BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS039E04

Length=618
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002276757.1|  PREDICTED: glycerophosphodiester phosphodies...    173   1e-46   Vitis vinifera
ref|XP_009787408.1|  PREDICTED: probable glycerophosphoryl dieste...    173   2e-46   Nicotiana sylvestris
ref|XP_009625976.1|  PREDICTED: probable glycerophosphoryl dieste...    170   1e-45   Nicotiana tomentosiformis
ref|XP_010324292.1|  PREDICTED: glycerophosphodiester phosphodies...    169   4e-45   Solanum lycopersicum
gb|KJB62955.1|  hypothetical protein B456_009G445400                    164   3e-43   Gossypium raimondii
emb|CAN61355.1|  hypothetical protein VITISV_027762                     163   3e-43   Vitis vinifera
ref|XP_006344880.1|  PREDICTED: probable glycerophosphoryl dieste...    163   6e-43   Solanum tuberosum [potatoes]
gb|KHG08046.1|  putative glycerophosphoryl diester phosphodiester...    159   2e-41   Gossypium arboreum [tree cotton]
gb|EYU33686.1|  hypothetical protein MIMGU_mgv1a001772mg                159   2e-41   Erythranthe guttata [common monkey flower]
gb|KDO62176.1|  hypothetical protein CISIN_1g003550mg                   157   3e-41   Citrus sinensis [apfelsine]
ref|XP_006346174.1|  PREDICTED: probable glycerophosphoryl dieste...    158   4e-41   Solanum tuberosum [potatoes]
gb|KDO62177.1|  hypothetical protein CISIN_1g003550mg                   156   5e-41   Citrus sinensis [apfelsine]
gb|KDO62175.1|  hypothetical protein CISIN_1g003550mg                   157   7e-41   Citrus sinensis [apfelsine]
ref|XP_011097815.1|  PREDICTED: glycerophosphodiester phosphodies...    157   8e-41   Sesamum indicum [beniseed]
ref|XP_006452490.1|  hypothetical protein CICLE_v10007536mg             157   8e-41   Citrus clementina [clementine]
ref|XP_006474966.1|  PREDICTED: probable glycerophosphoryl dieste...    157   9e-41   Citrus sinensis [apfelsine]
gb|KDO62174.1|  hypothetical protein CISIN_1g003550mg                   157   1e-40   Citrus sinensis [apfelsine]
ref|XP_009798152.1|  PREDICTED: probable glycerophosphoryl dieste...    153   1e-40   Nicotiana sylvestris
gb|KHG12016.1|  putative glycerophosphoryl diester phosphodiester...    154   1e-39   Gossypium arboreum [tree cotton]
ref|XP_010270134.1|  PREDICTED: glycerophosphodiester phosphodies...    153   3e-39   Nelumbo nucifera [Indian lotus]
ref|XP_004251903.1|  PREDICTED: glycerophosphodiester phosphodies...    153   3e-39   Solanum lycopersicum
ref|XP_007020654.1|  PLC-like phosphodiesterase family protein, p...    149   1e-38   
ref|XP_007020652.1|  PLC-like phosphodiesterase family protein, p...    151   1e-38   
ref|XP_007020653.1|  PLC-like phosphodiesterase family protein, p...    151   1e-38   
gb|KJB13801.1|  hypothetical protein B456_002G094900                    150   2e-38   Gossypium raimondii
gb|KJB13800.1|  hypothetical protein B456_002G094900                    150   2e-38   Gossypium raimondii
ref|XP_009105134.1|  PREDICTED: probable glycerophosphoryl dieste...    150   2e-38   Brassica rapa
ref|XP_010536709.1|  PREDICTED: glycerophosphodiester phosphodies...    150   2e-38   Tarenaya hassleriana [spider flower]
ref|XP_009108190.1|  PREDICTED: probable glycerophosphoryl dieste...    150   3e-38   Brassica rapa
gb|KJB13799.1|  hypothetical protein B456_002G094900                    150   4e-38   Gossypium raimondii
ref|XP_006401453.1|  hypothetical protein EUTSA_v10012748mg             150   4e-38   Eutrema salsugineum [saltwater cress]
ref|XP_010545263.1|  PREDICTED: glycerophosphodiester phosphodies...    149   5e-38   Tarenaya hassleriana [spider flower]
ref|XP_011095489.1|  PREDICTED: glycerophosphodiester phosphodies...    149   7e-38   Sesamum indicum [beniseed]
ref|XP_002888565.1|  glycerophosphoryl diester phosphodiesterase ...    148   9e-38   
gb|AAF98210.1|AC007152_6  Unknown protein                               149   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176870.2|  suppressor of npr1-1 constitutive 4                   149   2e-37   Arabidopsis thaliana [mouse-ear cress]
gb|KHM99500.1|  Putative glycerophosphoryl diester phosphodiester...    148   2e-37   Glycine soja [wild soybean]
ref|XP_003530777.1|  PREDICTED: probable glycerophosphoryl dieste...    148   2e-37   Glycine max [soybeans]
ref|XP_008447692.1|  PREDICTED: probable glycerophosphoryl dieste...    147   4e-37   Cucumis melo [Oriental melon]
ref|XP_010470590.1|  PREDICTED: glycerophosphodiester phosphodies...    137   4e-37   
emb|CDY60410.1|  BnaC02g45300D                                          137   5e-37   Brassica napus [oilseed rape]
ref|XP_002529027.1|  glycerophosphoryl diester phosphodiesterase,...    146   1e-36   Ricinus communis
emb|CDY14478.1|  BnaC03g21170D                                          147   1e-36   Brassica napus [oilseed rape]
gb|KDP39221.1|  hypothetical protein JCGZ_00978                         145   1e-36   Jatropha curcas
gb|AAP40466.1|  unknown protein                                         145   1e-36   Arabidopsis thaliana [mouse-ear cress]
emb|CDY61647.1|  BnaCnng38120D                                          145   1e-36   Brassica napus [oilseed rape]
ref|NP_176869.2|  putative glycerophosphoryl diester phosphodiest...    145   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867546.1|  MRH5/SHV3                                          145   2e-36   
ref|XP_010511612.1|  PREDICTED: glycerophosphodiester phosphodies...    145   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010422831.1|  PREDICTED: glycerophosphodiester phosphodies...    135   3e-36   
ref|XP_006300773.1|  hypothetical protein CARUB_v10019847mg             144   4e-36   
ref|XP_011013351.1|  PREDICTED: glycerophosphodiester phosphodies...    144   4e-36   Populus euphratica
ref|XP_010433460.1|  PREDICTED: glycerophosphodiester phosphodies...    143   5e-36   
ref|XP_002300353.2|  glycerophosphoryl diester phosphodiesterase ...    142   5e-36   
emb|CDP13760.1|  unnamed protein product                                144   6e-36   Coffea canephora [robusta coffee]
ref|XP_009127509.1|  PREDICTED: probable glycerophosphoryl dieste...    134   6e-36   Brassica rapa
emb|CDY12601.1|  BnaA02g12690D                                          134   7e-36   Brassica napus [oilseed rape]
ref|XP_011014752.1|  PREDICTED: glycerophosphodiester phosphodies...    143   9e-36   Populus euphratica
emb|CDX94294.1|  BnaC01g18900D                                          143   9e-36   
ref|XP_011014930.1|  PREDICTED: glycerophosphodiester phosphodies...    143   1e-35   Populus euphratica
ref|NP_567755.1|  glycerophosphoryl diester phosphodiesterase-like 3    142   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008227060.1|  PREDICTED: probable glycerophosphoryl dieste...    142   2e-35   Prunus mume [ume]
gb|AAL07129.1|  unknown protein                                         142   2e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36515.1|  putative protein                                       142   2e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KFK29182.1|  hypothetical protein AALP_AA7G100300                    142   2e-35   Arabis alpina [alpine rockcress]
ref|XP_010099974.1|  putative glycerophosphoryl diester phosphodi...    142   3e-35   
ref|XP_010449676.1|  PREDICTED: glycerophosphodiester phosphodies...    142   4e-35   Camelina sativa [gold-of-pleasure]
emb|CDY71959.1|  BnaCnng75290D                                          137   5e-35   Brassica napus [oilseed rape]
ref|XP_009127510.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    141   5e-35   Brassica rapa
emb|CDY13237.1|  BnaC09g24190D                                          141   6e-35   Brassica napus [oilseed rape]
gb|KFK27133.1|  hypothetical protein AALP_AA8G339300                    141   6e-35   Arabis alpina [alpine rockcress]
ref|XP_006413151.1|  hypothetical protein EUTSA_v10024494mg             141   6e-35   Eutrema salsugineum [saltwater cress]
ref|XP_010438711.1|  PREDICTED: glycerophosphodiester phosphodies...    141   6e-35   Camelina sativa [gold-of-pleasure]
ref|XP_009132384.1|  PREDICTED: probable glycerophosphoryl dieste...    141   7e-35   Brassica rapa
emb|CDY36746.1|  BnaA03g11400D                                          140   9e-35   Brassica napus [oilseed rape]
ref|XP_006391459.1|  hypothetical protein EUTSA_v10018170mg             140   9e-35   Eutrema salsugineum [saltwater cress]
ref|XP_010511610.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    140   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_007020655.1|  SHV3-like 2, putative isoform 4                    138   1e-34   
ref|NP_200359.1|  putative glycerophosphoryl diester phosphodiest...    140   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448228.1|  PREDICTED: glycerophosphodiester phosphodies...    140   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_007214645.1|  hypothetical protein PRUPE_ppa001847mg             140   1e-34   Prunus persica
ref|XP_009361078.1|  PREDICTED: probable glycerophosphoryl dieste...    139   2e-34   Pyrus x bretschneideri [bai li]
emb|CDX89312.1|  BnaA01g15810D                                          139   2e-34   
ref|XP_009142640.1|  PREDICTED: probable glycerophosphoryl dieste...    139   2e-34   Brassica rapa
ref|XP_002300351.2|  hypothetical protein POPTR_0001s37160g             139   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_002888566.1|  kinase family protein                              140   2e-34   
ref|XP_010470589.1|  PREDICTED: glycerophosphodiester phosphodies...    139   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006283180.1|  hypothetical protein CARUB_v10004210mg             139   4e-34   Capsella rubella
emb|CDY46687.1|  BnaA03g48210D                                          138   4e-34   Brassica napus [oilseed rape]
ref|XP_009137609.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    139   5e-34   Brassica rapa
ref|XP_010443178.1|  PREDICTED: glycerophosphodiester phosphodies...    138   5e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010482994.1|  PREDICTED: glycerophosphodiester phosphodies...    138   7e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009137635.1|  PREDICTED: probable glycerophosphoryl dieste...    139   7e-34   Brassica rapa
emb|CDX92806.1|  BnaC07g40640D                                          137   1e-33   
ref|XP_009588257.1|  PREDICTED: probable glycerophosphoryl dieste...    137   1e-33   
ref|XP_006300798.1|  hypothetical protein CARUB_v10019878mg             137   1e-33   
ref|XP_006300799.1|  hypothetical protein CARUB_v10019878mg             137   1e-33   
ref|XP_006300797.1|  hypothetical protein CARUB_v10019878mg             137   2e-33   
ref|XP_009120058.1|  PREDICTED: probable glycerophosphoryl dieste...    137   2e-33   Brassica rapa
emb|CDY17323.1|  BnaA10g09570D                                          137   2e-33   Brassica napus [oilseed rape]
emb|CDY12600.1|  BnaA02g12680D                                          136   4e-33   Brassica napus [oilseed rape]
ref|XP_010511611.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    137   4e-33   
ref|XP_010675854.1|  PREDICTED: glycerophosphodiester phosphodies...    135   5e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009127505.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    136   7e-33   
ref|XP_010253010.1|  PREDICTED: glycerophosphodiester phosphodies...    135   7e-33   Nelumbo nucifera [Indian lotus]
ref|XP_006279181.1|  hypothetical protein CARUB_v10007932mg             134   9e-33   
emb|CDY60415.1|  BnaC02g45340D                                          135   1e-32   Brassica napus [oilseed rape]
ref|XP_006279182.1|  hypothetical protein CARUB_v10007932mg             134   1e-32   Capsella rubella
ref|XP_006280048.1|  hypothetical protein CARUB_v10025925mg             134   1e-32   Capsella rubella
gb|AFW58563.1|  hypothetical protein ZEAMMB73_741781                    126   1e-32   
emb|CDX92782.1|  BnaC07g40400D                                          135   2e-32   
gb|EYU27402.1|  hypothetical protein MIMGU_mgv1a001806mg                133   3e-32   Erythranthe guttata [common monkey flower]
ref|XP_007146559.1|  hypothetical protein PHAVU_006G050800g             133   3e-32   Phaseolus vulgaris [French bean]
ref|XP_003579951.1|  PREDICTED: glycerophosphodiester phosphodies...    133   4e-32   Brachypodium distachyon [annual false brome]
ref|XP_010496108.1|  PREDICTED: glycerophosphodiester phosphodies...    132   6e-32   Camelina sativa [gold-of-pleasure]
ref|NP_001185333.1|  putative glycerophosphoryl diester phosphodi...    132   6e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007146552.1|  hypothetical protein PHAVU_006G050300g             132   6e-32   Phaseolus vulgaris [French bean]
emb|CDY11996.1|  BnaC03g14220D                                          132   6e-32   Brassica napus [oilseed rape]
ref|XP_010913178.1|  PREDICTED: glycerophosphodiester phosphodies...    132   7e-32   
ref|XP_010496109.1|  PREDICTED: glycerophosphodiester phosphodies...    133   8e-32   
ref|XP_010913177.1|  PREDICTED: glycerophosphodiester phosphodies...    132   1e-31   Elaeis guineensis
ref|XP_002864395.1|  glycerophosphoryl diester phosphodiesterase ...    131   2e-31   
ref|XP_004294052.1|  PREDICTED: glycerophosphodiester phosphodies...    131   2e-31   Fragaria vesca subsp. vesca
ref|XP_009415406.1|  PREDICTED: probable glycerophosphoryl dieste...    131   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN28413.1|  Putative glycerophosphoryl diester phosphodiester...    131   2e-31   Glycine soja [wild soybean]
ref|XP_009348463.1|  PREDICTED: probable glycerophosphoryl dieste...    130   2e-31   Pyrus x bretschneideri [bai li]
ref|XP_009396661.1|  PREDICTED: probable glycerophosphoryl dieste...    130   3e-31   
ref|XP_010415240.1|  PREDICTED: glycerophosphodiester phosphodies...    130   5e-31   Camelina sativa [gold-of-pleasure]
ref|XP_004150252.1|  PREDICTED: probable glycerophosphoryl dieste...    130   6e-31   Cucumis sativus [cucumbers]
ref|XP_008364336.1|  PREDICTED: probable glycerophosphoryl dieste...    128   6e-31   
ref|XP_010419030.1|  PREDICTED: glycerophosphodiester phosphodies...    129   9e-31   
gb|KHN28414.1|  Putative glycerophosphoryl diester phosphodiester...    128   2e-30   Glycine soja [wild soybean]
ref|XP_007142367.1|  hypothetical protein PHAVU_008G274300g             128   2e-30   Phaseolus vulgaris [French bean]
ref|XP_003530776.1|  PREDICTED: probable glycerophosphoryl dieste...    128   3e-30   Glycine max [soybeans]
gb|KHM99502.1|  Putative glycerophosphoryl diester phosphodiester...    127   3e-30   Glycine soja [wild soybean]
dbj|BAD17454.1|  glycerophosphoryl diester phosphodiesterase 2 pr...    119   3e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004975931.1|  PREDICTED: probable glycerophosphoryl dieste...    127   3e-30   Setaria italica
ref|XP_009364631.1|  PREDICTED: probable glycerophosphoryl dieste...    125   4e-30   Pyrus x bretschneideri [bai li]
ref|NP_001168748.1|  uncharacterized protein LOC100382543 precursor     127   5e-30   Zea mays [maize]
emb|CDY46667.1|  BnaA03g48410D                                          128   5e-30   Brassica napus [oilseed rape]
ref|XP_008806340.1|  PREDICTED: probable glycerophosphoryl dieste...    127   6e-30   Phoenix dactylifera
ref|XP_010474169.1|  PREDICTED: glycerophosphodiester phosphodies...    124   6e-30   
ref|XP_009335427.1|  PREDICTED: probable glycerophosphoryl dieste...    126   9e-30   Pyrus x bretschneideri [bai li]
ref|NP_001142429.1|  uncharacterized protein LOC100274608               123   9e-30   
gb|EMT15515.1|  Putative glycerophosphoryl diester phosphodiester...    126   1e-29   
gb|EMT29224.1|  Putative glycerophosphoryl diester phosphodiester...    126   1e-29   
ref|XP_010545539.1|  PREDICTED: glycerophosphodiester phosphodies...    125   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_008349893.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    123   1e-29   
ref|XP_003553031.1|  PREDICTED: probable glycerophosphoryl dieste...    125   2e-29   
gb|EMS58329.1|  putative glycerophosphoryl diester phosphodiester...    125   2e-29   Triticum urartu
ref|XP_002446646.1|  hypothetical protein SORBIDRAFT_06g019730          125   3e-29   Sorghum bicolor [broomcorn]
