sbjct  144  EVSFAGNGLTGQI  156



>gb|KEH35536.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=989

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 93/136 (68%), Gaps = 3/136 (2%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGLS  401
            LNDDVLGLIVFK+ ++DP   L +W+EDD+S C  +W  VKC+P + RV EV+L+G  LS
Sbjct  39   LNDDVLGLIVFKADIKDPKGKLTSWNEDDESACGGSWVGVKCNPRSNRVVEVNLNGFSLS  98

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMS  578
            G+IGRGL++L+ L  L L +NN +G I+  +  + NL+ L+LS N++SG VPD       
Sbjct  99   GRIGRGLQRLQFLRRLYLGNNNLTGSINANIATIDNLRVLDLSNNNLSGVVPDDFFRQCG  158

Query  579  SLQFLDLSGNSLSGPV  626
            S++ + L+ N  SG V
Sbjct  159  SMRVVSLARNRFSGNV  174



>ref|XP_003605286.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES87483.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=866

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 97/140 (69%), Gaps = 2/140 (1%)
 Frame = +3

Query  213  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  392
            +++   N+D+LGLIVFK+G++DP + L++W+EDD SPC W  VKC P+  RVS + L G 
Sbjct  22   SQNQPFNEDMLGLIVFKAGLEDPKNKLSSWNEDDYSPCNWEGVKCDPSTNRVSSLVLDGF  81

Query  393  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlgllt-nlqtlnlSKNSISGTVPDSLG  569
             LSG IG+ L +L+ L +LSL+ NNF+G I+  L +   NL+ ++LS+N++ GT+PD L 
Sbjct  82   SLSGHIGKSLMRLQFLQILSLSRNNFTGRINHDLLITLWNLKVVDLSENNLVGTIPDELF  141

Query  570  NMS-SLQFLDLSGNSLSGPV  626
                SL+ L  + N+L+G +
Sbjct  142  KQCWSLRVLSFAKNNLTGTI  161



>ref|XP_002870895.1| hypothetical protein ARALYDRAFT_486880 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47154.1| hypothetical protein ARALYDRAFT_486880 [Arabidopsis lyrata subsp. 
lyrata]
Length=968

 Score =   112 bits (281),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFKSG+ DP S L++W+ +D  PC W    C PA+ RVSE+ L    LSG I
Sbjct  26   NDDVLGLIVFKSGLDDPLSKLSSWNSEDYDPCNWVGCTCDPASNRVSELRLDSFSLSGHI  85

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +L+ L+ L L++NN +G ++P+   L +LQ ++ S NS+SG +PD       SL+
Sbjct  86   GRGLLRLQFLHTLVLSNNNLTGTLNPEFPHLGSLQVVDFSGNSLSGRIPDGFFEQCGSLR  145

Query  588  FLDLSGNSLSGPV  626
             + L+ N L+GP+
Sbjct  146  SVSLANNKLTGPL  158



>ref|XP_002990527.1| hypothetical protein SELMODRAFT_131809 [Selaginella moellendorffii]
 gb|EFJ08404.1| hypothetical protein SELMODRAFT_131809 [Selaginella moellendorffii]
Length=193

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 86/135 (64%), Gaps = 3/135 (2%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+ + DP   LA+WSED  SP  W  ++C P +G V++V L GL LSG +
Sbjct  16   NDDVLGLIVFKADLHDPRRALASWSEDSASPRNWTGIQCSPQSGTVTQVTLDGLELSGPL  75

Query  411  GRGLEKLEHLN---VLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  581
            GRGL KL+HL     L  + N  SG I   +G L+ L +L+LS NS+SG +P  LG    
Sbjct  76   GRGLLKLDHLQSLEALGASENRLSGSIPAGVGSLSRLSSLDLSHNSLSGEIPPELGQCQM  135

Query  582  LQFLDLSGNSLSGPV  626
            L  LDLS N LSG +
Sbjct  136  LVSLDLSYNLLSGEI  150



>dbj|BAF79960.1| receptor-like kinase [Marchantia polymorpha]
Length=979

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = +3

Query  225  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  404
            +++D+V+ L+VFK+GV DP S L++W++ D  PC W  + C  A GRV+++ L GL LSG
Sbjct  35   RISDEVMALLVFKAGVIDPNSVLSSWNDIDMDPCHWTGITCSSATGRVTDITLVGLSLSG  94

Query  405  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  584
             I R L KLE L  L+LA+NNF+G ++ +L   ++L+ LN+S N++SG++P S G+  +L
Sbjct  95   TIARALVKLEELQTLTLANNNFTGPLNGELAEFSDLKVLNVSHNALSGSIPASFGSAGNL  154

Query  585  QFLDLSGNSLSG  620
              LDLS N+ +G
Sbjct  155  YALDLSNNAFTG  166



>ref|XP_006398567.1| hypothetical protein EUTSA_v10012579mg [Eutrema salsugineum]
 gb|ESQ40020.1| hypothetical protein EUTSA_v10012579mg [Eutrema salsugineum]
Length=972

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C P + RV+E+ L G  LSG I
Sbjct  27   NDDVLGLIVFKAGLDDPYSKLASWNAEDYDPCNWAGCVCDPGSNRVTELRLDGFSLSGHI  86

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +L+ L+ L L++NN +G ++P+   L  LQ L+ S N++SG +PD       SL+
Sbjct  87   GRGLLRLQFLHTLVLSNNNLTGTLNPEFPHLGTLQVLDFSGNNLSGRIPDGFFEQCGSLR  146

Query  588  FLDLSGNSLSGPV  626
             + L+ N L+GP+
Sbjct  147  SVSLANNQLTGPL  159



>ref|XP_009125388.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=925

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 90/139 (65%), Gaps = 1/139 (1%)
 Frame = +3

Query  213  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  392
            AE    NDDVLGLIVFK+G+ DP S LA+W+ +D  PC+W    C PA  +V+E+ L G 
Sbjct  22   AEDPTFNDDVLGLIVFKAGLDDPFSKLASWNSEDYDPCSWVGCVCDPATNQVTELRLDGF  81

Query  393  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-G  569
             LSG IGRGL +L+ L+ L L++NN +G ++ +L     LQ L+ S N++SG +PD L  
Sbjct  82   SLSGHIGRGLLRLQSLHTLVLSNNNLTGALNSELTHRGTLQLLDFSGNNLSGRIPDGLFE  141

Query  570  NMSSLQFLDLSGNSLSGPV  626
               SL+ + L  N L+GP+
Sbjct  142  QCGSLRSVSLGRNRLTGPL  160



>gb|EMT18823.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=973

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 92/131 (70%), Gaps = 1/131 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+ V DP   LATWSEDD+  CAW  + C P  GRVS ++L G GLSGK+
Sbjct  31   NDDVLGLIVFKADVVDPEGRLATWSEDDERACAWAGITCDPRTGRVSGLNLAGFGLSGKL  90

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +LE L  LSL++NNFSG I P L  L +LQ+L+LS N+ SG +PD   G   +L+
Sbjct  91   GRGLLRLESLPSLSLSANNFSGDIPPDLARLPDLQSLDLSSNAFSGAIPDGFFGKCHALR  150

Query  588  FLDLSGNSLSG  620
             + L+ N+ +G
Sbjct  151  DVSLANNAFTG  161



>emb|CBI18033.3| unnamed protein product [Vitis vinifera]
Length=808

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 90/135 (67%), Gaps = 3/135 (2%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+QDP S L +W+EDD++PC W  VKC     RVSE+ L    LSG+I
Sbjct  24   NDDVLGLIVFKAGLQDPESKLISWNEDDNNPCNWAGVKCDRQTNRVSELLLDNFSLSGRI  83