ref|XP_008366428.1|  PREDICTED: probable glycerophosphoryl dieste...    125   3e-29   
gb|AES70468.2|  glycerophosphoryl diester phosphodiesterase famil...    124   4e-29   Medicago truncatula
ref|XP_010252664.1|  PREDICTED: glycerophosphodiester phosphodies...    124   5e-29   Nelumbo nucifera [Indian lotus]
ref|XP_003600217.1|  Glycerophosphodiesterase-like protein              124   5e-29   
dbj|BAJ87963.1|  predicted protein                                      124   5e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85772.1|  predicted protein                                      124   5e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAH67272.1|  B0806H07.1                                             124   7e-29   Oryza sativa [red rice]
ref|NP_001053060.1|  Os04g0472300                                       124   7e-29   
ref|XP_006652401.1|  PREDICTED: probable glycerophosphoryl dieste...    124   9e-29   Oryza brachyantha
emb|CBI18678.3|  unnamed protein product                                123   9e-29   Vitis vinifera
gb|KHN43860.1|  Putative glycerophosphoryl diester phosphodiester...    123   1e-28   Glycine soja [wild soybean]
tpg|DAA63616.1|  TPA: hypothetical protein ZEAMMB73_629479              120   1e-28   
ref|XP_006586115.1|  PREDICTED: probable glycerophosphoryl dieste...    123   1e-28   Glycine max [soybeans]
gb|AAV64200.1|  unknown                                                 120   1e-28   Zea mays [maize]
ref|XP_003519608.1|  PREDICTED: probable glycerophosphoryl dieste...    123   1e-28   Glycine max [soybeans]
ref|XP_010656583.1|  PREDICTED: glycerophosphodiester phosphodies...    123   1e-28   Vitis vinifera
ref|XP_007146553.1|  hypothetical protein PHAVU_006G0504001g            121   1e-28   Phaseolus vulgaris [French bean]
ref|XP_003530778.1|  PREDICTED: probable glycerophosphoryl dieste...    122   2e-28   Glycine max [soybeans]
gb|KCW78936.1|  hypothetical protein EUGRSUZ_C00368                     122   2e-28   Eucalyptus grandis [rose gum]
ref|XP_010252665.1|  PREDICTED: glycerophosphodiester phosphodies...    122   2e-28   Nelumbo nucifera [Indian lotus]
gb|AAV64238.1|  unknown                                                 119   3e-28   Zea mays [maize]
ref|XP_003544723.1|  PREDICTED: probable glycerophosphoryl dieste...    122   3e-28   Glycine max [soybeans]
ref|XP_004500131.1|  PREDICTED: probable glycerophosphoryl dieste...    122   4e-28   Cicer arietinum [garbanzo]
gb|EMS62136.1|  putative glycerophosphoryl diester phosphodiester...    122   4e-28   Triticum urartu
gb|KHN23877.1|  Putative glycerophosphoryl diester phosphodiester...    122   4e-28   Glycine soja [wild soybean]
ref|XP_007146557.1|  hypothetical protein PHAVU_006G050600g             121   4e-28   Phaseolus vulgaris [French bean]
ref|XP_007146558.1|  hypothetical protein PHAVU_006G050600g             121   8e-28   Phaseolus vulgaris [French bean]
ref|XP_004973845.1|  PREDICTED: probable glycerophosphoryl dieste...    120   1e-27   Setaria italica
ref|NP_001047275.1|  Os02g0588500                                       120   1e-27   
ref|XP_008782908.1|  PREDICTED: probable glycerophosphoryl dieste...    120   1e-27   Phoenix dactylifera
ref|NP_001169682.1|  hypothetical protein precursor                     120   2e-27   Zea mays [maize]
ref|XP_004973844.1|  PREDICTED: probable glycerophosphoryl dieste...    120   2e-27   Setaria italica
ref|XP_010928867.1|  PREDICTED: glycerophosphodiester phosphodies...    120   2e-27   Elaeis guineensis
gb|EAY86479.1|  hypothetical protein OsI_07859                          119   2e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_009417318.1|  PREDICTED: probable glycerophosphoryl dieste...    119   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006344951.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    117   2e-27   
ref|XP_008798763.1|  PREDICTED: probable glycerophosphoryl dieste...    119   3e-27   Phoenix dactylifera
ref|XP_004979884.1|  PREDICTED: probable glycerophosphoryl dieste...    120   3e-27   Setaria italica
ref|XP_010064948.1|  PREDICTED: probable glycerophosphoryl dieste...    119   4e-27   
ref|XP_009390640.1|  PREDICTED: probable glycerophosphoryl dieste...    119   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010675853.1|  PREDICTED: glycerophosphodiester phosphodies...    118   6e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006829998.1|  hypothetical protein AMTR_s00252p00015420          118   7e-27   Amborella trichopoda
ref|XP_010913956.1|  PREDICTED: glycerophosphodiester phosphodies...    118   8e-27   Elaeis guineensis
ref|XP_010943202.1|  PREDICTED: glycerophosphodiester phosphodies...    117   1e-26   Elaeis guineensis
ref|XP_004491450.1|  PREDICTED: probable glycerophosphoryl dieste...    117   2e-26   Cicer arietinum [garbanzo]
ref|XP_008811210.1|  PREDICTED: probable glycerophosphoryl dieste...    116   2e-26   
ref|XP_006297062.1|  hypothetical protein CARUB_v10013062mg             117   2e-26   Capsella rubella
gb|EMT33222.1|  Putative glycerophosphoryl diester phosphodiester...    117   2e-26   
ref|XP_008811209.1|  PREDICTED: probable glycerophosphoryl dieste...    116   4e-26   Phoenix dactylifera
gb|AFW72078.1|  hypothetical protein ZEAMMB73_869244                    113   4e-26   
ref|XP_006856834.1|  hypothetical protein AMTR_s00055p00174750          115   5e-26   Amborella trichopoda
ref|XP_004952935.1|  PREDICTED: probable glycerophosphoryl dieste...    115   5e-26   
ref|XP_007142366.1|  hypothetical protein PHAVU_008G274200g             115   6e-26   Phaseolus vulgaris [French bean]
ref|XP_002445920.1|  hypothetical protein SORBIDRAFT_07g028050          115   8e-26   
ref|XP_002452366.1|  hypothetical protein SORBIDRAFT_04g024440          115   9e-26   Sorghum bicolor [broomcorn]
ref|XP_006406374.1|  hypothetical protein EUTSA_v10020151mg             115   1e-25   
ref|XP_010687738.1|  PREDICTED: glycerophosphodiester phosphodies...    115   1e-25   Beta vulgaris subsp. vulgaris [field beet]
tpg|DAA47913.1|  TPA: hypothetical protein ZEAMMB73_887943              114   1e-25   
ref|XP_003572357.1|  PREDICTED: glycerophosphodiester phosphodies...    114   1e-25   
ref|XP_008645839.1|  PREDICTED: uncharacterized protein LOC100384...    114   2e-25   
ref|NP_001170117.1|  hypothetical protein                               114   2e-25   Zea mays [maize]
ref|XP_004491451.1|  PREDICTED: probable glycerophosphoryl dieste...    114   2e-25   Cicer arietinum [garbanzo]
ref|XP_008645878.1|  PREDICTED: probable glycerophosphoryl dieste...    114   2e-25   Zea mays [maize]
emb|CDY58867.1|  BnaC09g52640D                                          114   3e-25   Brassica napus [oilseed rape]
emb|CDX86765.1|  BnaA09g21550D                                          107   3e-25   
ref|XP_011033465.1|  PREDICTED: glycerophosphodiester phosphodies...    113   3e-25   Populus euphratica
emb|CDY11831.1|  BnaC03g12570D                                          112   4e-25   Brassica napus [oilseed rape]
ref|XP_002308389.2|  hypothetical protein POPTR_0006s20170g             113   4e-25   
ref|XP_009145621.1|  PREDICTED: probable glycerophosphoryl dieste...    112   5e-25   Brassica rapa
emb|CDY19634.1|  BnaA05g20420D                                          112   5e-25   Brassica napus [oilseed rape]
ref|XP_003575252.1|  PREDICTED: glycerophosphodiester phosphodies...    112   5e-25   
ref|XP_002883252.1|  glycerophosphoryl diester phosphodiesterase ...    112   7e-25   
ref|XP_010109457.1|  putative glycerophosphoryl diester phosphodi...    112   7e-25   Morus notabilis
gb|AAO42211.1|  unknown protein                                         112   9e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CDX86766.1|  BnaA09g21560D                                          111   9e-25   
ref|XP_008799657.1|  PREDICTED: probable glycerophosphoryl dieste...    112   9e-25   Phoenix dactylifera
gb|EEE53168.1|  hypothetical protein OsJ_36008                          113   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|NP_188688.1|  glycerophosphodiester phosphodiesterase-like pr...    112   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866252.1|  glycerophosphoryl diester phosphodiesterase ...    111   1e-24   Arabidopsis lyrata subsp. lyrata
gb|KEH28442.1|  glycerophosphoryl diester phosphodiesterase famil...    111   2e-24   Medicago truncatula
ref|XP_003617676.1|  Glycerophosphodiesterase-like protein              111   2e-24   Medicago truncatula
ref|XP_009399679.1|  PREDICTED: probable glycerophosphoryl dieste...    111   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004293798.1|  PREDICTED: glycerophosphodiester phosphodies...    111   2e-24   Fragaria vesca subsp. vesca
ref|XP_010241663.1|  PREDICTED: glycerophosphodiester phosphodies...    110   3e-24   Nelumbo nucifera [Indian lotus]
ref|XP_009132086.1|  PREDICTED: probable glycerophosphoryl dieste...    110   3e-24   Brassica rapa
ref|NP_001062173.1|  Os08g0503200                                       110   3e-24   
emb|CDX88656.1|  BnaA03g09930D                                          110   4e-24   
ref|XP_002862842.1|  glycerophosphoryl diester phosphodiesterase ...    109   6e-24   
ref|XP_010050300.1|  PREDICTED: probable glycerophosphoryl dieste...    109   8e-24   
ref|XP_010488033.1|  PREDICTED: glycerophosphodiester phosphodies...    105   8e-24   
ref|XP_011017989.1|  PREDICTED: glycerophosphodiester phosphodies...    109   9e-24   Populus euphratica
ref|XP_010483370.1|  PREDICTED: glycerophosphodiester phosphodies...    109   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_008679540.1|  PREDICTED: probable glycerophosphoryl dieste...    108   1e-23   Zea mays [maize]
emb|CDX71386.1|  BnaC04g16210D                                          102   2e-23   
ref|XP_010913957.1|  PREDICTED: glycerophosphodiester phosphodies...    108   2e-23   
ref|XP_006660255.1|  PREDICTED: probable glycerophosphoryl dieste...    107   3e-23   
ref|XP_004506009.1|  PREDICTED: uncharacterized protein LOC101491157    105   4e-23   
ref|XP_007011972.1|  SHV3-like 5                                        107   5e-23   
dbj|BAJ92515.1|  predicted protein                                      102   7e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002325146.2|  hypothetical protein POPTR_0018s11890g             106   7e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006647435.1|  PREDICTED: probable glycerophosphoryl dieste...    106   9e-23   Oryza brachyantha
emb|CDY36036.1|  BnaC03g41620D                                          106   1e-22   Brassica napus [oilseed rape]
ref|XP_006401135.1|  hypothetical protein EUTSA_v10012762mg             105   1e-22   
ref|NP_001046128.1|  Os02g0187400                                       105   1e-22   
ref|XP_010536984.1|  PREDICTED: glycerophosphodiester phosphodies...    105   2e-22   Tarenaya hassleriana [spider flower]
dbj|BAD15424.1|  glycerophosphoryl diester phosphodiesterase 2 pr...    105   2e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006282081.1|  hypothetical protein CARUB_v10028327mg             105   2e-22   Capsella rubella
gb|EEE56466.1|  hypothetical protein OsJ_05675                          105   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72640.1|  hypothetical protein OsI_06154                          105   3e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_002523503.1|  glycerophosphoryl diester phosphodiesterase,...    104   4e-22   Ricinus communis
ref|XP_010443532.1|  PREDICTED: glycerophosphodiester phosphodies...    103   4e-22   Camelina sativa [gold-of-pleasure]
gb|EMT22700.1|  Putative glycerophosphoryl diester phosphodiester...    104   5e-22   
ref|XP_010485211.1|  PREDICTED: glycerophosphodiester phosphodies...    102   6e-22   Camelina sativa [gold-of-pleasure]
emb|CDY02800.1|  BnaC02g10890D                                          103   7e-22   
ref|XP_010453288.1|  PREDICTED: glycerophosphodiester phosphodies...    103   7e-22   Camelina sativa [gold-of-pleasure]
gb|EMS54688.1|  putative glycerophosphoryl diester phosphodiester...    103   8e-22   Triticum urartu
emb|CDY02788.1|  BnaC02g11010D                                          103   1e-21   
emb|CDY32730.1|  BnaA02g07920D                                          103   1e-21   Brassica napus [oilseed rape]
ref|XP_004499801.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    103   1e-21   
dbj|BAJ93663.1|  predicted protein                                      103   1e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002866246.1|  glycerophosphoryl diester phosphodiesterase ...    103   1e-21   Arabidopsis lyrata subsp. lyrata
dbj|BAK08209.1|  predicted protein                                      103   1e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS66577.1|  putative glycerophosphoryl diester phosphodiester...    103   1e-21   Triticum urartu
ref|XP_010928375.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    103   1e-21   Elaeis guineensis
ref|XP_009126795.1|  PREDICTED: probable glycerophosphoryl dieste...    102   2e-21   Brassica rapa
ref|XP_010453117.1|  PREDICTED: glycerophosphodiester phosphodies...    102   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_004951679.1|  PREDICTED: probable glycerophosphoryl dieste...    102   2e-21   
ref|NP_200625.1|  glycerophosphodiester phosphodiesterase like 7        102   3e-21   Arabidopsis thaliana [mouse-ear cress]
gb|EPS69135.1|  glycerophosphodiesterase-like protein                   102   3e-21   
ref|XP_004160165.1|  PREDICTED: probable glycerophosphoryl dieste...    101   4e-21   
gb|KFK39359.1|  hypothetical protein AALP_AA3G234500                    101   4e-21   
emb|CDX82243.1|  BnaA03g35780D                                        98.2    4e-21   
ref|NP_200613.2|  glycerophosphodiester phosphodiesterase like 6        101   6e-21   
ref|XP_009358473.1|  PREDICTED: probable glycerophosphoryl dieste...    101   6e-21   
ref|XP_004143578.1|  PREDICTED: probable glycerophosphoryl dieste...    101   7e-21   
ref|XP_008440682.1|  PREDICTED: probable glycerophosphoryl dieste...    100   9e-21   
ref|XP_010231119.1|  PREDICTED: glycerophosphodiester phosphodies...    100   1e-20   
emb|CDY32720.1|  BnaA02g07820D                                          100   2e-20   
ref|XP_009366150.1|  PREDICTED: probable glycerophosphoryl dieste...    100   2e-20   
gb|EEE69509.1|  hypothetical protein OsJ_28963                        98.2    2e-20   
ref|XP_003566003.1|  PREDICTED: glycerophosphodiester phosphodies...  99.8    2e-20   
gb|AFW66254.1|  hypothetical protein ZEAMMB73_246886                  99.8    2e-20   
ref|XP_008677440.1|  PREDICTED: uncharacterized protein LOC100304...    100   2e-20   
ref|XP_008677439.1|  PREDICTED: uncharacterized protein LOC100304...    100   2e-20   
ref|XP_008677441.1|  PREDICTED: uncharacterized protein LOC100304...    100   2e-20   
gb|AFW70515.1|  hypothetical protein ZEAMMB73_076757                  97.1    2e-20   
ref|XP_004965786.1|  PREDICTED: probable glycerophosphoryl dieste...  99.0    3e-20   
dbj|BAD28342.1|  glycerophosphoryl diester phosphodiesterase 2 pr...  98.2    6e-20   
ref|XP_007201937.1|  hypothetical protein PRUPE_ppa001673mg           97.8    8e-20   
ref|XP_008242952.1|  PREDICTED: probable glycerophosphoryl dieste...  97.8    1e-19   
ref|XP_006474608.1|  PREDICTED: probable glycerophosphoryl dieste...  97.4    1e-19   
ref|XP_008645346.1|  PREDICTED: probable glycerophosphoryl dieste...  97.1    2e-19   
ref|XP_008343908.1|  PREDICTED: probable glycerophosphoryl dieste...  96.7    3e-19   
ref|XP_003570935.1|  PREDICTED: glycerophosphodiester phosphodies...  96.3    3e-19   
ref|XP_008384576.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...  95.9    5e-19   
ref|XP_008361197.1|  PREDICTED: probable glycerophosphoryl dieste...  95.5    5e-19   
ref|XP_009120321.1|  PREDICTED: probable glycerophosphoryl dieste...  94.7    9e-19   
emb|CDY43885.1|  BnaC09g33580D                                        94.4    1e-18   
ref|XP_009126782.1|  PREDICTED: probable glycerophosphoryl dieste...  94.4    2e-18   
ref|XP_011460616.1|  PREDICTED: glycerophosphodiester phosphodies...  93.6    3e-18   
emb|CDP10204.1|  unnamed protein product                              92.8    5e-18   
gb|KDP38642.1|  hypothetical protein JCGZ_03995                       90.9    2e-17   
gb|EMT03737.1|  Putative glycerophosphoryl diester phosphodiester...  90.1    5e-17   
gb|KJB54927.1|  hypothetical protein B456_009G054700                  89.0    1e-16   
ref|NP_001062919.2|  Os09g0339800                                     88.2    1e-16   
gb|EYU25341.1|  hypothetical protein MIMGU_mgv1a001922mg              87.4    3e-16   
ref|XP_006586114.1|  PREDICTED: probable glycerophosphoryl dieste...  81.6    4e-16   
ref|XP_009126781.1|  PREDICTED: probable glycerophosphoryl dieste...  87.0    5e-16   
ref|XP_011084009.1|  PREDICTED: glycerophosphodiester phosphodies...  86.3    6e-16   
ref|XP_009594117.1|  PREDICTED: probable glycerophosphoryl dieste...  85.1    2e-15   
ref|XP_002437331.1|  hypothetical protein SORBIDRAFT_10g025000        84.7    2e-15   
ref|XP_006340538.1|  PREDICTED: probable glycerophosphoryl dieste...  84.0    5e-15   
ref|XP_010315575.1|  PREDICTED: glycerophosphodiester phosphodies...  83.2    7e-15   
gb|KEH37864.1|  glycerophosphoryl diester phosphodiesterase famil...  82.0    2e-14   
ref|XP_009803613.1|  PREDICTED: probable glycerophosphoryl dieste...  81.3    3e-14   
ref|XP_009803612.1|  PREDICTED: probable glycerophosphoryl dieste...  80.9    4e-14   
ref|XP_006340583.1|  PREDICTED: probable glycerophosphoryl dieste...  80.5    5e-14   
emb|CDY12605.1|  BnaA02g12730D                                        80.1    8e-14   
ref|XP_010315562.1|  PREDICTED: glycerophosphodiester phosphodies...  79.7    1e-13   
gb|EPS68532.1|  hypothetical protein M569_06231                       77.0    8e-13   
ref|XP_007154910.1|  hypothetical protein PHAVU_003G158000g           76.6    1e-12   
gb|AES92567.2|  glycerophosphoryl diester phosphodiesterase famil...  75.5    3e-12   
ref|XP_003610370.1|  GPI-anchored protein                             75.5    3e-12   
ref|XP_006600556.1|  PREDICTED: probable glycerophosphoryl dieste...  73.2    1e-11   
ref|XP_002983605.1|  hypothetical protein SELMODRAFT_118548           71.6    4e-11   
ref|XP_002973791.1|  hypothetical protein SELMODRAFT_100702           69.3    2e-10   
ref|WP_027846981.1|  hypothetical protein                             68.2    3e-10   
ref|XP_001756508.1|  predicted protein                                67.8    9e-10   
ref|WP_008906374.1|  glycerophosphoryl diester phosphodiesterase      66.6    1e-09   
ref|XP_003541467.2|  PREDICTED: probable glycerophosphoryl dieste...  66.2    3e-09   
ref|XP_976827.1|  Glycerophosphoryl diester phosphodiesterase fam...  65.1    3e-09   
ref|WP_026880196.1|  glycerophosphodiester phosphodiesterase          65.1    4e-09   
gb|KHN18329.1|  Putative glycerophosphoryl diester phosphodiester...  65.5    5e-09   
gb|KDB51915.1|  glycerophosphoryl diester phosphodiesterase           64.7    5e-09   
ref|WP_012348374.1|  glycerophosphoryl diester phosphodiesterase      64.7    6e-09   
ref|WP_037482455.1|  glycerophosphodiester phosphodiesterase          64.7    6e-09   
ref|XP_010416257.1|  PREDICTED: glycerophosphodiester phosphodies...  62.0    1e-08   
ref|XP_010416256.1|  PREDICTED: glycerophosphodiester phosphodies...  61.6    1e-08   
ref|XP_001756342.1|  predicted protein                                63.5    2e-08   
ref|XP_010416252.1|  PREDICTED: glycerophosphodiester phosphodies...  62.0    2e-08   
gb|KHN22089.1|  Putative glycerophosphoryl diester phosphodiester...  63.5    2e-08   
ref|WP_036838616.1|  glycerophosphodiester phosphodiesterase          62.0    5e-08   
gb|EJL83967.1|  glycerophosphoryl diester phosphodiesterase           62.0    5e-08   
ref|XP_010416272.1|  PREDICTED: glycerophosphodiester phosphodies...  61.6    6e-08   
ref|XP_010428404.1|  PREDICTED: glycerophosphodiester phosphodies...  61.6    6e-08   
gb|ELR99882.1|  glycerophosphoryl diester phosphodiesterase           62.0    7e-08   
ref|WP_036269588.1|  glycerophosphodiester phosphodiesterase          60.5    1e-07   
ref|XP_004241605.1|  PREDICTED: glycerophosphodiester phosphodies...  59.7    3e-07   
gb|ERT04513.1|  glycerophosphoryl diester phosphodiesterase famil...  60.1    3e-07   
ref|XP_006354752.1|  PREDICTED: probable glycerophosphoryl dieste...  59.3    3e-07   
ref|WP_012745495.1|  glycerophosphoryl diester phosphodiesterase      58.9    4e-07   
gb|KDO59429.1|  hypothetical protein CISIN_1g005894mg                 58.9    5e-07   
gb|AEY88262.1|  glycerophosphoryl diester phosphodiesterase           56.6    6e-07   
ref|WP_036483116.1|  glycerophosphodiester phosphodiesterase          58.9    6e-07   
ref|WP_036478771.1|  glycerophosphodiester phosphodiesterase          58.9    6e-07   
ref|WP_008178488.1|  glycerophosphoryl diester phosphodiesterase      58.9    7e-07   
ref|WP_015216930.1|  glycerophosphoryl diester phosphodiesterase      58.9    7e-07   
ref|WP_042464421.1|  hypothetical protein                             56.6    7e-07   
ref|WP_026436377.1|  glycerophosphodiester phosphodiesterase          57.8    1e-06   
ref|WP_007835428.1|  glycerophosphoryl diester phosphodiesterase      57.8    1e-06   
ref|XP_006302358.1|  hypothetical protein CARUB_v10020425mg           57.4    2e-06   
ref|WP_040484619.1|  hypothetical protein                             57.4    2e-06   
ref|WP_039781895.1|  glycerophosphodiester phosphodiesterase          57.4    2e-06   
ref|WP_012163503.1|  glycerophosphoryl diester phosphodiesterase      57.4    2e-06   
gb|AGC70933.1|  glycerophosphoryl diester phosphodiesterase           57.0    2e-06   
ref|XP_006440766.1|  hypothetical protein CICLE_v10020540mg           56.6    2e-06   
ref|WP_011612320.1|  glycerophosphoryl diester phosphodiesterase      57.0    3e-06   
ref|XP_010416268.1|  PREDICTED: glycerophosphodiester phosphodies...  56.2    4e-06   
ref|XP_004299298.1|  PREDICTED: glycerophosphodiester phosphodies...  56.2    4e-06   
ref|WP_029315687.1|  glycerophosphodiester phosphodiesterase          56.6    4e-06   
gb|EYU45734.1|  hypothetical protein MIMGU_mgv1a007920mg              55.8    4e-06   
ref|XP_009345993.1|  PREDICTED: probable glycerophosphoryl dieste...  55.8    4e-06   
ref|XP_009338242.1|  PREDICTED: probable glycerophosphoryl dieste...  55.8    4e-06   
gb|ELR97763.1|  glycerophosphoryl diester phosphodiesterase           56.2    5e-06   
ref|WP_021005092.1|  putative glycerophosphoryl diester phosphodi...  55.8    5e-06   
ref|XP_010491423.1|  PREDICTED: glycerophosphodiester phosphodies...  55.8    5e-06   
gb|KDP31354.1|  hypothetical protein JCGZ_11730                       55.8    5e-06   
ref|WP_030654863.1|  MULTISPECIES: glycerophosphodiester phosphod...  55.5    6e-06   
ref|WP_018996438.1|  hypothetical protein                             55.5    6e-06   
ref|WP_042580472.1|  glycerophosphodiester phosphodiesterase          55.5    6e-06   
ref|WP_040554519.1|  hypothetical protein                             55.5    6e-06   
gb|EGM78982.1|  glycerophosphoryl diester phosphodiesterase           55.5    6e-06   
ref|WP_030981770.1|  glycerophosphodiester phosphodiesterase          55.5    6e-06   
ref|WP_038119525.1|  glycerophosphodiester phosphodiesterase          55.5    6e-06   
ref|XP_006390448.1|  hypothetical protein EUTSA_v10018684mg           55.5    6e-06   
ref|WP_010351343.1|  glycerophosphoryl diester phosphodiesterase      55.5    6e-06   
ref|XP_010471509.1|  PREDICTED: glycerophosphodiester phosphodies...  55.5    7e-06   
ref|XP_001691613.1|  glycerophosphoryl diester phosphodiesterase ...  55.1    7e-06   
ref|WP_027730853.1|  hypothetical protein                             53.5    8e-06   
emb|CDS53213.1|  Glycerophosphoryl diester phosphodiesterase          55.1    8e-06   
ref|XP_008351894.1|  PREDICTED: probable glycerophosphoryl dieste...  55.1    9e-06   
ref|WP_003286770.1|  glycerophosphoryl diester phosphodiesterase      55.1    9e-06   
ref|WP_015914076.1|  glycerophosphoryl diester phosphodiesterase      55.1    9e-06   
ref|XP_002283945.1|  PREDICTED: glycerophosphodiester phosphodies...  55.1    9e-06   
ref|WP_011806527.1|  glycerophosphoryl diester phosphodiesterase      55.1    9e-06   
ref|WP_040697410.1|  glycerophosphodiester phosphodiesterase          55.5    9e-06   
gb|KFI26028.1|  glycerophosphodiester phosphodiesterase               55.1    1e-05   
ref|WP_013538798.1|  glycerophosphoryl diester phosphodiesterase      55.1    1e-05   
ref|XP_002514650.1|  glycerophosphoryl diester phosphodiesterase,...  54.7    1e-05   
emb|CDX73068.1|  BnaC06g35160D                                        54.7    1e-05   
ref|XP_009795261.1|  PREDICTED: probable glycerophosphoryl dieste...  54.7    1e-05   
ref|XP_009593560.1|  PREDICTED: probable glycerophosphoryl dieste...  54.7    1e-05   
ref|XP_010695228.1|  PREDICTED: glycerophosphodiester phosphodies...  54.7    1e-05   
ref|WP_039222483.1|  glycerophosphodiester phosphodiesterase          52.8    1e-05   
ref|WP_003372241.1|  glycerophosphodiester phosphodiesterase          54.3    1e-05   
ref|WP_036813012.1|  glycerophosphodiester phosphodiesterase          54.3    1e-05   
emb|CDP19102.1|  unnamed protein product                              54.3    2e-05   
ref|WP_015228782.1|  glycerophosphoryl diester phosphodiesterase      54.7    2e-05   
ref|XP_003549570.1|  PREDICTED: probable glycerophosphoryl dieste...  54.3    2e-05   
ref|WP_037751029.1|  glycerophosphodiester phosphodiesterase          54.3    2e-05   
gb|KEH32030.1|  glycerophosphoryl diester phosphodiesterase famil...  53.9    2e-05   
gb|KEH32031.1|  glycerophosphoryl diester phosphodiesterase famil...  54.3    2e-05   
emb|CDP11621.1|  unnamed protein product                              53.9    2e-05   
gb|ABE45042.1|  glycerophosphoryl diester phosphodiesterase           53.9    2e-05   
emb|CDX85814.1|  BnaC06g23200D                                        52.8    2e-05   
ref|WP_019960329.1|  hypothetical protein                             53.9    2e-05   
ref|WP_031016567.1|  glycerophosphodiester phosphodiesterase          53.9    2e-05   
ref|WP_041389906.1|  glycerophosphodiester phosphodiesterase          53.9    2e-05   
ref|XP_001758075.1|  predicted protein                                53.5    2e-05   
ref|XP_007045851.1|  PLC-like phosphodiesterases superfamily protein  53.9    3e-05   
ref|WP_030973272.1|  glycerophosphodiester phosphodiesterase          53.5    3e-05   
ref|WP_017352539.1|  glycerophosphodiester phosphodiesterase          53.5    3e-05   
ref|WP_035783325.1|  glycerophosphodiester phosphodiesterase          53.5    3e-05   
ref|WP_018549077.1|  glycerophosphoryl diester phosphodiesterase      53.5    3e-05   
ref|XP_009020602.1|  hypothetical protein HELRODRAFT_192312           53.5    3e-05   
ref|XP_010258037.1|  PREDICTED: glycerophosphodiester phosphodies...  53.5    3e-05   
ref|WP_012425650.1|  glycerophosphodiester phosphodiesterase          53.5    3e-05   
ref|WP_033366138.1|  glycerophosphodiester phosphodiesterase          53.5    3e-05   
ref|WP_030166314.1|  glycerophosphodiester phosphodiesterase          53.5    3e-05   
gb|EMT04962.1|  Glycerophosphoryl diester phosphodiesterase           53.1    3e-05   
ref|WP_029169778.1|  glycerophosphodiester phosphodiesterase          53.1    3e-05   
ref|WP_029169609.1|  glycerophosphodiester phosphodiesterase          53.1    3e-05   
gb|EPS69640.1|  hypothetical protein M569_05124                       53.1    3e-05   
gb|AEB77601.1|  glycerophosphodiester phosphodiesterase               53.1    4e-05   
ref|WP_015013304.1|  glycerophosphoryl diester phosphodiesterase      53.1    4e-05   
emb|CDX68196.1|  BnaA07g22360D                                        53.1    4e-05   
ref|XP_009104778.1|  PREDICTED: probable glycerophosphoryl dieste...  53.1    4e-05   
ref|XP_009104777.1|  PREDICTED: probable glycerophosphoryl dieste...  53.1    4e-05   
ref|WP_019325152.1|  glycerophosphoryl diester phosphodiesterase      53.1    5e-05   
ref|WP_043374988.1|  glycerophosphodiester phosphodiesterase          52.8    5e-05   
gb|ABI67153.1|  glycerophosphoryl diester phosphodiesterase           52.8    5e-05   
gb|ABR16222.1|  unknown                                               52.8    5e-05   
gb|EMS65566.1|  Glycerophosphoryl diester phosphodiesterase           52.8    5e-05   
ref|WP_038017664.1|  glycerophosphodiester phosphodiesterase          53.1    5e-05   
ref|WP_039801360.1|  glycerophosphodiester phosphodiesterase          52.8    6e-05   
ref|WP_020938914.1|  glycerophosphoryl diester phosphodiesterase      52.8    6e-05   
ref|WP_026283911.1|  glycerophosphodiester phosphodiesterase          52.8    6e-05   
emb|CDY11071.1|  BnaC06g23230D                                        52.8    6e-05   
ref|XP_001766682.1|  predicted protein                                52.8    6e-05   
ref|WP_030190176.1|  glycerophosphodiester phosphodiesterase          52.8    6e-05   
ref|WP_044401406.1|  glycerophosphodiester phosphodiesterase          52.4    7e-05   
ref|WP_038368073.1|  glycerophosphodiester phosphodiesterase          52.4    7e-05   
ref|WP_010463978.1|  glycerophosphoryl diester phosphodiesterase      52.4    7e-05   
gb|EDX87604.1|  Glycerophosphoryl diester phosphodiesterase family    52.8    7e-05   
ref|WP_036006738.1|  glycerophosphodiester phosphodiesterase          52.4    8e-05   
ref|XP_010068779.1|  PREDICTED: probable glycerophosphoryl dieste...  52.4    8e-05   
gb|KCW64880.1|  hypothetical protein EUGRSUZ_G02445                   52.4    8e-05   
ref|WP_012775934.1|  glycerophosphodiester phosphodiesterase          52.0    8e-05   
ref|XP_002966299.1|  hypothetical protein SELMODRAFT_85502            52.0    9e-05   
ref|WP_036772477.1|  glycerophosphodiester phosphodiesterase          52.0    9e-05   
ref|XP_002130939.1|  PREDICTED: probable glycerophosphoryl dieste...  52.0    9e-05   
ref|XP_002978269.1|  hypothetical protein SELMODRAFT_108000           52.0    1e-04   
ref|XP_008374638.1|  PREDICTED: probable glycerophosphoryl dieste...  52.0    1e-04   
ref|WP_023552025.1|  glycerophosphoryl diester phosphodiesterase      52.0    1e-04   
ref|WP_039230396.1|  glycerophosphodiester phosphodiesterase          52.0    1e-04   
ref|WP_039233339.1|  glycerophosphodiester phosphodiesterase          52.0    1e-04   
ref|XP_002466838.1|  hypothetical protein SORBIDRAFT_01g015000        52.0    1e-04   
ref|WP_030613703.1|  glycerophosphodiester phosphodiesterase          52.0    1e-04   
ref|WP_030945709.1|  glycerophosphodiester phosphodiesterase          52.0    1e-04   
ref|WP_011647402.1|  MULTISPECIES: glycerophosphoryl diester phos...  51.6    1e-04   
emb|CDX68195.1|  BnaA07g22350D                                        52.0    1e-04   
ref|WP_039260348.1|  glycerophosphodiester phosphodiesterase          51.6    1e-04   
ref|WP_039747705.1|  glycerophosphodiester phosphodiesterase          52.0    1e-04   
ref|XP_008240011.1|  PREDICTED: probable glycerophosphoryl dieste...  51.6    1e-04   
ref|WP_024814502.1|  glycerophosphodiester phosphodiesterase          51.6    1e-04   
ref|XP_007209220.1|  hypothetical protein PRUPE_ppa006823mg           51.6    1e-04   
ref|WP_012703278.1|  glycerophosphoryl diester phosphodiesterase      51.2    2e-04   
gb|AAV74406.1|  glycerophosphodiester phosphodiesterase-like protein  51.2    2e-04   
ref|XP_011072888.1|  PREDICTED: glycerophosphodiester phosphodies...  51.2    2e-04   
gb|KDO65721.1|  hypothetical protein CISIN_1g016353mg                 50.8    2e-04   
ref|WP_006520099.1|  glycerophosphoryl diester phosphodiesterase      51.2    2e-04   
gb|KDO65720.1|  hypothetical protein CISIN_1g016353mg                 50.8    2e-04   
ref|XP_006477678.1|  PREDICTED: probable glycerophosphoryl dieste...  50.8    2e-04   
ref|XP_006477679.1|  PREDICTED: probable glycerophosphoryl dieste...  50.8    3e-04   
ref|WP_035698005.1|  hypothetical protein                             50.4    3e-04   
ref|WP_026929396.1|  hypothetical protein                             50.8    3e-04   
ref|WP_019655470.1|  glycerophosphoryl diester phosphodiesterase      50.4    3e-04   
ref|WP_015121891.1|  glycerophosphoryl diester phosphodiesterase      50.8    3e-04   
ref|WP_003322871.1|  glycerophosphodiester phosphodiesterase          49.7    4e-04   