Query  411  GRGLEKLEHLNVLS---LASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  581
            GRGL +L+ L +LS    +SN  SG +   +  L  L++L+LS N + G +P+ +G++ S
Sbjct  84   GRGLLRLQFLRILSGVNFSSNQLSGQLPDGIWSLYGLRSLDLSNNFLEGEIPEGIGSLYS  143

Query  582  LQFLDLSGNSLSGPV  626
            L+ ++L  N  SG +
Sbjct  144  LRAINLGKNKFSGRI  158



>ref|XP_003557968.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brachypodium distachyon]
Length=970

 Score =   110 bits (274),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 92/142 (65%), Gaps = 1/142 (1%)
 Frame = +3

Query  198  SGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  377
            +G G      LNDDVLGLIVFK+ V DP   LATWSEDD+  CAW  V C P   RVS +
Sbjct  20   AGRGAGSVAALNDDVLGLIVFKADVVDPEGRLATWSEDDERACAWAGVTCDPRTSRVSGL  79

Query  378  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  557
             L G GLSGK+GRGL +LE L  LSL+ NNFSG +   L  L +LQ+L+LS N+ SG VP
Sbjct  80   SLDGFGLSGKLGRGLLRLESLQSLSLSRNNFSGDLPADLARLPDLQSLDLSSNAFSGAVP  139

Query  558  DS-LGNMSSLQFLDLSGNSLSG  620
            D   G   SL+ + L+ N+ SG
Sbjct  140  DGFFGKCHSLRDVSLANNAFSG  161



>ref|XP_006279331.1| hypothetical protein CARUB_v10012717mg [Capsella rubella]
 gb|EOA12229.1| hypothetical protein CARUB_v10012717mg [Capsella rubella]
Length=967

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG I
Sbjct  25   NDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGHI  84

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +L+ L+ L L++NN +G ++P+   L +LQ +N S N++SG +PD       SL+
Sbjct  85   GRGLLRLQFLHTLVLSNNNLTGNLNPEFPRLGSLQVINFSGNNLSGRIPDGFFEQCGSLR  144

Query  588  FLDLSGNSLSGPV  626
             + L+ N L+GP+
Sbjct  145  SVSLANNKLTGPL  157



>ref|XP_006650049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Oryza brachyantha]
Length=971

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +3

Query  234  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  413
            DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVVDPEGRLATWSEDDERPCAWASVTCDPLTGRVAGLSLAGFGLSGKLG  91

Query  414  RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQF  590
            RGL +LE L  LSL+ NNFSG +   L  L +LQ+L+LS N+ SG +PD   G+  SL+ 
Sbjct  92   RGLLRLESLQSLSLSRNNFSGDLPADLARLPDLQSLDLSSNAFSGAIPDGFFGHCRSLRD  151

Query  591  LDLSGNSLSGPV  626
            + L+ N+ SG V
Sbjct  152  ISLANNAFSGDV  163



>ref|NP_001050035.1| Os03g0335500 [Oryza sativa Japonica Group]
 gb|ABF95811.1| leucine-rich repeat transmembrane protein kinase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11949.1| Os03g0335500 [Oryza sativa Japonica Group]
Length=971

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            L+DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ + L G GLSGK
Sbjct  30   LDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPLTGRVAGLSLAGFGLSGK  89

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            +GRGL +LE L  LSL+ NNFSG +   L  L +LQ+L+LS N+ SG +PD   G+  +L
Sbjct  90   LGRGLLRLESLQSLSLSGNNFSGDLPADLARLPDLQSLDLSANAFSGAIPDGFFGHCRNL  149

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N+ SG V
Sbjct  150  RDVSLANNAFSGDV  163



>ref|XP_003567498.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brachypodium distachyon]
Length=1056

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 92/138 (67%), Gaps = 5/138 (4%)
 Frame = +3

Query  222  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  401
            + +N++VLGL+VF+S + DP+  L+ WSE D +PC W  V+C PA  RV  + L  L LS
Sbjct  35   MPVNEEVLGLVVFRSALADPSGALSAWSESDATPCGWAHVECDPATSRVLRLSLDNLFLS  94

Query  402  -----GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  566
                 G I RGL++L  L  LSLA NNFSG +SP L LL +L++L+LS N+ SG +P+  
Sbjct  95   STSGTGGIPRGLDRLPALQSLSLAGNNFSGNLSPGLSLLASLRSLDLSHNAFSGNLPEDF  154

Query  567  GNMSSLQFLDLSGNSLSG  620
              + +L++LDL+ NS SG
Sbjct  155  PFLPALRYLDLTANSFSG  172


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 51/88 (58%), Gaps = 0/88 (0%)
 Frame = +3

Query  363  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  542
            R+  +DL    LSG +  G+  L +L  + L+ N FSG I   +GL  +L  ++LS N+ 
Sbjct  231  RLRALDLSNNRLSGPVAAGIASLHNLKTVDLSGNRFSGAIPADIGLCPHLSRIDLSSNAF  290

Query  543  SGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
             G +P S+G +SSL F   SGN LSG V
Sbjct  291  DGALPGSIGALSSLVFFSASGNRLSGQV  318



>ref|NP_195809.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL11557.1|AF424563_1 AT5g01890/T20L15_160 [Arabidopsis thaliana]
 emb|CAB82759.1| putative protein [Arabidopsis thaliana]
 gb|AAO42766.1| At5g01890/T20L15_160 [Arabidopsis thaliana]
 gb|ACN59360.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED90406.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
Length=967

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+ DP S L++W+ +D  PC W    C PA  RVSE+ L    LSG I
Sbjct  25   NDDVLGLIVFKAGLDDPLSKLSSWNSEDYDPCNWVGCTCDPATNRVSELRLDAFSLSGHI  84

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +L+ L+ L L++NN +G ++P+   L +LQ ++ S N++SG +PD       SL+
Sbjct  85   GRGLLRLQFLHTLVLSNNNLTGTLNPEFPHLGSLQVVDFSGNNLSGRIPDGFFEQCGSLR  144

Query  588  FLDLSGNSLSGPV  626
             + L+ N L+G +
Sbjct  145  SVSLANNKLTGSI  157



>ref|XP_010451924.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=953

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 88/136 (65%), Gaps = 7/136 (5%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG I
Sbjct  25   NDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGHI  84

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL----GNMS  578
            GRGL +L+ L  L L++NN +G I+P+   L +LQ ++ S N +SG +P+      G++S
Sbjct  85   GRGLLRLQFLRALVLSNNNLTGTINPEFPHLGSLQVVDFSGNHLSGRIPEGFFEQCGSLS  144

Query  579  SLQFLDLSGNSLSGPV  626
            S+ F   + N L+GP+
Sbjct  145  SVSF---ANNKLTGPL  157



>emb|CDP13903.1| unnamed protein product [Coffea canephora]
Length=898

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 89/137 (65%), Gaps = 6/137 (4%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL-----  392
            +NDDVLGLIVFK+ VQDP   LA+W+EDD+SPC WN V+C+P + RVSE+ L GL     
Sbjct  1    MNDDVLGLIVFKADVQDPQGKLASWNEDDESPCIWNGVQCNPRSNRVSELVLDGLSLADN  60

Query  393  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPq-lglltnlqtlnlSKNSISGTVPDSLG  569
             L+G +   L +L +L  L L+ N+ SG IS        +L++L+L+KN  SG +P SL 
Sbjct  61   NLTGSLTLSLGQLPNLRTLDLSGNSLSGPISSDFFQQCGSLRSLSLAKNKFSGQIPASLS  120

Query  570  NMSSLQFLDLSGNSLSG  620
            + S L  L++S N  SG
Sbjct  121  SCSMLTSLNISSNQFSG  137



>ref|XP_010490496.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=967

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 88/136 (65%), Gaps = 7/136 (5%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG I
Sbjct  25   NDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDSFSLSGHI  84