>ref|XP_002276757.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Vitis 
vinifera]
 emb|CBI26719.3| unnamed protein product [Vitis vinifera]
Length=757

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 100/121 (83%), Gaps = 1/121 (1%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  409
            M KLR +  LL L  +V LV+AQGSTN TS WQTL+G+APLVIARGGFSGLFPDSS  AY
Sbjct  1    MSKLRQVI-LLFLLHSVALVSAQGSTNGTSSWQTLNGNAPLVIARGGFSGLFPDSSSAAY  59

Query  410  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  589
            S A +TSL+NV++WCDVQLTKDG GICFPD+KL+NAS+++ +FK++ + YLVNGV T  W
Sbjct  60   SLALMTSLSNVVLWCDVQLTKDGAGICFPDMKLENASDISIVFKNRNNVYLVNGVSTPGW  119

Query  590  F  592
            F
Sbjct  120  F  120



>ref|XP_009787408.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana sylvestris]
Length=752

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  409
            MW LRSI  LLLLC +   V+AQ S N+TSKW TLSGDAP VIARGGFSGL PDSSFNAY
Sbjct  1    MWNLRSISCLLLLCCSAAFVSAQRSNNATSKWFTLSGDAPKVIARGGFSGLMPDSSFNAY  60

Query  410  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  589
            + A   S+ + + WCDVQLTKDGVGIC  DI+LDN+S+V  LFK+KQ+TYLVNGVP   W
Sbjct  61   TLASTISVADWVAWCDVQLTKDGVGICLSDIRLDNSSDVDVLFKNKQNTYLVNGVPQKGW  120

Query  590  F  592
            F
Sbjct  121  F  121



>ref|XP_009625976.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Nicotiana tomentosiformis]
 dbj|BAE53680.1| putative glycerophosphoryl diester phosphodiesterase family protein 
[Nicotiana tabacum]
 dbj|BAF34116.1| glycerophosphodiesterase-like protein [Nicotiana tabacum]
Length=752

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  409
            MW LRSI  LLLLC +   V+AQ S N+TSKW TL+GDAP VIARGGFSGL PDSSFNAY
Sbjct  1    MWNLRSISCLLLLCCSAAFVSAQRSDNATSKWLTLTGDAPKVIARGGFSGLMPDSSFNAY  60

Query  410  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  589
              A   S+ + + WCDVQLTKDGVGIC  DI+LDN+S+V  LFK+KQ+TYLVNGVP   W
Sbjct  61   ILAKAISVADWVAWCDVQLTKDGVGICLSDIRLDNSSDVNVLFKNKQNTYLVNGVPQKGW  120

Query  590  F  592
            F
Sbjct  121  F  121



>ref|XP_010324292.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Solanum 
lycopersicum]
Length=753

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  409
            M K+RS+  LL+LC +V  VAAQ S N TSKW+TLSGDAP VIARGGFSGL PDSSFNAY
Sbjct  1    MRKMRSVLCLLVLCCSVAFVAAQRSNNVTSKWKTLSGDAPKVIARGGFSGLLPDSSFNAY  60

Query  410  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  589
              A   S  + + WCDVQLTKDGVGICFPDIKL+NAS++ TL+ ++ + Y VNG+P T W
Sbjct  61   MLAQAISSADWVAWCDVQLTKDGVGICFPDIKLNNASDIDTLYPNRNNNYSVNGIPQTGW  120

Query  590  F  592
            F
Sbjct  121  F  121



>gb|KJB62955.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=760

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 98/125 (78%), Gaps = 5/125 (4%)
 Frame = +2

Query  230  MWKLR----SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  397
            M  LR    +IF +  L ++VTLV+AQGSTN  S+WQTLSG AP VIA GGFSG+F DSS
Sbjct  1    MGSLRGISVAIFVVQALLASVTLVSAQGSTNG-SRWQTLSGKAPSVIAHGGFSGIFADSS  59

Query  398  FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  577
            F AYS A LTSL +VI+WCDVQLT+DG GICFPD+KLDN S+VA ++KD+Q TYLVNGV 
Sbjct  60   FGAYSLALLTSLPDVILWCDVQLTRDGAGICFPDLKLDNNSDVAVVYKDRQKTYLVNGVS  119

Query  578  TTAWF  592
            T  WF
Sbjct  120  TKGWF  124



>emb|CAN61355.1| hypothetical protein VITISV_027762 [Vitis vinifera]
Length=642

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +2

Query  275  AVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  454
            +V LV+AQGSTN TS WQTL+G+APLVIARGGFSGLFPDSS  AYS A +TSL+NV++WC
Sbjct  15   SVALVSAQGSTNGTSSWQTLNGNAPLVIARGGFSGLFPDSSSAAYSLALMTSLSNVVLWC  74

Query  455  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DVQL+KDG GICFPD+KL+NAS+++ +FK++ + YLVNGV T  WF
Sbjct  75   DVQLSKDGAGICFPDMKLENASDISIVFKNRNNVYLVNGVSTPGWF  120



>ref|XP_006344880.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 92/121 (76%), Gaps = 1/121 (1%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  409
            MW LR +  L +L S  + V  Q   N+T+KW TL GDAPLVIARGGFSGL PDSS++AY
Sbjct  1    MWNLRRLSYLFVLLSCFS-VTTQALNNATTKWLTLHGDAPLVIARGGFSGLLPDSSYDAY  59

Query  410  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  589
              A  TSL N I+WCDVQLTKDGVGICFPD+KLDNAS++   FK+K+S YLVNGVPT  W
Sbjct  60   IMALETSLPNAIIWCDVQLTKDGVGICFPDLKLDNASDIDFYFKNKKSKYLVNGVPTQGW  119

Query  590  F  592
            F
Sbjct  120  F  120



>gb|KHG08046.1| putative glycerophosphoryl diester phosphodiesterase 2 -like 
protein [Gossypium arboreum]
Length=775

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 97/125 (78%), Gaps = 5/125 (4%)
 Frame = +2

Query  230  MWKLR----SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  397
            M  LR    +IF +  L ++VTLV+AQGSTN  S+WQTLSG AP VIA GGFSG+F DSS
Sbjct  1    MGSLRGISVAIFVVQALLASVTLVSAQGSTNG-SRWQTLSGKAPSVIAHGGFSGIFADSS  59

Query  398  FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  577
            F AYS A LTS  +VI+WCDVQLT+DG GICFPD+KLDN S+VA ++K++Q TYLVNGV 
Sbjct  60   FGAYSLALLTSPPDVILWCDVQLTRDGAGICFPDLKLDNNSDVAIVYKNRQKTYLVNGVS  119

Query  578  TTAWF  592
            T  WF
Sbjct  120  TKGWF  124



>gb|EYU33686.1| hypothetical protein MIMGU_mgv1a001772mg [Erythranthe guttata]
Length=761

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 92/124 (74%), Gaps = 3/124 (2%)
 Frame = +2

Query  230  MWKLRSIFNL---LLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  400
            M K R +F L   LLLCS+  LV+AQ S    S WQTLSG+APLVIARGGFSG+FPDSS 
Sbjct  1    MLKFRPVFCLFSFLLLCSSSVLVSAQRSRTRGSPWQTLSGNAPLVIARGGFSGIFPDSSL  60

Query  401  NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  580
             AYS A  T L N+  WCDVQLTKDG GICFPD++L+NAS++  ++K++Q TY VNGV T
Sbjct  61   YAYSLAVQTGLPNLHAWCDVQLTKDGAGICFPDLRLENASDIDNIYKNRQKTYDVNGVST  120

Query  581  TAWF  592
              WF
Sbjct  121  QGWF  124



>gb|KDO62176.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=667

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = +2

Query  269  CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIM  448
            C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS   +TS  +VI+
Sbjct  67   CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  125

Query  449  WCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            WCDVQLTKD  GICFPD+KLDNASN+A +FK +Q  YLVNGVPT  WF
Sbjct  126  WCDVQLTKDEAGICFPDLKLDNASNIAQIFKTQQKNYLVNGVPTPGWF  173



>ref|XP_006346174.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  409
            M K+RS+  LLLLC +   VAAQ S+N TSKW+TLSGDAP VIARGGFSGL PDSS+NAY
Sbjct  1    MRKMRSVLCLLLLCCSAAFVAAQRSSNVTSKWKTLSGDAPKVIARGGFSGLLPDSSYNAY  60

Query  410  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  589
              A   SL + + WCDVQLTKDGVGICFPDIKL+NAS++ TL+ ++ + Y VNG+P T W
Sbjct  61   LLAQAISLADWVAWCDVQLTKDGVGICFPDIKLNNASDIDTLYLNRNNNYSVNGIPQTGW  120

Query  590  F  592
            F
Sbjct  121  F  121



>gb|KDO62177.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
 gb|KDO62178.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=504

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = +2

Query  269  CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIM  448
            C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS   +TS  +VI+
Sbjct  67   CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  125

Query  449  WCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            WCDVQLTKD  GICFPD+KLDNASN+A +FK +Q  YLVNGVPT  WF
Sbjct  126  WCDVQLTKDEAGICFPDLKLDNASNIAQIFKTQQKNYLVNGVPTPGWF  173



>gb|KDO62175.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=733

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = +2

Query  269  CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIM  448
            C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS   +TS  +VI+
Sbjct  67   CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  125

Query  449  WCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            WCDVQLTKD  GICFPD+KLDNASN+A +FK +Q  YLVNGVPT  WF
Sbjct  126  WCDVQLTKDEAGICFPDLKLDNASNIAQIFKTQQKNYLVNGVPTPGWF  173



>ref|XP_011097815.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=760

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 96/124 (77%), Gaps = 3/124 (2%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAVTL---VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  400
            MWK+RS+  LL L          AAQGS   +SKWQTLSGDAPLVIARGGFSG+FPDSSF
Sbjct  1    MWKVRSVLGLLSLLLLSASVGLAAAQGSRGRSSKWQTLSGDAPLVIARGGFSGIFPDSSF  60

Query  401  NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  580
             AYS A  TSLTNV +WCDVQLTKDG GICFPDI+L+N+S++  ++K+ ++TY+VNGV T
Sbjct  61   YAYSLAVQTSLTNVHVWCDVQLTKDGAGICFPDIRLENSSDIDNVYKNGRNTYVVNGVST  120

Query  581  TAWF  592
              WF
Sbjct  121  QGWF  124



>ref|XP_006452490.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
 gb|ESR65730.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
Length=764

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = +2

Query  269  CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIM  448
            C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS   +TS  +VI+
Sbjct  20   CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  78

Query  449  WCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            WCDVQLTKD  GICFPD+KLDNASN+A +FK +Q  YLVNGVPT  WF
Sbjct  79   WCDVQLTKDEAGICFPDLKLDNASNIAQIFKTQQKNYLVNGVPTPGWF  126



>ref|XP_006474966.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Citrus sinensis]
Length=764

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = +2

Query  269  CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIM  448
            C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS   +TS  +VI+
Sbjct  20   CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  78

Query  449  WCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            WCDVQLTKD  GICFPD+KLDNASN+A +FK +Q  YLVNGVPT  WF
Sbjct  79   WCDVQLTKDEAGICFPDLKLDNASNIAQIFKTQQKNYLVNGVPTPGWF  126



>gb|KDO62174.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=811

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = +2

Query  269  CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIM  448
            C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS   +TS  +VI+
Sbjct  67   CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  125

Query  449  WCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            WCDVQLTKD  GICFPD+KLDNASN+A +FK +Q  YLVNGVPT  WF
Sbjct  126  WCDVQLTKDEAGICFPDLKLDNASNIAQIFKTQQKNYLVNGVPTPGWF  173



>ref|XP_009798152.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana sylvestris]
Length=391

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  409
            MW LRS+  LLLLC +VT VAAQ + + T+KW TL+GDAPLVIA GGFSGLFPDSS++AY
Sbjct  14   MWNLRSLSCLLLLCFSVTTVAAQRTNSETTKWLTLNGDAPLVIALGGFSGLFPDSSYDAY  73

Query  410  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  589
              A  TSL NVI WCDVQLTKDGVGIC PD+KLDNAS++   FK+K++ Y VNGVP   W
Sbjct  74   MVAMETSLANVIAWCDVQLTKDGVGICLPDLKLDNASDIDVYFKNKETKYSVNGVPMQGW  133

Query  590  F  592
            F
Sbjct  134  F  134



>gb|KHG12016.1| putative glycerophosphoryl diester phosphodiesterase 1 -like 
protein [Gossypium arboreum]
Length=762

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 95/125 (76%), Gaps = 5/125 (4%)
 Frame = +2

Query  230  MWKLR----SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  397
            M  LR    +IF +  L ++V LV+AQGS  + S+WQTLSG+AP+VIARGGFSG+F DSS
Sbjct  1    MGSLRGISIAIFVVQALLASVALVSAQGSA-TPSRWQTLSGEAPVVIARGGFSGIFSDSS  59

Query  398  FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  577
            F AYS A  T  ++VI+WCDVQLTKDG GICFPD+KLDN SN+AT+F DK  TYLVNGV 
Sbjct  60   FGAYSLALETGPSDVILWCDVQLTKDGAGICFPDLKLDNNSNIATIFSDKPVTYLVNGVS  119

Query  578  TTAWF  592
            T   F
Sbjct  120  TKGLF  124



>ref|XP_010270134.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Nelumbo 
nucifera]
Length=751

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = +2

Query  242  RSIFNLLLLCSAVTLVAAQGSTN-STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFA  418
            R +F LL+L SAV + + + STN STS W TL+G APLVIA+GGFSGLFPDSS+ AYS A
Sbjct  5    RPLFLLLVLHSAVLITSQRSSTNNSTSPWLTLNGKAPLVIAKGGFSGLFPDSSYAAYSLA  64

Query  419  GLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFP  595
             +TSL+NVI+WCDVQLTKD VGICFPD+KLDN+S++A +FK+  + YLVNG     +FP
Sbjct  65   NMTSLSNVILWCDVQLTKDAVGICFPDLKLDNSSDIANVFKN-STVYLVNGQLMKGYFP  122



>ref|XP_004251903.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Solanum lycopersicum]
Length=751

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 95/124 (77%), Gaps = 9/124 (7%)
 Frame = +2

Query  230  MWKLRSI---FNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  400
            MW LRS+   F +LL C +V   AAQG  N T KW TL+G+APLVIARGGFSGL PDSS+
Sbjct  1    MWNLRSLSWSF-VLLTCFSV---AAQG-VNRT-KWLTLNGNAPLVIARGGFSGLLPDSSY  54

Query  401  NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  580
            +AY     TSL N I+WCDVQLTKDGVGICFPD+KLDNAS++   FK+K+S YLVNGVPT
Sbjct  55   DAYIMGLETSLPNAIIWCDVQLTKDGVGICFPDLKLDNASDIDFYFKNKKSKYLVNGVPT  114

Query  581  TAWF  592
              WF
Sbjct  115  QGWF  118



>ref|XP_007020654.1| PLC-like phosphodiesterase family protein, putative isoform 3 
[Theobroma cacao]
 gb|EOY12179.1| PLC-like phosphodiesterase family protein, putative isoform 3 
[Theobroma cacao]
Length=514

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 92/125 (74%), Gaps = 5/125 (4%)
 Frame = +2

Query  230  MWKLRSIFNLLL----LCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  397
            M  LR I   +L    L ++V LV+AQGS+N  S+WQTL+GD P VIARGGFSG+F DSS
Sbjct  1    MGSLRGITVAVLVVQALLASVALVSAQGSSNR-SRWQTLNGDVPFVIARGGFSGMFSDSS  59

Query  398  FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  577
              AY  A LT  TNVI+WCDVQL+KD  GICFPD+KLDN S++ T+F +KQ TYLVNGV 
Sbjct  60   PAAYRLALLTGPTNVILWCDVQLSKDAAGICFPDLKLDNNSDITTVFPNKQKTYLVNGVA  119