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP----DSLGNMS  578
            GRGL +L+ L  L L++NN +G ++P+   L +LQ ++ S N +SG +P    +  G++S
Sbjct  85   GRGLLRLQFLRALVLSNNNLTGTLNPEFPHLGSLQVVDFSGNHLSGRIPEGFFEQCGSLS  144

Query  579  SLQFLDLSGNSLSGPV  626
            S+ F   + N L+GP+
Sbjct  145  SVSF---ANNKLTGPL  157



>gb|EAZ26832.1| hypothetical protein OsJ_10748 [Oryza sativa Japonica Group]
Length=971

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            L+DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ + L   GLSGK
Sbjct  30   LDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPITGRVAGLSLACFGLSGK  89

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  584
            +GRGL +LE L  LSL+ NNFSG +   L  L +LQ+L+LS N+ SG +PD   G+  +L
Sbjct  90   LGRGLLRLESLQSLSLSGNNFSGDLPADLARLPDLQSLDLSANAFSGAIPDGFFGHCRNL  149

Query  585  QFLDLSGNSLSGPV  626
            + + L+ N+ SG V
Sbjct  150  RDVSLANNAFSGDV  163



>gb|KFK24685.1| hypothetical protein AALP_AA8G011600 [Arabis alpina]
Length=976

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 89/140 (64%), Gaps = 1/140 (1%)
 Frame = +3

Query  204  AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  383
            A   ++   NDDVLGLIVFKSG+ DP S L++W+ +D  PC W    C P+  RV+E+ L
Sbjct  21   AAAGQNPTFNDDVLGLIVFKSGLHDPLSKLSSWNSEDLDPCNWLGCICDPSTNRVTELRL  80

Query  384  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  563
             G  LSG IGRGL +L  L+ L L++NN +G ++P+   L +LQ L+ S N++SG +PD+
Sbjct  81   DGFSLSGHIGRGLLRLNFLHTLLLSNNNLTGTLNPEFPHLGSLQVLDFSGNNLSGRIPDA  140

Query  564  -LGNMSSLQFLDLSGNSLSG  620
                  SL+ +  + N L+G
Sbjct  141  FFQQCGSLRSVSFANNKLTG  160



>ref|XP_008776998.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=1008

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 95/168 (57%), Gaps = 27/168 (16%)
 Frame = +3

Query  204  AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  383
            A G     LND+VLGLIVFKS ++DP + LA+WSE D + C W  V+C PA   V  + L
Sbjct  25   ADGDLPTPLNDEVLGLIVFKSALEDPTAALASWSETDATACGWAHVECDPATSHVLRLYL  84

Query  384  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  563
              L LSG + RGL++L +L  LS+++NN SG++   L LL  L +L+LS+N+ SG +P  
Sbjct  85   DSLSLSGPLPRGLDRLPYLESLSISNNNLSGLLPAGLSLLPRLHSLDLSRNAFSGRLPQD  144

Query  564  LGNM---------------------------SSLQFLDLSGNSLSGPV  626
            LGN+                           SSL++L L+ N L GP+
Sbjct  145  LGNITNLRSLDLSSNSLSGPIPDSLFSAATCSSLRYLSLAENRLEGPI  192



>dbj|BAK06250.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=973

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+ V DP   LATWSEDD+  CAW  + C P  GRVS ++L G GLSGK+
Sbjct  31   NDDVLGLIVFKADVVDPEGRLATWSEDDERACAWAGITCDPRTGRVSGLNLAGFGLSGKL  90

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  587
            GRGL +LE L  LSL++NNFSG I P L  L +LQ+L+LS N+ S  +P+   G   +L+
Sbjct  91   GRGLLRLESLQSLSLSANNFSGDIPPDLARLPDLQSLDLSCNAFSAPIPEGFFGKCHALR  150

Query  588  FLDLSGNSLSG  620
             + L+ N+ +G
Sbjct  151  DVSLANNAFTG  161



>emb|CDY27220.1| BnaA09g35820D [Brassica napus]
Length=936

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 92/158 (58%), Gaps = 27/158 (17%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGL+ FKS ++DP   LA+W+EDD +PCAWN VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLVAFKSDLRDPDQKLASWNEDDYTPCAWNGVKCHPRTNRVTELTLDGFSLSGR  88

Query  408  IGRGLEKLE---------------------------HLNVLSLASNNFSGVISPqlgllt  506
            IGRGL +L                             L V S+A N  +G I   +G  +
Sbjct  89   IGRGLLQLHLVSLKVVDLSGNGLSGSLPDGFFRQCGSLRVFSVAENKLTGKIPVSVGSCS  148

Query  507  nlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSG  620
            +L +LNLS N  SG++P  + ++++L+ LDLS N L G
Sbjct  149  SLASLNLSSNRFSGSMPLGIWSLNTLRSLDLSRNELEG  186



>ref|XP_009415955.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1020

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LND+V+GLIVFK+ ++DP + LA+W+E D +PC W  V+C P   RV  + L  L LSG 
Sbjct  49   LNDEVMGLIVFKAALEDPTAALASWNEADATPCGWAHVRCDPRTSRVVRLALDSLSLSGP  108

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  587
            + RGL++L  L  LSL++NN SG + P L LL  L++L+LS+NS SG++P  L  + S+ 
Sbjct  109  LPRGLDRLPALASLSLSNNNLSGPVPPGLSLLPALRSLDLSRNSFSGSLPGDLAFLPSIV  168

Query  588  FLDLSGNSLSGPV  626
             LDLS N+LSGP+
Sbjct  169  SLDLSSNALSGPL  181


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +3

Query  363  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  542
            R+  + L+G   SG I  G+    HL++L L+ N+F G +   +  L +L +L LS N +
Sbjct  267  RLRNLQLNGNRFSGTIPAGVGLCRHLSILDLSYNSFEGALPSSMRYLGSLTSLKLSDNQL  326

Query  543  SGTVPDSLGNMSSLQFLDLSGNSLSG  620
            SG VP  +GN++++Q +DLS N L+G
Sbjct  327  SGDVPAWIGNLTTIQQVDLSNNKLAG  352



>emb|CDX72142.1| BnaC08g27320D [Brassica napus]
Length=936

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 91/158 (58%), Gaps = 27/158 (17%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            LNDDVLGL+ FKS ++DP   LA+W+EDD +PCAWN VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLVAFKSDLRDPDQKLASWNEDDYTPCAWNGVKCHPRTNRVTELTLDGFSLSGR  88

Query  408  IGRGLEKLE--HLNVLSLASNNFSGVISPq-lglltnlqtlnlSKNSISGTVPDSLG---  569
            IGRGL +L    L V+ L+ N  SG +         +L+  ++++N ++G +P S+G   
Sbjct  89   IGRGLLQLHLVSLKVVDLSGNGLSGSLPDGFFRQCGSLRAFSVAENKLTGKIPVSVGSCS  148

Query  570  ---------------------NMSSLQFLDLSGNSLSG  620
                                 ++++L+ LDLS N L G
Sbjct  149  SLASLNLSSNGFSGSMPLGIWSLNTLRSLDLSRNELEG  186



>ref|XP_001769840.1| predicted protein [Physcomitrella patens]
 gb|EDQ65402.1| predicted protein [Physcomitrella patens]
Length=947

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            ++DDVLGL+ FK+G+ DP   L +W EDD SPCAW  + C    GRVSE++L G  L G+
Sbjct  13   MSDDVLGLMAFKAGLHDPTEALRSWREDDASPCAWAGIVCDRVTGRVSELNLVGFSLIGQ  72

Query  408  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  584
            IGRGL KL+ L  L+L+ NN +G I  ++  L  L  L+LS N+++G +  D   +  SL
Sbjct  73   IGRGLIKLDELQTLNLSFNNLTGSIDAEVARLPILVLLDLSNNAMTGPMAEDFFTSCQSL  132

Query  585  QFLDLSGNSLSGPV  626
              L L GNSL+G +
Sbjct  133  VSLYLVGNSLNGSI  146



>emb|CDY04822.1| BnaAnng00040D [Brassica napus]
Length=928

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 85/140 (61%), Gaps = 5/140 (4%)
 Frame = +3

Query  213  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  392
            AE    NDDVLGLIVFK+G+ DP S LA+W+ +D  PC+W    C PA  +V+E+ L G 
Sbjct  23   AEDPTFNDDVLGLIVFKAGLDDPFSKLASWNSEDYDPCSWVGCVCDPATNQVTELRLDGF  82

Query  393  GLSGKIGRGLEKLEHLNVLSL--ASNNFSGVISPqlglltnlqtlnlS--KNSISGTVPD  560
             LSG IGRGL +L+ L+ L L  + NN SG I P           ++S  +N ++G +P 
Sbjct  83   SLSGHIGRGLLRLQSLHTLLLDFSGNNLSGRI-PDGFFEQCGSLRSVSLGRNRLTGPLPV  141

Query  561  SLGNMSSLQFLDLSGNSLSG  620
            SL   S+L  L+LS N LSG
Sbjct  142  SLSYCSTLTHLNLSSNQLSG  161



>ref|XP_010424006.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Camelina sativa]
Length=959

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 86/134 (64%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG I
Sbjct  25   NDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGHI  84

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP----DSLGNMS  578
            GRGL +L+ L  L L++NN +G ++P+   L +LQ ++ S N +SG +P    +  G++S
Sbjct  85   GRGLLRLQFLRALVLSNNNLTGTLNPEFPHLGSLQVVDFSGNHLSGRIPEGFFEQCGSLS  144

Query  579  SLQFLDLSGNSLSG  620
            S+ F   + N L+G
Sbjct  145  SVSF---ANNKLTG  155



>ref|XP_010424007.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Camelina sativa]
Length=955

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 86/134 (64%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  410
            NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG I
Sbjct  25   NDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGHI  84

Query  411  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP----DSLGNMS  578
            GRGL +L+ L  L L++NN +G ++P+   L +LQ ++ S N +SG +P    +  G++S
Sbjct  85   GRGLLRLQFLRALVLSNNNLTGTLNPEFPHLGSLQVVDFSGNHLSGRIPEGFFEQCGSLS  144

Query  579  SLQFLDLSGNSLSG  620
            S+ F   + N L+G
Sbjct  145  SVSF---ANNKLTG  155



>ref|XP_009589224.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Nicotiana tomentosiformis]
Length=938

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +3

Query  357  NGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKN  536
            NGRVSE++L+GL LSGKIGRGLEKL+ L VLSL++NNF+G ISP+LGLL NL+ LNLS+N
Sbjct  2    NGRVSELNLNGLSLSGKIGRGLEKLQSLQVLSLSNNNFTGPISPELGLLINLENLNLSQN  61

Query  537  SISGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
             +SG +P S+  M+SLQFLDLS NSLSGPV
Sbjct  62   GLSGNIPASISKMTSLQFLDLSENSLSGPV  91


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +3

Query  363  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  542
            ++ E  L G   SG++   +    HLN L L+ N F+G I   +  L  L  L LS N I
Sbjct  176  QLKEFLLQGNQFSGELPSDIGFCPHLNKLDLSENLFTGAIPESVQKLNALSFLTLSNNMI  235

Query  543  SGTVPDSLGNMSSLQFLDLSGNSLSG  620
            +G  P  + NMSSL++LD SGNSL G
Sbjct  236  NGDFPQWISNMSSLEYLDFSGNSLEG  261



>ref|XP_010670069.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=976

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 90/152 (59%), Gaps = 25/152 (16%)
 Frame = +3

Query  240  VLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRG  419
            VLGLIVFK+ ++DP   L +W+EDD+  C W  VKC+P + RVSE++L GL LSGK+GRG
Sbjct  36   VLGLIVFKADIKDPNGKLRSWNEDDNDSCKWYGVKCNPRSNRVSELNLDGLSLSGKLGRG  95

Query  420  LEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGT----------------  551
            L +L+ L  LSL++NN +G +S  L  LTNL+ L+LS N+ SG                 
Sbjct  96   LLQLQSLRKLSLSNNNLTGSLSSALVRLTNLRILDLSDNNFSGVMSSDFFRQCGPLRSIN  155

Query  552  ---------VPDSLGNMSSLQFLDLSGNSLSG  620
                     +PDSL +   L  L+LS N  SG
Sbjct  156  LANNKFSGEIPDSLSSCVGLTVLNLSANQFSG  187



>ref|XP_009789234.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=972

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 92/161 (57%), Gaps = 25/161 (16%)
 Frame = +3

Query  213  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  392
            A +L  NDD+LGL+VFK+ +QDP  +L +W+E+DDSPC WN +KC+P + RVS++ L G 
Sbjct  21   ALNLSFNDDILGLMVFKADIQDPLGNLVSWNEEDDSPCNWNGIKCNPRSNRVSQIVLDGF  80

Query  393  GLSGK------------------------IGRGLEKLEHLNVLSLASNNFSGVI-SPqlg  497
            GLSGK                        I   + +L++L VL L+ NNF G+I      
Sbjct  81   GLSGKISRGLLRLQLLRKLSLAKNNFTGSISSTVVQLDNLRVLDLSENNFFGLIPGDFFR  140

Query  498  lltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSG  620
                L++++L+KN   G +P SL +  +L  L+LS N  SG
Sbjct  141  QCGPLRSVSLAKNKFLGKIPGSLSSCVALGSLNLSSNQFSG  181



>ref|XP_011076585.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Sesamum indicum]
Length=987

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 95/157 (61%), Gaps = 26/157 (17%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCA-WNFVKCHPANGRVSEVDLHGLGLSG  404
            LNDDVLGLIVFK+ ++DP   L++W+EDDDSPC  W  VKC+P + RVSE+ L G GLSG
Sbjct  25   LNDDVLGLIVFKADIRDPDQKLSSWNEDDDSPCNNWIGVKCNPRSNRVSELVLDGFGLSG  84

Query  405  KIGRGLEKLEHLNVLSLASNNFSG-------------------------VISPqlglltn  509
            K+GRGL +L+ L  LSLA NN +G                         + S       +
Sbjct  85   KLGRGLLQLQSLQKLSLAKNNLTGSLSLSLAQLSDLRVLDLSENGLWGSISSDFFMQCGS  144

Query  510  lqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSG  620
            L++++L++N  SG +P+SLG+ S+L  L+ SGN   G
Sbjct  145  LRSISLARNKFSGPIPESLGSCSTLTSLNFSGNQFLG  181



>ref|XP_002990711.1| hypothetical protein SELMODRAFT_132189, partial [Selaginella 
moellendorffii]
 gb|EFJ08160.1| hypothetical protein SELMODRAFT_132189, partial [Selaginella 
moellendorffii]
Length=908

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = +3

Query  276  DPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSL  455
            DP   LA+WSED  SPC W  ++C P +GRV++V L GL LSG +GRGL KL+HL VLSL
Sbjct  1    DPRRALASWSEDSASPCNWTGIQCSPQSGRVTQVTLDGLELSGPLGRGLLKLDHLQVLSL  60

Query  456  ASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSLQFLDLSGNSLSGPV  626
            A NN SG ISPQ+ +L +L+ L+LS N++SG +P  SL ++  L  LD+S NS SG V
Sbjct  61   ARNNLSGSISPQIRVLKSLRNLSLSHNALSGPLPGASLASLELLSLLDVSHNSFSGSV  118



>dbj|BAB85306.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAB86487.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
Length=947

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 86/157 (55%), Gaps = 26/157 (17%)
 Frame = +3