Query  578  TTAWF  592
            T  WF
Sbjct  120  TKGWF  124



>ref|XP_007020652.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY12177.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
Length=760

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 91/125 (73%), Gaps = 5/125 (4%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSA----VTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  397
            M  LR I   +L+  A    V LV+AQGS+N  S+WQTL+GD P VIARGGFSG+F DSS
Sbjct  1    MGSLRGITVAVLVVQALLASVALVSAQGSSNR-SRWQTLNGDVPFVIARGGFSGMFSDSS  59

Query  398  FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  577
              AY  A LT  TNVI+WCDVQL+KD  GICFPD+KLDN S++ T+F +KQ TYLVNGV 
Sbjct  60   PAAYRLALLTGPTNVILWCDVQLSKDAAGICFPDLKLDNNSDITTVFPNKQKTYLVNGVA  119

Query  578  TTAWF  592
            T  WF
Sbjct  120  TKGWF  124



>ref|XP_007020653.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
 gb|EOY12178.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
Length=758

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 91/125 (73%), Gaps = 5/125 (4%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSA----VTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  397
            M  LR I   +L+  A    V LV+AQGS+N  S+WQTL+GD P VIARGGFSG+F DSS
Sbjct  1    MGSLRGITVAVLVVQALLASVALVSAQGSSNR-SRWQTLNGDVPFVIARGGFSGMFSDSS  59

Query  398  FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  577
              AY  A LT  TNVI+WCDVQL+KD  GICFPD+KLDN S++ T+F +KQ TYLVNGV 
Sbjct  60   PAAYRLALLTGPTNVILWCDVQLSKDAAGICFPDLKLDNNSDITTVFPNKQKTYLVNGVA  119

Query  578  TTAWF  592
            T  WF
Sbjct  120  TKGWF  124



>gb|KJB13801.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=686

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 94/125 (75%), Gaps = 5/125 (4%)
 Frame = +2

Query  230  MWKLR----SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  397
            M  LR    +IF +  L ++V LV+AQGS  + S+WQTLSG+AP+VIARGGFSG+F DSS
Sbjct  1    MGSLRGISIAIFVVQALLASVALVSAQGSA-TPSRWQTLSGEAPVVIARGGFSGIFSDSS  59

Query  398  FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  577
            F AYS A  T  ++VI+WCDVQLT DG GICFPD+KLDN S +AT+F DK +TYLVNGV 
Sbjct  60   FGAYSLALETGPSDVILWCDVQLTNDGAGICFPDLKLDNNSKIATVFTDKPTTYLVNGVS  119

Query  578  TTAWF  592
            T   F
Sbjct  120  TKGLF  124



>gb|KJB13800.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=691

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 94/125 (75%), Gaps = 5/125 (4%)
 Frame = +2

Query  230  MWKLR----SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  397
            M  LR    +IF +  L ++V LV+AQGS  + S+WQTLSG+AP+VIARGGFSG+F DSS
Sbjct  1    MGSLRGISIAIFVVQALLASVALVSAQGSA-TPSRWQTLSGEAPVVIARGGFSGIFSDSS  59

Query  398  FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  577
            F AYS A  T  ++VI+WCDVQLT DG GICFPD+KLDN S +AT+F DK +TYLVNGV 
Sbjct  60   FGAYSLALETGPSDVILWCDVQLTNDGAGICFPDLKLDNNSKIATVFTDKPTTYLVNGVS  119

Query  578  TTAWF  592
            T   F
Sbjct  120  TKGLF  124



>ref|XP_009105134.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=756

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 85/114 (75%), Gaps = 3/114 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQG-STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            +LLC  V   L A Q  +  S+S WQTLSGDAPLVIARGGFSGLFPDSSFNAY FA  TS
Sbjct  6    VLLCCVVLIQLFAGQADAQRSSSPWQTLSGDAPLVIARGGFSGLFPDSSFNAYDFAKQTS  65

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            +    +WCDVQLTKDG GICFPD+KL+NAS V  ++ ++Q TY VNGV T  WF
Sbjct  66   VAGAALWCDVQLTKDGAGICFPDLKLNNASTVEDVYPNRQKTYSVNGVSTQGWF  119



>ref|XP_010536709.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=752

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            LLLC  V   L+AAQ  +  S S WQTL+GDAPLVIARGGFSG+ PDSS +AY  A   S
Sbjct  9    LLLCGVVLIQLLAAQVDAQRSRSPWQTLAGDAPLVIARGGFSGVLPDSSVDAYGLAVQVS  68

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            +T+V++WCDVQLTKDG+GICFPD+ L NASN+  ++  +Q++YLVNGVPT  WF
Sbjct  69   VTDVVLWCDVQLTKDGIGICFPDVNLGNASNIGDVYPKQQNSYLVNGVPTQGWF  122



>ref|XP_009108190.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=758

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 84/113 (74%), Gaps = 2/113 (2%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  433
            +LLC  V   L A Q    S+S WQTLSGDAPLVIARGGFSGLFPDSS NAYSFA  TS+
Sbjct  6    VLLCCVVLIQLFAGQTDARSSSPWQTLSGDAPLVIARGGFSGLFPDSSLNAYSFAVQTSV  65

Query  434  TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
                +WCDVQLTKDG GICFPD+KL+NAS V  ++ ++Q +Y VNGV T  WF
Sbjct  66   PGSALWCDVQLTKDGAGICFPDLKLNNASTVEYVYPNRQKSYPVNGVSTQGWF  118



>gb|KJB13799.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=762

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 94/125 (75%), Gaps = 5/125 (4%)
 Frame = +2

Query  230  MWKLR----SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  397
            M  LR    +IF +  L ++V LV+AQGS  + S+WQTLSG+AP+VIARGGFSG+F DSS
Sbjct  1    MGSLRGISIAIFVVQALLASVALVSAQGSA-TPSRWQTLSGEAPVVIARGGFSGIFSDSS  59

Query  398  FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  577
            F AYS A  T  ++VI+WCDVQLT DG GICFPD+KLDN S +AT+F DK +TYLVNGV 
Sbjct  60   FGAYSLALETGPSDVILWCDVQLTNDGAGICFPDLKLDNNSKIATVFTDKPTTYLVNGVS  119

Query  578  TTAWF  592
            T   F
Sbjct  120  TKGLF  124



>ref|XP_006401453.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
 gb|ESQ42906.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
Length=768

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 84/104 (81%), Gaps = 3/104 (3%)
 Frame = +2

Query  281  TLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDV  460
            T +AAQ    S S WQTLSGDAPL+IARGGFSGL PDSS +AYSF  +TS+ + ++WCDV
Sbjct  31   TQLAAQ---RSKSPWQTLSGDAPLIIARGGFSGLLPDSSLDAYSFVSMTSVPDAVLWCDV  87

Query  461  QLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            QLTKDGVGICFPD+K+ NASN+   + D++++YL+NGVPT  WF
Sbjct  88   QLTKDGVGICFPDVKMMNASNIQVAYPDRKNSYLLNGVPTQDWF  131



>ref|XP_010545263.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=764

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 87/115 (76%), Gaps = 4/115 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ--GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  427
            LLLC  V   L+AAQ     +  S WQTL+GDAPLVIARGGFSGL PDSS +AY  A  T
Sbjct  18   LLLCGVVLMQLLAAQVDAQRSGRSPWQTLTGDAPLVIARGGFSGLLPDSSIDAYGLALQT  77

Query  428  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            S+++V++WCDVQLTKDGVGICFPD+ L NASN+  ++   QS+Y+VNGVPT  WF
Sbjct  78   SVSDVVLWCDVQLTKDGVGICFPDVNLRNASNIDVVYPKGQSSYIVNGVPTQGWF  132



>ref|XP_011095489.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
 ref|XP_011095490.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=767

 Score =   149 bits (376),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 87/121 (72%), Gaps = 0/121 (0%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  409
            MW+ R +F L++LC     VAAQG+     +WQTLSG+APLVIARGGFSG+FP SS  AY
Sbjct  1    MWRFRDVFLLIMLCLLAVSVAAQGTRRGGRQWQTLSGNAPLVIARGGFSGVFPYSSGYAY  60

Query  410  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  589
              A LT L N+ +WCDVQLTKDG GICFPDI+L NAS++  ++ +K +TY ++G     W
Sbjct  61   ELALLTGLPNLHIWCDVQLTKDGAGICFPDIRLQNASDIKYVYGNKSNTYTIDGKQEQGW  120

Query  590  F  592
            F
Sbjct  121  F  121



>ref|XP_002888565.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64824.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=708

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 84/115 (73%), Gaps = 3/115 (3%)
 Frame = +2

Query  260  LLLCSAVTL---VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            LL C  V +   VA   +  STS+WQTL+GDAPLVIARGGFSGLFPDSS  AY FA   S
Sbjct  18   LLFCGVVLIQLFVAQIDAQRSTSRWQTLNGDAPLVIARGGFSGLFPDSSLAAYQFAMQAS  77

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFP  595
            L +VI+WCDVQLTKD VGICFPD+ L NASN+  ++  ++ +Y VNGV T  WFP
Sbjct  78   LADVILWCDVQLTKDEVGICFPDLNLANASNIQDVYSTRRKSYRVNGVTTQGWFP  132



>gb|AAF98210.1|AC007152_6 Unknown protein [Arabidopsis thaliana]
Length=1111

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 85/114 (75%), Gaps = 3/114 (3%)
 Frame = +2

Query  263  LLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  433
            LLC  V   L AAQ  +  STS WQTLSGDAPLVIARGGFSGLFPDSS  AY FA + S+
Sbjct  9    LLCGVVLLQLFAAQVDAQRSTSPWQTLSGDAPLVIARGGFSGLFPDSSLAAYQFAMVVSV  68

Query  434  TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFP  595
             +V++WCDVQLTKDG GICFPD+ L NASN   ++ ++Q +Y VNGV T  WFP
Sbjct  69   ADVVLWCDVQLTKDGHGICFPDLNLANASNSEEVYPNRQKSYPVNGVTTKGWFP  122



>ref|NP_176870.2| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
 sp|D7SFH9.1|GPDL2_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase protein 
kinase domain-containing GDPDL2; AltName: Full=Glycerophosphodiester 
phosphodiesterase-like 2; Short=ATGDPDL2; AltName: 
Full=Protein SUPPRESSOR OF NPR1-1 CONSTITUTIVE 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ADI71282.1| SNC4 [Arabidopsis thaliana]
 gb|AEE34581.1| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
Length=1118

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 85/114 (75%), Gaps = 3/114 (3%)
 Frame = +2

Query  263  LLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  433
            LLC  V   L AAQ  +  STS WQTLSGDAPLVIARGGFSGLFPDSS  AY FA + S+
Sbjct  20   LLCGVVLLQLFAAQVDAQRSTSPWQTLSGDAPLVIARGGFSGLFPDSSLAAYQFAMVVSV  79

Query  434  TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFP  595
             +V++WCDVQLTKDG GICFPD+ L NASN   ++ ++Q +Y VNGV T  WFP
Sbjct  80   ADVVLWCDVQLTKDGHGICFPDLNLANASNSEEVYPNRQKSYPVNGVTTKGWFP  133



>gb|KHM99500.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 96/126 (76%), Gaps = 7/126 (6%)
 Frame = +2

Query  230  MWKLRSI---FNLL--LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDS  394
            MWK R++   F+LL  L  S + LV+AQGS  +T  W TL+G  PLVIARGGFSG+FPDS
Sbjct  1    MWKPRAVPRAFSLLHLLFHSVLVLVSAQGSNRTT--WNTLTGSPPLVIARGGFSGIFPDS  58

Query  395  SFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGV  574
            S  AY+ A +TSL N+I+WCDVQLTKDG GIC P+IKL+NA+N+  +F+++  TY VNGV
Sbjct  59   SEFAYNLAAVTSLKNLIVWCDVQLTKDGEGICIPNIKLENATNIDNVFQNRSKTYSVNGV  118

Query  575  PTTAWF  592
             T+A+F
Sbjct  119  QTSAYF  124



>ref|XP_003530777.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Glycine max]
Length=761

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 96/126 (76%), Gaps = 7/126 (6%)
 Frame = +2

Query  230  MWKLRSI---FNLL--LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDS  394
            MWK R++   F+LL  L  S + LV+AQGS  +T  W TL+G  PLVIARGGFSG+FPDS
Sbjct  1    MWKPRAVPRAFSLLHLLFHSVLVLVSAQGSNRTT--WNTLTGSPPLVIARGGFSGIFPDS  58

Query  395  SFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGV  574
            S  AY+ A +TSL N+I+WCDVQLTKDG GIC P+IKL+NA+N+  +F+++  TY VNGV
Sbjct  59   SEFAYNLAAVTSLKNLIVWCDVQLTKDGEGICIPNIKLENATNIDNVFQNRSKTYSVNGV  118

Query  575  PTTAWF  592
             T+A+F
Sbjct  119  QTSAYF  124



>ref|XP_008447692.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
 ref|XP_008447693.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
Length=764

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 93/116 (80%), Gaps = 2/116 (2%)
 Frame = +2

Query  248  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  427
            IF  L L S + LV+AQGS NST+ WQTLSGDAP V+ARGGFSGLFPDSS  AY+FA + 
Sbjct  10   IFFSLFLHSFLALVSAQGS-NSTALWQTLSGDAPFVVARGGFSGLFPDSSGVAYNFAVMV  68

Query  428  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA-TLFKDKQSTYLVNGVPTTAWF  592
            S+ +VI+WCDVQLTKDGVGIC PD++LDNA++   TL K++ S+YLVNGV T+  F
Sbjct  69   SVPDVILWCDVQLTKDGVGICLPDLRLDNATDAPTTLGKNRTSSYLVNGVRTSGLF  124



>ref|XP_010470590.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=136

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 84/115 (73%), Gaps = 3/115 (3%)
 Frame = +2

Query  257  LLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  427
            ++L C  V   L AAQ  +  STS+WQTLSGDAP VIARGGFSGL PDSS +AY+ A  T
Sbjct  1    MILFCGVVMIQLFAAQIDAERSTSRWQTLSGDAPRVIARGGFSGLLPDSSIDAYNLAIQT  60