Query  234  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  413
            DDVL L+VFK+GV DP   LA W+EDDD PC+W  V C    GRV+ + L G  LSG++ 
Sbjct  29   DDVLALVVFKTGVADPMGRLAAWTEDDDRPCSWPGVGCDARAGRVTSLSLPGASLSGRLP  88

Query  414  RGLEKLEHLNVLSLASNNFSGVISPqlgll--------------------------tnlq  515
            R L +L+ L  LSL  NN SG + P L                              +++
Sbjct  89   RALLRLDALASLSLPRNNLSGPVLPGLLAALPRLRSLDLSSNRLAAPVPAELFAQCRSIR  148

Query  516  tlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
             L+L++N +SG +P ++ + +SL  L+LS N L+GP+
Sbjct  149  ALSLARNELSGYIPPAVTSCASLVSLNLSSNRLAGPI  185



>gb|EAY76307.1| hypothetical protein OsI_04242 [Oryza sativa Indica Group]
Length=947

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 86/157 (55%), Gaps = 26/157 (17%)
 Frame = +3

Query  234  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  413
            DDVL L+VFK+GV DP   LA W+EDDD PC+W  V C    GRV+ + L G  LSG++ 
Sbjct  29   DDVLALVVFKTGVADPMGRLAAWTEDDDRPCSWPGVGCDARAGRVTSLSLPGASLSGRLP  88

Query  414  RGLEKLEHLNVLSLASNNFSGVISPqlgll--------------------------tnlq  515
            R L +L+ L  LSL  NN SG + P L                              +++
Sbjct  89   RALLRLDALASLSLPRNNLSGPVLPGLLAALPRLRSLDLSSNRLAAPVPAELFAQCRSIR  148

Query  516  tlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
             L+L++N +SG +P ++ + +SL  L+LS N L+GP+
Sbjct  149  ALSLARNELSGYIPPAVTSCASLVSLNLSSNRLAGPI  185



>ref|XP_002439964.1| hypothetical protein SORBIDRAFT_09g023480 [Sorghum bicolor]
 gb|EES18394.1| hypothetical protein SORBIDRAFT_09g023480 [Sorghum bicolor]
Length=944

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 83/134 (62%), Gaps = 3/134 (2%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            ++DDVL L+V KSG+ DP+  LA WSED D  CAW  V C P  GRV+ +DL    L+G+
Sbjct  47   VSDDVLALVVLKSGLSDPSGRLAPWSEDADRACAWPGVSCDPRTGRVAALDLPAASLAGR  106

Query  408  IGR-GLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  584
            + R  L +L+ L  L+L  N  SG +     L   L+ L+LS N+ISG +P SL +  SL
Sbjct  107  LPRSALLRLDALVSLALPGNRLSGALP--DALPPRLRALDLSGNAISGGIPASLASCDSL  164

Query  585  QFLDLSGNSLSGPV  626
              L+LS N L+GPV
Sbjct  165  VSLNLSRNRLTGPV  178



>ref|XP_004961741.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=942

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 82/134 (61%), Gaps = 3/134 (2%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            ++DDVL L+V KSG+ DPA  LA WSED D  C+W  V C P  GRV+ ++L    L+G+
Sbjct  46   VSDDVLALVVLKSGLSDPAGRLAPWSEDADRACSWPGVSCDPRTGRVAALELPAASLAGR  105

Query  408  IGR-GLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  584
            + R  L +L+ L  L+L  N  SG +     L   L+ L+LS N+IS  +P SL +  SL
Sbjct  106  LPRSALLRLDALVSLALPGNRLSGALP--DALPPRLRALDLSGNAISSGIPASLASCESL  163

Query  585  QFLDLSGNSLSGPV  626
              L+LS N L+GPV
Sbjct  164  VSLNLSRNQLTGPV  177



>ref|XP_002458686.1| hypothetical protein SORBIDRAFT_03g038240 [Sorghum bicolor]
 gb|EES03806.1| hypothetical protein SORBIDRAFT_03g038240 [Sorghum bicolor]
Length=948

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 88/183 (48%), Gaps = 50/183 (27%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            L DDVL L+VFK+ V DP+  LATW+EDDD PC+W  V C    GRV+ + L    LSG+
Sbjct  26   LTDDVLALVVFKTDVSDPSGRLATWTEDDDRPCSWPAVGCDARTGRVTSLSLPAASLSGR  85

Query  408  IGR----------------------------GLEKLEHLNV-------------------  446
            + R                             L +L  L++                   
Sbjct  86   LPRALLRLDALLSLALPRNNLSGPVLPNLLTALPRLRSLDLSSNRLAAPVPAQLFAQCRA  145

Query  447  ---LSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  617
               +SLA N  SG I P +    +L +LNLS N ++G +PD L ++ SL+ LDLSGN LS
Sbjct  146  VRAISLAHNQLSGYIPPAVASCASLVSLNLSSNRLAGPIPDGLWSLPSLRSLDLSGNELS  205

Query  618  GPV  626
            G V
Sbjct  206  GSV  208



>emb|CDX85183.1| BnaC07g24940D, partial [Brassica napus]
Length=933

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 76/101 (75%), Gaps = 4/101 (4%)
 Frame = +3

Query  318  SPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlg  497
            SPC+W +VKC+P   RV+E+ L GL L+GKIGRG++KL+HL VLSL++NN +G I+  L 
Sbjct  2    SPCSWTYVKCNPKTSRVTELSLSGLSLTGKIGRGIQKLQHLKVLSLSNNNLTGNIA-ALS  60

Query  498  lltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSG  620
               +LQ L+LS NS+SG +  SL   +SL++LDL+GNS SG
Sbjct  61   NNNHLQKLDLSHNSLSGQISSSL---TSLRYLDLTGNSFSG  98



>ref|XP_001759642.1| predicted protein [Physcomitrella patens]
 gb|EDQ75554.1| predicted protein [Physcomitrella patens]
Length=901

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 84/139 (60%), Gaps = 2/139 (1%)
 Frame = +3

Query  210  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  389
            GAE++   D+   L+ FK+ + D  S L TW  +D  PC W+ + C   N  V+ ++L  
Sbjct  30   GAEAIA-TDEGWALLDFKNAISDSRSTLRTWKSEDSYPCEWSGISCD-KNSHVTSINLRN  87

Query  390  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  569
             GLSG I   L +L  L +L L+ NNFSG I PQL  + +L  L L  N+++G++P  L 
Sbjct  88   AGLSGTIALELHRLRKLRILILSENNFSGPIPPQLSEIGSLWKLKLDHNNLTGSIPGELS  147

Query  570  NMSSLQFLDLSGNSLSGPV  626
            ++S+L+  DLS N+LSGP+
Sbjct  148  HLSNLRIFDLSYNALSGPI  166



>ref|XP_004970391.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=946

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 87/181 (48%), Gaps = 50/181 (28%)
 Frame = +3

Query  234  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  413
            DDVL L+VFK+GV DP+  LATW+EDDD PC+W  V C    GRV+ + L    LSG++ 
Sbjct  26   DDVLALVVFKTGVSDPSGRLATWTEDDDRPCSWPGVGCDARTGRVTSLSLPAASLSGRLP  85

Query  414  ----------------------------------RGLE----------------KLEHLN  443
                                              R L+                +  ++ 
Sbjct  86   PALLRLDALLSLALPRNNLSGPVLPNLLAALPRLRSLDLSSNRLAAPVPAQLFAQCRYIR  145

Query  444  VLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGP  623
             +SLA N  SG I P +    +L +LNLS N ++G +PD L ++ SL+ LDLSGN LSG 
Sbjct  146  AISLAHNQLSGYIPPAVTSCASLVSLNLSSNRLAGPIPDGLWSLPSLRSLDLSGNELSGS  205

Query  624  V  626
            V
Sbjct  206  V  206


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +3

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  581
            G++  G+  +  L VL +++N   G + P++G    L+ L + +NS++G +P  +GN SS
Sbjct  395  GQLPAGIGGMRLLEVLDVSANRLDGTVPPEIGGAVALRDLRMGRNSLTGGIPAQIGNCSS  454

Query  582  LQFLDLSGNSLSGPV  626
            L  LDLS NSL+GP+
Sbjct  455  LVALDLSHNSLTGPI  469



>ref|XP_008659447.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Zea mays]
 gb|AFW86332.1| hypothetical protein ZEAMMB73_446534 [Zea mays]
Length=199

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 82/141 (58%), Gaps = 1/141 (1%)
 Frame = +3

Query  204  AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  383
            +G A  +  N +V  L+V KS ++DP   L  W  +   PC W+F+ C P N  V+ ++ 
Sbjct  20   SGLAAPMDFNHEVQVLMVIKSLLKDPYGALRNWDRNSVDPCTWSFISCSPEN-LVTALEA  78

Query  384  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  563
                LSG++   +  L  L  L L +NN  G I  ++G L  L+TL LS N + GTVP+S
Sbjct  79   PSKNLSGRLSPSIGNLTKLEKLQLQNNNIIGPIPAEIGKLAKLRTLVLSSNKLHGTVPNS  138

Query  564  LGNMSSLQFLDLSGNSLSGPV  626
            LG +  LQ++DLS N+LSGP+
Sbjct  139  LGRLGRLQYIDLSYNNLSGPI  159



>ref|XP_008649763.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Zea mays]
 gb|AFW78385.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=938

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 80/132 (61%), Gaps = 3/132 (2%)
 Frame = +3

Query  234  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  413
            DDVL L+V KSG+ DPA  LA WSED D  CAW  V C     RV+ +DL    L+G++ 
Sbjct  44   DDVLALVVLKSGLFDPAGRLAPWSEDADRACAWPGVSCDSRTDRVAALDLPAASLAGRLP  103

Query  414  R-GLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  590
            R  L +L+ L  L+L  N  SG +     L   L++L+LS N+ISG +P SL +  SL  
Sbjct  104  RAALLRLDALVSLALPGNRLSGTLP--DALPPRLRSLDLSGNAISGGIPASLASCESLVS  161

Query  591  LDLSGNSLSGPV  626
            L+LS N L+GPV
Sbjct  162  LNLSRNRLTGPV  173



>ref|NP_001055909.1| Os05g0491400 [Oryza sativa Japonica Group]
 gb|AAT69645.1| unknown protein, contains LRR domain [Oryza sativa Japonica Group]
 dbj|BAF17823.1| Os05g0491400 [Oryza sativa Japonica Group]
 gb|EEE64195.1| hypothetical protein OsJ_19027 [Oryza sativa Japonica Group]
Length=216

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 77/127 (61%), Gaps = 1/127 (1%)
 Frame = +3

Query  246  GLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  425
             L  F+ G+ DP   LA+W  D  +PC W  V C+ A+ RV  +DL  + LSG +   L 
Sbjct  35   ALTEFRKGMSDPDGALASWDPDLVNPCTWFRVTCN-ADNRVIRLDLEEMNLSGHLSADLA  93

Query  426  KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  605
            +L+ L  + +ASNN  G I P+ G L NL +L+L  N+ISG +P SLG + SL+F+ +  
Sbjct  94   RLDQLQFMEIASNNIEGPIPPEFGNLENLISLDLCNNTISGPIPPSLGKLKSLKFMRIDH  153

Query  606  NSLSGPV  626
            N L+GP+
Sbjct  154  NLLTGPI  160



>ref|XP_004970305.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Setaria 
italica]
Length=215

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 76/127 (60%), Gaps = 1/127 (1%)
 Frame = +3

Query  246  GLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  425
             L   +  ++DP   L +W     +PC W  V C   N RV+ +DL  L LSG +   L 
Sbjct  31   ALSALRRSLRDPGGVLQSWDPTLVNPCTWFHVTCDSGN-RVTRLDLGNLNLSGHLVPELG  89

Query  426  KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  605
            KLEHL  L L  NN  G I  +LG L NL +L+L KN+ISGT+P +LGN+ SL FL L+G
Sbjct  90   KLEHLQYLELYKNNIQGTIPSELGNLKNLISLDLYKNNISGTIPPALGNLKSLVFLRLNG  149

Query  606  NSLSGPV  626
            N L+GP+
Sbjct  150  NRLTGPI  156



>ref|NP_001055847.2| Os05g0478300 [Oryza sativa Japonica Group]
 gb|AAT01367.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17761.2| Os05g0478300 [Oryza sativa Japonica Group]
Length=917

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 80/156 (51%), Gaps = 23/156 (15%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            +NDDVL L+VFKSGV DP   LA WSED D  CAW  V C    GRV  V L   GLSG+
Sbjct  23   VNDDVLALVVFKSGVSDPGGVLAAWSEDADRACAWPGVSCDARAGRVDAVALPSAGLSGR  82

Query  408  IGRGLEKL-----------------------EHLNVLSLASNNFSGVISPqlglltnlqt  518
            + R                                 L L++N+ SG +   L    +L +
Sbjct  83   LPRSALLRLDALLSLALPGNNLSGPLPDALPPRARALDLSANSLSGYLPAALASCGSLVS  142

Query  519  lnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
            LNLS N +SG VPD + ++ SL+ LDLSGN L+G V
Sbjct  143  LNLSGNLLSGPVPDGIWSLPSLRSLDLSGNQLAGSV  178



>emb|CDY14823.1| BnaC04g48200D [Brassica napus]
Length=640

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 81/132 (61%), Gaps = 3/132 (2%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQ-DPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  404
            LN D L L+  KS V+ DP   +  WSE D +PC W+ V C   NGRV+ ++L G  LSG
Sbjct  24   LNSDGLSLLALKSAVENDPTKVMNHWSESDQTPCHWSGVAC--TNGRVTSLNLFGKSLSG  81

Query  405  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  584
             I   L  L+ LN L LA NNFS  +  +L   TNL+ ++LS NS+SG +PD + ++ SL
Sbjct  82   YIPSELGLLDSLNRLDLAHNNFSKPVPVRLFEPTNLRYIDLSHNSLSGPIPDQIRHLKSL  141

Query  585  QFLDLSGNSLSG  620
              LDLS N L+G
Sbjct  142  NHLDLSSNRLNG  153



>gb|EAY98521.1| hypothetical protein OsI_20433 [Oryza sativa Indica Group]
Length=216

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 77/127 (61%), Gaps = 1/127 (1%)
 Frame = +3

Query  246  GLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  425
             L  F+ G+ DP   LA+W  D  +PC W  V C+ A+ RV  +DL  + LSG +   L 
Sbjct  35   ALTEFRKGMSDPDGALASWDPDLVNPCTWFRVTCN-ADNRVIRLDLEEMNLSGHLSADLA  93

Query  426  KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  605
            +L+ L  + +ASNN  G I P+ G L NL +L+L  N+ISG +P S+G + SL+F+ +  
Sbjct  94   RLDQLQFMEIASNNIEGPIPPEFGNLENLISLDLCNNTISGPIPPSVGKLKSLKFMRIDH  153

Query  606  NSLSGPV  626
            N L+GP+
Sbjct  154  NLLTGPI  160



>ref|XP_004491185.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Cicer 
arietinum]
Length=218

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 74/127 (58%), Gaps = 1/127 (1%)
 Frame = +3

Query  246  GLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  425
             L   K  + DP + L +W     SPC W  V C+  N RV+ VDL    LSG +   L 
Sbjct  33   ALYTLKRSLTDPDNVLQSWDPTLVSPCTWFHVTCNQDN-RVTRVDLGNSNLSGHLVPELG  91