Query  428  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            S+ +V++WCDVQLTKDG GICFPD+ L NAS V  ++ + Q +Y +NGV T  WF
Sbjct  61   SVADVVLWCDVQLTKDGFGICFPDLNLANASTVQFVYPNGQKSYPINGVTTQGWF  115



>emb|CDY60410.1| BnaC02g45300D [Brassica napus]
Length=136

 Score =   137 bits (344),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = +2

Query  278  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  454
            + L AAQ  +  S S WQTLSGDAPLVIARGGFSGLFPDSS +AY+ A  TS+   ++WC
Sbjct  14   IQLFAAQIDAKRSKSPWQTLSGDAPLVIARGGFSGLFPDSSIDAYNNAMQTSVAGAVLWC  73

Query  455  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DVQLTKDG GICFPD+KL+NAS++  ++ ++Q +Y VNGV    WF
Sbjct  74   DVQLTKDGHGICFPDLKLNNASSIGYVYPNRQKSYPVNGVTIQGWF  119



>ref|XP_002529027.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
 gb|EEF33338.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
Length=768

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 92/125 (74%), Gaps = 7/125 (6%)
 Frame = +2

Query  230  MWKLRSI----FNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  397
            MW  RS+       +LL S  +LV+AQGS  S   W+TLSG+ PLVIARGGFSG+FPDSS
Sbjct  11   MWSRRSVSCVVAAFVLLNSLASLVSAQGSGTS---WKTLSGNPPLVIARGGFSGIFPDSS  67

Query  398  FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  577
              AY  A +T + ++I+WCDVQLTKDGVGIC PD++LDN+++++ +FK+K   YLVNG P
Sbjct  68   SAAYQLALITGVPDLILWCDVQLTKDGVGICAPDLRLDNSTDISLVFKNKDKNYLVNGAP  127

Query  578  TTAWF  592
            T  WF
Sbjct  128  TQGWF  132



>emb|CDY14478.1| BnaC03g21170D [Brassica napus]
Length=1314

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 83/115 (72%), Gaps = 3/115 (3%)
 Frame = +2

Query  257  LLLLCSAVTLVAAQGSTN---STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  427
            + LLC  V +    G T+   S   WQTLSGDAPLVIARGGFSGLFPDSS  AYSF   T
Sbjct  44   MFLLCGVVLIQLFAGQTDAQRSRGPWQTLSGDAPLVIARGGFSGLFPDSSLKAYSFVKQT  103

Query  428  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            S+    +WCDVQLTKDG GICFPD+KL+NAS +  ++ +++ +YLVNGVPT  WF
Sbjct  104  SVAGAALWCDVQLTKDGAGICFPDLKLNNASTIDFVYPNRKKSYLVNGVPTQGWF  158



>gb|KDP39221.1| hypothetical protein JCGZ_00978 [Jatropha curcas]
Length=767

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 96/124 (77%), Gaps = 6/124 (5%)
 Frame = +2

Query  230  MWKLRSIFNLL---LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  400
            M + R+  +LL   +L   ++ V+A+GSTN   +WQTLSG+ PLV+ARGGFSG+FPDSS 
Sbjct  1    MCRPRAFASLLAGFILLHLLSFVSAKGSTN---RWQTLSGNPPLVVARGGFSGIFPDSSS  57

Query  401  NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  580
             AY  A  TS+ +V++WCDVQLTKDGVGIC PD++L+N+++++  FK+++STY+VNGV T
Sbjct  58   YAYQLALATSVPDVVLWCDVQLTKDGVGICAPDVRLENSTDISLFFKNRESTYIVNGVST  117

Query  581  TAWF  592
              WF
Sbjct  118  KGWF  121



>gb|AAP40466.1| unknown protein [Arabidopsis thaliana]
Length=763

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 87/115 (76%), Gaps = 3/115 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            LL C  V   L AAQ  +  STS+WQTL+GDAPLVIARGGFSGL+PDSS  AY  A LTS
Sbjct  18   LLFCGVVLIHLFAAQIDAQRSTSRWQTLNGDAPLVIARGGFSGLYPDSSIAAYQLATLTS  77

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFP  595
            + +V++WCD+QLTKDG+GICFPD+ L NAS +  ++ +++ +Y VNGV T  WFP
Sbjct  78   VADVVLWCDLQLTKDGLGICFPDLNLANASTIDRVYPNREKSYSVNGVTTKGWFP  132



>emb|CDY61647.1| BnaCnng38120D [Brassica napus]
Length=755

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 84/114 (74%), Gaps = 3/114 (3%)
 Frame = +2

Query  260  LLLCSAVTLVAAQGSTN---STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            +LLC  V +    G T+   S+S+WQTLSGDAPLVIARGGFSGLFPDSS  AY FA  TS
Sbjct  6    VLLCCVVLIQLFAGQTDAQRSSSRWQTLSGDAPLVIARGGFSGLFPDSSSIAYGFAKQTS  65

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            +    +WCDVQLTKDG GICFPD+KL+NAS V  ++ ++Q TY VNGV T  WF
Sbjct  66   VAGAALWCDVQLTKDGAGICFPDLKLNNASTVEDVYPNRQKTYSVNGVSTQGWF  119



>ref|NP_176869.2| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 sp|Q7Y208.2|GPDL1_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL1; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
1; Short=ATGDPDL1; AltName: Full=Glycerophosphodiesterase-like 
3; AltName: Full=Protein SHV3-LIKE 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF98209.1|AC007152_5 Unknown protein [Arabidopsis thaliana]
 gb|AEE34579.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=763

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 87/115 (76%), Gaps = 3/115 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            LL C  V   L AAQ  +  STS+WQTL+GDAPLVIARGGFSGL+PDSS  AY  A LTS
Sbjct  18   LLFCGVVLIHLFAAQIDAQRSTSRWQTLNGDAPLVIARGGFSGLYPDSSIAAYQLATLTS  77

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFP  595
            + +V++WCD+QLTKDG+GICFPD+ L NAS +  ++ +++ +Y VNGV T  WFP
Sbjct  78   VADVVLWCDLQLTKDGLGICFPDLNLANASTIDRVYPNREKSYSVNGVTTKGWFP  132



>ref|XP_002867546.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43805.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
Length=756

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 87/114 (76%), Gaps = 3/114 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            LLLC  V   L AAQ  +    S W TL+GD P VIARGGFSGLFPDSS++AY+FA LTS
Sbjct  9    LLLCGVVLIQLFAAQINAQKPKSPWPTLTGDPPFVIARGGFSGLFPDSSYDAYNFAMLTS  68

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            +++V++WCDVQLTKD +GICFPD+ + NAS++  ++  +Q +Y VNGVPT+ WF
Sbjct  69   VSDVVLWCDVQLTKDALGICFPDLTMSNASSIEVVYPTRQKSYPVNGVPTSGWF  122



>ref|XP_010511612.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=761

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 88/117 (75%), Gaps = 9/117 (8%)
 Frame = +2

Query  260  LLLCSAV------TLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  421
            LL C  V      T + A+GST   S+WQTLSGDAPLVIARGGFSGL PDSS  AY+ A 
Sbjct  18   LLFCGVVMIQLFATQIDAEGST---SRWQTLSGDAPLVIARGGFSGLLPDSSLVAYNLAT  74

Query  422  LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            LTS+T+V++WCDVQLTKDG GICFPD+ + NASN+  ++ +++++Y VNGV T  WF
Sbjct  75   LTSVTSVVLWCDVQLTKDGAGICFPDLNMANASNIDVVYPNRKNSYPVNGVTTQGWF  131



>ref|XP_010422831.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=146

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 80/114 (70%), Gaps = 3/114 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
             L C  V   L AAQ  +  S S+WQTLSGDAP VIARGGFSGL PDSS +AY+ A  TS
Sbjct  16   FLFCGVVLINLFAAQIDAQRSRSRWQTLSGDAPRVIARGGFSGLLPDSSVDAYNLATQTS  75

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            +  V++WCDVQLTKDGVGICFPD+ L NAS V   + + Q +Y VNGV T  WF
Sbjct  76   VAEVVLWCDVQLTKDGVGICFPDLNLANASTVQYAYPNGQKSYPVNGVTTQGWF  129



>ref|XP_006300773.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
 gb|EOA33671.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
Length=766

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +2

Query  311  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  490
            STS WQTLSGDAPLVIARGGFSGLFPDSS +AY+FA LTS+ +V++WCDVQLTKDGVGIC
Sbjct  43   STSPWQTLSGDAPLVIARGGFSGLFPDSSSDAYNFAILTSVADVVLWCDVQLTKDGVGIC  102

Query  491  FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            FPD+ L NAS +  ++ + Q +Y+VNGV T  WF
Sbjct  103  FPDLNLANASIIKYIYPNGQKSYMVNGVTTQGWF  136



>ref|XP_011013351.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%), Gaps = 3/101 (3%)
 Frame = +2

Query  290  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  469
            +AQGS    S WQTL+G+ PLVIARGGFSGLFPDSS  A+ FA LTSL +V++WCDVQLT
Sbjct  25   SAQGSA---STWQTLTGNPPLVIARGGFSGLFPDSSSAAFQFAPLTSLPDVVLWCDVQLT  81

Query  470  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            KDGVGIC PD++LDN++++A + K+K   YLVNGVPT  WF
Sbjct  82   KDGVGICAPDLRLDNSTSIAQVMKNKDKLYLVNGVPTRGWF  122



>ref|XP_010433460.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Camelina 
sativa]
Length=661

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 87/114 (76%), Gaps = 3/114 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            LLLC  V   L+A+Q  +  S S W TL+G+ PLVIARGGFSGLFPDSS++AY+FA LTS
Sbjct  9    LLLCGVVLIQLLASQIHAQRSKSPWPTLTGNPPLVIARGGFSGLFPDSSYDAYNFAMLTS  68

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            + + ++WCDVQLTKD +GICFPD+ + NASN+  + K++  +Y VNGVPT  WF
Sbjct  69   VPDAVLWCDVQLTKDALGICFPDLTMSNASNIEAVLKNRLKSYSVNGVPTQGWF  122



>ref|XP_002300353.2| glycerophosphoryl diester phosphodiesterase family protein, partial 
[Populus trichocarpa]
 gb|EEE85158.2| glycerophosphoryl diester phosphodiesterase family protein, partial 
[Populus trichocarpa]
Length=495

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 82/101 (81%), Gaps = 3/101 (3%)
 Frame = +2

Query  290  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  469
            +AQGS    S WQTL+G+ PLVIARGGFSGLFPDSS  A+ FA LTSL +V++WCDVQLT
Sbjct  25   SAQGSA---STWQTLTGNRPLVIARGGFSGLFPDSSSVAFQFATLTSLPDVVLWCDVQLT  81

Query  470  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            KDGVGIC PD++LDN++++A + K+K   YLVNG+PT  WF
Sbjct  82   KDGVGICAPDLRLDNSTSIAQVMKNKDKLYLVNGIPTRGWF  122



>emb|CDP13760.1| unnamed protein product [Coffea canephora]
Length=745

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +2

Query  311  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  490
            ST KWQTLSG APL IARGGFSGLFPDSS+NAY  A  TSL+++++WCDVQLTKD  GIC
Sbjct  26   STRKWQTLSGSAPLAIARGGFSGLFPDSSYNAYVLAVGTSLSDLVLWCDVQLTKDAAGIC  85

Query  491  FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            FPD+KLDNAS+V  +F ++ STY+V+GV T  WF
Sbjct  86   FPDLKLDNASDVNVVFNNRASTYIVSGVSTRGWF  119



>ref|XP_009127509.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=136

 Score =   134 bits (337),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = +2

Query  278  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  454
            + L AAQ  +  S S WQT SGDAPLVIARGGFSGLFPDSS +AY+FA  TS+   ++ C
Sbjct  14   IQLFAAQIDAKGSKSPWQTFSGDAPLVIARGGFSGLFPDSSIDAYNFAMQTSVAGAVLCC  73

Query  455  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DVQLTKDG G+ FPD+KL+NASN+  ++ ++Q +Y VNGV T  WF
Sbjct  74   DVQLTKDGHGVSFPDLKLNNASNIGDIYPNRQKSYPVNGVTTHGWF  119



>emb|CDY12601.1| BnaA02g12690D [Brassica napus]
Length=136

 Score =   134 bits (337),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = +2

Query  278  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  454
            + L AAQ  +  S S WQT SGDAPLVIARGGFSGLFPDSS +AY+FA  TS+   ++ C
Sbjct  14   IQLFAAQIDAKGSKSPWQTFSGDAPLVIARGGFSGLFPDSSIDAYNFAMQTSVAGAVLCC  73

Query  455  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DVQLTKDG G+ FPD+KL+NASN+  ++ ++Q +Y VNGV T  WF
Sbjct  74   DVQLTKDGHGVSFPDLKLNNASNIGDIYPNRQKSYPVNGVTTQGWF  119



>ref|XP_011014752.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014753.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%), Gaps = 3/101 (3%)
 Frame = +2

Query  290  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  469
            +AQGS    S WQTL+G+ PLVIARGGFSGLFPDSS  A+ FA LTSL +V++WCDVQLT
Sbjct  25   SAQGSA---STWQTLTGNPPLVIARGGFSGLFPDSSSVAFQFATLTSLPDVVLWCDVQLT  81

Query  470  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            KDGVGIC PD++LDN++++A + K+K   YLVNGVPT  WF
Sbjct  82   KDGVGICAPDLRLDNSTSIAQVMKNKDKLYLVNGVPTRGWF  122



>emb|CDX94294.1| BnaC01g18900D [Brassica napus]
Length=757

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 85/114 (75%), Gaps = 3/114 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            LLLC  V   L+A Q  +    + W+TLSG +P VIARGGFSGLFPDSS +AY+FA LTS
Sbjct  9    LLLCGVVLIQLLAVQIDAQRPKTHWKTLSGFSPRVIARGGFSGLFPDSSLDAYNFAMLTS  68