Query  426  KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  605
            KLEHL  L L  NN  G I P+LG L +L +L+L  N+ISGTVP SLG + +L FL L+ 
Sbjct  92   KLEHLQYLELYKNNIQGTIPPELGNLRSLVSLDLYNNNISGTVPPSLGKLKNLVFLRLND  151

Query  606  NSLSGPV  626
            N L+GP+
Sbjct  152  NRLTGPI  158



>tpg|DAA57062.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=949

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 86/183 (47%), Gaps = 50/183 (27%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  407
            L DDVL L+VFK  + DP+  LATW+EDDD PC+W  V C    GRV+ + L    LSG+
Sbjct  27   LTDDVLALVVFKMDISDPSGRLATWTEDDDRPCSWPAVGCDARTGRVTSLSLPAASLSGR  86

Query  408  IGR----------------------------GLEKLEHLNV-------------------  446
            +                               L +L  L++                   
Sbjct  87   LPHALLRLDALLSLALPRNNLSGPVPPNLLTALPRLRALDLSSNRLAAPVPAQLFAQCRA  146

Query  447  ---LSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  617
               +SLA N  SG I P +    +L +LNLS N ++G +PD L ++ SL+ LDLSGN LS
Sbjct  147  VRAISLAHNQLSGYIPPAVASCASLVSLNLSSNRLAGPIPDGLWSLPSLRSLDLSGNELS  206

Query  618  GPV  626
            G V
Sbjct  207  GSV  209



>ref|XP_009142052.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Brassica rapa]
Length=642

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 80/132 (61%), Gaps = 3/132 (2%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGV-QDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  404
            LN D L L+  KS V  DP   +  WSE D +PC W+ V C   NGRV+ ++L G  LSG
Sbjct  24   LNSDGLSLLALKSAVDNDPTKVMNHWSESDQTPCHWSGVAC--TNGRVTSLNLFGKSLSG  81

Query  405  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  584
             I   L  L+ LN L LA NNFS  +  +L   TNL+ ++LS NS+SG +PD + ++ SL
Sbjct  82   YIPSELGLLDSLNRLDLAHNNFSKPVPVRLFEPTNLRYIDLSHNSLSGPIPDQIRHLKSL  141

Query  585  QFLDLSGNSLSG  620
              LDLS N L+G
Sbjct  142  NHLDLSSNRLNG  153



>emb|CDY47962.1| BnaA04g24400D [Brassica napus]
Length=645

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 80/132 (61%), Gaps = 3/132 (2%)
 Frame = +3

Query  228  LNDDVLGLIVFKSGV-QDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  404
            LN D L L+  KS V  DP   +  WSE D +PC W+ V C   NGRV+ ++L G  LSG
Sbjct  24   LNSDGLSLLALKSAVDNDPTKVMNHWSESDQTPCHWSGVAC--TNGRVTSLNLFGKSLSG  81

Query  405  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  584
             I   L  L+ LN L LA NNFS  +  +L   TNL+ ++LS NS+SG +PD + ++ SL
Sbjct  82   YIPSELGLLDSLNRLDLAHNNFSKPVPVRLFEPTNLRYIDLSHNSLSGPIPDQIRHLKSL  141

Query  585  QFLDLSGNSLSG  620
              LDLS N L+G
Sbjct  142  NHLDLSSNRLNG  153



>emb|CAH66725.1| H0404F02.1 [Oryza sativa Indica Group]
Length=1157

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 84/136 (62%), Gaps = 2/136 (1%)
 Frame = +3

Query  225  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDS-PCAWNFVKCHPANGRVSEVDLHGLGLS  401
            ++  ++  L++F+SG++DP + ++ W+    S PC+W  V C    GRV E+ L  L LS
Sbjct  32   EVKAEIDALLMFRSGLRDPYAAMSGWNASSPSAPCSWRGVACAAGTGRVVELALPKLRLS  91

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMS  578
            G I   L  L +L  LSL SN+ SG I   L  +++L+ + L  NS+SG +P S L N++
Sbjct  92   GAISPALSSLVYLEKLSLRSNSLSGTIPASLSRISSLRAVYLQYNSLSGPIPQSFLANLT  151

Query  579  SLQFLDLSGNSLSGPV  626
            +LQ  D+SGN LSGPV
Sbjct  152  NLQTFDVSGNLLSGPV  167


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +3

Query  363  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  542
            R+ EV L G   SG+I   L  L  L  LS   N  +G +  +L +L NL  L+LS N +
Sbjct  417  RLREVYLGGNSFSGQIPASLGNLSWLEALSTPGNRLTGDLPSELFVLGNLTFLDLSDNKL  476

Query  543  SGTVPDSLGNMSSLQFLDLSGNSLSG  620
            +G +P S+GN+++LQ L+LSGNS SG
Sbjct  477  AGEIPPSIGNLAALQSLNLSGNSFSG  502



>gb|AEW49518.1| putative LRR-RLK protein XIAO [Oryza sativa Japonica Group]
Length=1157

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 84/136 (62%), Gaps = 2/136 (1%)
 Frame = +3

Query  225  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDS-PCAWNFVKCHPANGRVSEVDLHGLGLS  401
            ++  ++  L++F+SG++DP + ++ W+    S PC+W  V C    GRV E+ L  L LS
Sbjct  32   EVKAEIDALLMFRSGLRDPYAAMSGWNASSPSAPCSWRGVACAAGTGRVVELALPKLRLS  91

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMS  578
            G I   L  L +L  LSL SN+ SG I   L  +++L+ + L  NS+SG +P S L N++
Sbjct  92   GAISPALSSLVYLEKLSLRSNSLSGTIPASLSRISSLRAVYLQYNSLSGPIPQSFLANLT  151

Query  579  SLQFLDLSGNSLSGPV  626
            +LQ  D+SGN LSGPV
Sbjct  152  NLQTFDVSGNLLSGPV  167


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +3

Query  363  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  542
            R+ EV L G   SG+I   L  L  L  LS   N  +G +  +L +L NL  L+LS N +
Sbjct  417  RLREVYLGGNSFSGQIPASLGNLSWLEALSTPGNRLTGDLPSELFVLGNLTFLDLSDNKL  476

Query  543  SGTVPDSLGNMSSLQFLDLSGNSLSG  620
            +G +P S+GN+++LQ L+LSGNS SG
Sbjct  477  AGEIPPSIGNLAALQSLNLSGNSFSG  502



>dbj|BAK02926.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1171

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 82/139 (59%), Gaps = 2/139 (1%)
 Frame = +3

Query  216  ESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDS-PCAWNFVKCHPANGRVSEVDLHGL  392
             + ++  ++  L+ F++ ++DP + +A W     S PC+W  V C+ A+GRV E+ L  L
Sbjct  45   RAAEVQAEIDALLAFRAALRDPYAAMAGWDASSPSAPCSWRGVACNAASGRVVELQLPRL  104

Query  393  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LG  569
             L+G +   L  L HL  LSL SN  +G I P L  L +L+ + L  N++SG +P S L 
Sbjct  105  RLAGPVSPALASLRHLQKLSLRSNALTGAIPPALARLASLRAVFLQDNALSGPIPPSFLA  164

Query  570  NMSSLQFLDLSGNSLSGPV  626
            N++ L+  D+S N LSGPV
Sbjct  165  NLTGLETFDVSANLLSGPV  183


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +3

Query  375  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  554
            +DL G  L+G I   L +L+ L  L L+ N  S  I P++  +++L TL L  N + G +
Sbjct  630  LDLSGNHLTGPIPSDLSRLDELEELDLSHNQLSSKIPPEISNISSLATLKLDDNHLVGEI  689

Query  555  PDSLGNMSSLQFLDLSGNSLSGPV  626
            P SL N+S LQ LDLS NS++G +
Sbjct  690  PASLANLSKLQALDLSSNSITGSI  713


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = +3

Query  363  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  542
            ++  V L     SG +  G   L  L  L+++ N+F+G I    G + +LQ L+ S N I
Sbjct  554  QLQHVSLADNSFSGDVPEGFSSLWSLRHLNISVNSFAGSIPATYGYMASLQVLSASHNRI  613

Query  543  SGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
            SG VP  L N S+L  LDLSGN L+GP+
Sbjct  614  SGEVPAELANCSNLTVLDLSGNHLTGPI  641



>gb|EEE61543.1| hypothetical protein OsJ_15867 [Oryza sativa Japonica Group]
Length=1116

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 84/136 (62%), Gaps = 2/136 (1%)
 Frame = +3

Query  225  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDS-PCAWNFVKCHPANGRVSEVDLHGLGLS  401
            ++  ++  L++F+SG++DP + ++ W+    S PC+W  V C    GRV E+ L  L LS
Sbjct  32   EVKAEIDALLMFRSGLRDPYAAMSGWNASSPSAPCSWRGVACAAGTGRVVELALPKLRLS  91

Query  402  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMS  578
            G I   L  L +L  LSL SN+ SG I   L  +++L+ + L  NS+SG +P S L N++
Sbjct  92   GAISPALSSLVYLEKLSLRSNSLSGTIPASLSRISSLRAVYLQYNSLSGPIPQSFLANLT  151

Query  579  SLQFLDLSGNSLSGPV  626
            +LQ  D+SGN LSGPV
Sbjct  152  NLQTFDVSGNLLSGPV  167


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +3

Query  363  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  542
            R+ EV L G   SG+I   L  L  L  LS   N  +G +  +L +L NL  L+LS N +
Sbjct  417  RLREVYLGGNSFSGQIPASLGNLSWLEALSTPGNRLTGDLPSELFVLGNLTFLDLSDNKL  476

Query  543  SGTVPDSLGNMSSLQFLDLSGNSLSG  620
            +G +P S+GN+++LQ L+LSGNS SG
Sbjct  477  AGEIPPSIGNLAALQSLNLSGNSFSG  502



>dbj|BAJ86449.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1135

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 82/139 (59%), Gaps = 2/139 (1%)
 Frame = +3

Query  216  ESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDS-PCAWNFVKCHPANGRVSEVDLHGL  392
             + ++  ++  L+ F++ ++DP + +A W     S PC+W  V C+ A+GRV E+ L  L
Sbjct  9    RAAEVQAEIDALLAFRAALRDPYAAMAGWDASSPSAPCSWRGVACNAASGRVVELQLPRL  68

Query  393  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LG  569
             L+G +   L  L HL  LSL SN  +G I P L  L +L+ + L  N++SG +P S L 
Sbjct  69   RLAGPVSPALASLRHLQKLSLRSNALTGAIPPALARLASLRAVFLQDNALSGPIPPSFLA  128

Query  570  NMSSLQFLDLSGNSLSGPV  626
            N++ L+  D+S N LSGPV
Sbjct  129  NLTGLETFDVSANLLSGPV  147


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +3

Query  375  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  554
            +DL G  L+G I   L +L+ L  L L+ N  S  I P++  +++L TL L  N + G +
Sbjct  594  LDLSGNHLTGPIPSDLSRLDELEELDLSHNQLSSKIPPEISNISSLATLKLDDNHLVGEI  653

Query  555  PDSLGNMSSLQFLDLSGNSLSGPV  626
            P SL N+S LQ LDLS NS++G +
Sbjct  654  PASLANLSKLQALDLSSNSITGSI  677


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = +3

Query  363  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  542
            ++  V L     SG +  G   L  L  L+++ N+F+G I    G + +LQ L+ S N I
Sbjct  518  QLQHVSLADNSFSGDVPEGFSSLWSLRHLNISVNSFAGSIPATYGYMASLQVLSASHNRI  577

Query  543  SGTVPDSLGNMSSLQFLDLSGNSLSGPV  626
            SG VP  L N S+L  LDLSGN L+GP+
Sbjct  578  SGEVPAELANCSNLTVLDLSGNHLTGPI  605



>gb|ACU19288.1| unknown [Glycine max]
Length=218

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 74/127 (58%), Gaps = 1/127 (1%)
 Frame = +3

Query  246  GLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  425
             L   K  + DP + L +W     SPC W  V C+  N RV+ VDL    LSG +   L 
Sbjct  33   ALYTLKRSLSDPDNVLQSWDPTLVSPCTWFHVTCNQDN-RVTRVDLGNSNLSGHLVPELG  91

Query  426  KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  605
            KLEHL  L L  NN  G I P+LG L +L +L+L  N+ISGT+P SLG + +L FL L+ 
Sbjct  92   KLEHLQYLELYKNNIQGTIPPELGNLKSLVSLDLYNNNISGTIPPSLGKLKNLVFLRLND  151

Query  606  NSLSGPV  626
            N L+GP+
Sbjct  152  NRLTGPI  158



>gb|ACU22741.1| unknown [Glycine max]
Length=218

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 74/127 (58%), Gaps = 1/127 (1%)
 Frame = +3

Query  246  GLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  425
             L   K  + DP + L +W     SPC W  V C+  N RV+ VDL    LSG +   L 
Sbjct  33   ALYTLKRSLSDPDNVLQSWDPTLVSPCTWFHVTCNQDN-RVTRVDLGNSNLSGHLVPELG  91

Query  426  KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  605
            KLEHL  L L  NN  G I P+LG L +L +L+L  N+ISGT+P SLG + +L FL L+ 
Sbjct  92   KLEHLQYLELYKNNIQGTIPPELGNLKSLVSLDLYNNNISGTIPPSLGKLKNLVFLRLND  151

Query  606  NSLSGPV  626
            N L+GP+
Sbjct  152  NRLTGPI  158



>ref|XP_003519488.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Glycine 
max]
Length=218

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 74/127 (58%), Gaps = 1/127 (1%)
 Frame = +3

Query  246  GLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  425
             L   K  + DP + L +W     SPC W  V C+  N RV+ VDL    LSG +   L 
Sbjct  33   ALYTLKRSLSDPDNVLQSWDPTLVSPCTWFHVTCNQDN-RVTRVDLGNSNLSGHLVPELG  91

Query  426  KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  605
            KLEHL  L L  NN  G I P+LG L +L +L+L  N+ISGT+P SLG + +L FL L+ 
Sbjct  92   KLEHLQYLELYKNNIQGTIPPELGNLKSLVSLDLYNNNISGTIPPSLGKLKNLVFLRLND  151

Query  606  NSLSGPV  626
            N L+GP+
Sbjct  152  NRLTGPI  158



>ref|NP_001241394.1| somatic embryogenesis receptor kinase 1-like precursor [Glycine 
max]
 gb|ACM89589.1| leucine-rich repeat protein [Glycine max]
 gb|KHN26025.1| Somatic embryogenesis receptor kinase 1 [Glycine soja]
Length=218

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 74/127 (58%), Gaps = 1/127 (1%)
 Frame = +3

Query  246  GLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  425
             L   K  + DP + L +W     SPC W  V C+  N RV+ VDL    LSG +   L 
Sbjct  33   ALYTLKRSLSDPDNVLQSWDPTLVSPCTWFHVTCNQDN-RVTRVDLGNSNLSGHLVPELG  91

Query  426  KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  605
            KLEHL  L L  NN  G I P+LG L +L +L+L  N+ISGT+P SLG + +L FL L+ 
Sbjct  92   KLEHLQYLELYKNNIQGTIPPELGNLKSLVSLDLYNNNISGTIPPSLGKLKNLVFLRLND  151

Query  606  NSLSGPV  626
            N L+GP+
Sbjct  152  NRLTGPI  158



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250