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            + + ++WCD+QLTKDG GICFPD+ + NASNV T++   QSTY VNGVPT  WF
Sbjct  69   VADAVLWCDLQLTKDGAGICFPDLTMSNASNVETVYPKGQSTYPVNGVPTPGWF  122



>ref|XP_011014930.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014931.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%), Gaps = 3/101 (3%)
 Frame = +2

Query  290  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  469
            +AQGS    S WQTL+G+ PLVIARGGFSGLFPDSS  A+ FA LTSL +V++WCDVQLT
Sbjct  25   SAQGSA---STWQTLTGNPPLVIARGGFSGLFPDSSSVAFQFATLTSLPDVVLWCDVQLT  81

Query  470  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            KDGVGIC PD++LDN++++A + K+K   YLVNGVPT  WF
Sbjct  82   KDGVGICAPDLRLDNSTSIAQVMKNKDKLYLVNGVPTRGWF  122



>ref|NP_567755.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
 sp|Q9SZ11.3|GPDL3_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL3; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
3; Short=ATGDPDL3; AltName: Full=Glycerophosphodiesterase-like 
2; AltName: Full=Protein MUTANT ROOT HAIR 5; AltName: Full=Protein 
SHAVEN 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE85238.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
Length=759

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 87/116 (75%), Gaps = 5/116 (4%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ---GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  424
            LLLC  +   L+AAQ    S    S W TL+GD PLVIARGGFSGLFPDSS++AY+FA L
Sbjct  10   LLLCGVILIQLLAAQIHAQSKKPKSPWPTLTGDPPLVIARGGFSGLFPDSSYDAYNFAIL  69

Query  425  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            TS+ + ++WCDVQLTKD +GICFPD+ + N+S++  ++  +Q +Y VNGVPT+ WF
Sbjct  70   TSVPDAVLWCDVQLTKDALGICFPDLTMRNSSSIEAVYPTRQKSYPVNGVPTSGWF  125



>ref|XP_008227060.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=755

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +2

Query  272  SAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMW  451
            S V LV+A+GS NSTS+WQTLSGDAPLVIARGGFSGLFP  S  A++ A +TS+ +V++W
Sbjct  16   SVVALVSAKGS-NSTSQWQTLSGDAPLVIARGGFSGLFPGFSTAAFNLALVTSVPDVVLW  74

Query  452  CDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            CDVQLT+DG GICFPD+ L+N S++  +F  K  TYLVNGV T  WF
Sbjct  75   CDVQLTRDGAGICFPDLLLNNNSDIEAVFPKKDKTYLVNGVSTRGWF  121



>gb|AAL07129.1| unknown protein [Arabidopsis thaliana]
Length=759

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 87/116 (75%), Gaps = 5/116 (4%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ---GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  424
            LLLC  +   L+AAQ    S    S W TL+GD PLVIARGGFSGLFPDSS++AY+FA L
Sbjct  10   LLLCGVILIQLLAAQIHAQSKKPKSPWPTLTGDPPLVIARGGFSGLFPDSSYDAYNFAIL  69

Query  425  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            TS+ + ++WCDVQLTKD +GICFPD+ + N+S++  ++  +Q +Y VNGVPT+ WF
Sbjct  70   TSVPDAVLWCDVQLTKDALGICFPDLTMRNSSSIEAVYPTRQKSYPVNGVPTSGWF  125



>emb|CAB36515.1| putative protein [Arabidopsis thaliana]
 emb|CAB79524.1| putative protein [Arabidopsis thaliana]
Length=770

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 87/116 (75%), Gaps = 5/116 (4%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ---GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  424
            LLLC  +   L+AAQ    S    S W TL+GD PLVIARGGFSGLFPDSS++AY+FA L
Sbjct  21   LLLCGVILIQLLAAQIHAQSKKPKSPWPTLTGDPPLVIARGGFSGLFPDSSYDAYNFAIL  80

Query  425  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            TS+ + ++WCDVQLTKD +GICFPD+ + N+S++  ++  +Q +Y VNGVPT+ WF
Sbjct  81   TSVPDAVLWCDVQLTKDALGICFPDLTMRNSSSIEAVYPTRQKSYPVNGVPTSGWF  136



>gb|KFK29182.1| hypothetical protein AALP_AA7G100300 [Arabis alpina]
Length=758

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 87/124 (70%), Gaps = 5/124 (4%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  400
            M  LRS  + L+LC  V   L ++Q  +  S S WQTL GDAPLVIARGGFSGLFPDSS 
Sbjct  1    MRGLRS--SSLILCGFVLIQLFSSQIDAQRSKSPWQTLLGDAPLVIARGGFSGLFPDSSL  58

Query  401  NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  580
            +AYSFA  TS+   ++WCDVQLTKDG GICFPD+ + NAS +   +  +Q TY VNGVPT
Sbjct  59   DAYSFAMQTSVAGAVLWCDVQLTKDGAGICFPDLTMSNASTIDVAYPTRQKTYTVNGVPT  118

Query  581  TAWF  592
              WF
Sbjct  119  QNWF  122



>ref|XP_010099974.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
 gb|EXB81079.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
Length=748

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 80/101 (79%), Gaps = 1/101 (1%)
 Frame = +2

Query  290  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  469
            +AQGS  S + WQTLSG APL IARGGFSGLFPDSS+ AYSFA +TSL  V++WCDVQLT
Sbjct  21   SAQGS-GSKTPWQTLSGGAPLAIARGGFSGLFPDSSYAAYSFAIMTSLPEVVLWCDVQLT  79

Query  470  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            KD  GIC PDIKLDN++++A +F ++   Y++NGV T  WF
Sbjct  80   KDSKGICLPDIKLDNSTDIADVFNNRDKEYVINGVATKGWF  120



>ref|XP_010449676.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Camelina sativa]
 ref|XP_010449685.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Camelina sativa]
Length=767

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +2

Query  302  STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGV  481
            +  S S WQTLSGDAP +IARGGFSGL PDSS +AYSF G TS+ + ++WCD+QLTKD +
Sbjct  36   AQRSKSPWQTLSGDAPRIIARGGFSGLLPDSSLDAYSFVGQTSVPDAVLWCDLQLTKDAI  95

Query  482  GICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            GICFPD+K+ NASN+  ++  ++++YL+NGVPT  WF
Sbjct  96   GICFPDVKMMNASNIQVVYPKRKNSYLLNGVPTQDWF  132



>emb|CDY71959.1| BnaCnng75290D, partial [Brassica napus]
Length=328

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 84/112 (75%), Gaps = 3/112 (3%)
 Frame = +2

Query  257  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  436
            L+L+    T + AQ    S S WQTL+G APL+IARGGFSGL PDSS +AYS    TS++
Sbjct  24   LILIQLLPTQLLAQ---RSKSPWQTLTGSAPLIIARGGFSGLLPDSSVDAYSIVSQTSVS  80

Query  437  NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            + ++WCDVQLTKDGVGICFPD+K+ NAS++   +  ++++YLVNGVPT  WF
Sbjct  81   DAVLWCDVQLTKDGVGICFPDVKMMNASSIQDAYSKRKNSYLVNGVPTQDWF  132



>ref|XP_009127510.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=749

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 88/116 (76%), Gaps = 5/116 (4%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            +LL S V   L AAQ  + +S S WQTLSGDAPLVIARGGFSGLFPDSS  AY FA  TS
Sbjct  6    VLLSSVVLIQLFAAQIDAKSSRSPWQTLSGDAPLVIARGGFSGLFPDSSSVAYKFAKQTS  65

Query  431  L--TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            +  T+ ++WCDVQLTKDG GICFPD+KL+NASN+  LF ++Q+ Y VNGV +  WF
Sbjct  66   VAGTSSVLWCDVQLTKDGHGICFPDLKLNNASNIGDLFPNRQNFYPVNGVTSQGWF  121



>emb|CDY13237.1| BnaC09g24190D [Brassica napus]
Length=759

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 80/113 (71%), Gaps = 2/113 (2%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  433
            +LLC  V   L A Q    S+S WQTLSG APLVIARGGFSGLFPDSS  AY FA  TS+
Sbjct  6    VLLCCVVLIQLFAGQTDARSSSPWQTLSGGAPLVIARGGFSGLFPDSSSAAYGFAVQTSV  65

Query  434  TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
               ++WCDVQLTKDG  ICFPD+KL+NAS V   + ++Q +Y VNGV T  WF
Sbjct  66   PGAVLWCDVQLTKDGAAICFPDLKLNNASTVEYFYPNRQKSYPVNGVSTQGWF  118



>gb|KFK27133.1| hypothetical protein AALP_AA8G339300 [Arabis alpina]
Length=764

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 87/115 (76%), Gaps = 3/115 (3%)
 Frame = +2

Query  248  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  427
            +F L+L+    T + AQ    S S WQTL+GDAPLVIARGGFSGL PDSS +AYSF   T
Sbjct  17   LFALILIHLLPTQLFAQ---RSKSPWQTLTGDAPLVIARGGFSGLLPDSSLDAYSFVSQT  73

Query  428  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            S+++ ++WCDVQLTKDG+GICFPD+ + NASN+   + +++++YLVNGV T  WF
Sbjct  74   SVSDAVLWCDVQLTKDGIGICFPDLTMMNASNIQDAYPNRKNSYLVNGVTTQDWF  128



>ref|XP_006413151.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
 gb|ESQ54604.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
Length=757

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 86/114 (75%), Gaps = 3/114 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            LLLC  V   L+AAQ  +  S S W TL+GD P VIARGGFSGLFPDSS +AY FA +TS
Sbjct  9    LLLCGVVLIQLLAAQIDAQKSKSPWLTLTGDFPRVIARGGFSGLFPDSSLDAYKFAMITS  68

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            + +V++WCD+QLTKDG GICFP + + NAS++  ++ ++Q +YLVNGVPT  WF
Sbjct  69   VPDVVLWCDLQLTKDGAGICFPGLTMSNASSINGVYPNRQKSYLVNGVPTQGWF  122



>ref|XP_010438711.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 86/114 (75%), Gaps = 3/114 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            LLLC  V   L+A+Q  +  S S W TL+G+APLVIARGGFSGLFPDSS++AY+FA LTS
Sbjct  9    LLLCGVVLIQLLASQIHAQRSKSPWPTLTGEAPLVIARGGFSGLFPDSSYDAYNFAMLTS  68

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            + + ++WCDVQLTKD  GICFPD+ + NASN+  + K++  +Y VNGVPT   F
Sbjct  69   VPDAVLWCDVQLTKDAFGICFPDLTMSNASNIEAVHKNRLKSYSVNGVPTQGRF  122



>ref|XP_009132384.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=766

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  311  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  490
            S S WQTL+G+APLVIARGGFSGLFPDSSFNAYSF   TS  + ++WCDVQLTKDGVGIC
Sbjct  40   SKSPWQTLTGEAPLVIARGGFSGLFPDSSFNAYSFVASTSAPDAVLWCDVQLTKDGVGIC  99

Query  491  FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            FP + + N SNV   +  K+++YL+NGVPT  WF
Sbjct  100  FPYVTMYNDSNVQEAYPKKKNSYLLNGVPTQDWF  133



>emb|CDY36746.1| BnaA03g11400D [Brassica napus]
Length=766

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +2

Query  308  NSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGI  487
             S S WQTL+G+APLVIARGGFSGLFPDSSFNAYSF   TS  + ++WCDVQLTKDGVGI
Sbjct  39   RSKSPWQTLTGEAPLVIARGGFSGLFPDSSFNAYSFVASTSAPDAVLWCDVQLTKDGVGI  98

Query  488  CFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            CFP + + N SNV   +  K+++YL+NGVPT  WF
Sbjct  99   CFPYVTMYNDSNVQDAYPKKKNSYLLNGVPTQDWF  133



>ref|XP_006391459.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
 gb|ESQ28745.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
Length=763

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            +LLC  V   L AAQ     S S WQTLSGDAPLVIARGGFSGLFPDSS  AYSFA  TS
Sbjct  15   VLLCGIVLAHLFAAQIDGQRSRSPWQTLSGDAPLVIARGGFSGLFPDSSLAAYSFAMQTS  74

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            +    +WCDVQLTKDG+GICFPD+ L+NAS +  ++  +Q +Y VNGV T  WF
Sbjct  75   VAGSALWCDVQLTKDGLGICFPDLTLNNASTIEFVYPSRQKSYPVNGVRTRGWF  128



>ref|XP_010511610.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
GDPDL1-like [Camelina sativa]
Length=764

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 84/114 (74%), Gaps = 3/114 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            LL CS V   L AAQ  +  S S+WQTLSGDAPLVIARGGFSGL PDSS +AY+ A  TS
Sbjct  16   LLFCSVVLIQLFAAQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSLDAYNLAIQTS  75

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            +  V++WCDVQLTKDG GICFP++ + NASN+  ++ + Q +Y VNGV T  WF
Sbjct  76   VAEVVLWCDVQLTKDGAGICFPELNMANASNIDFVYPNGQKSYPVNGVTTQGWF  129



>ref|XP_007020655.1| SHV3-like 2, putative isoform 4, partial [Theobroma cacao]
 gb|EOY12180.1| SHV3-like 2, putative isoform 4, partial [Theobroma cacao]
Length=559

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S+WQTL+GD P VIARGGFSG+F DSS  AY  A LT  TNVI+WCDVQL+KD  GICFP
Sbjct  1    SRWQTLNGDVPFVIARGGFSGMFSDSSPAAYRLALLTGPTNVILWCDVQLSKDAAGICFP  60

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            D+KLDN S++ T+F +KQ TYLVNGV T  WF
Sbjct  61   DLKLDNNSDITTVFPNKQKTYLVNGVATKGWF  92



>ref|NP_200359.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
 sp|Q9FJ62.1|GPDL4_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL4; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
4; Short=ATGDPDL4; AltName: Full=Glycerophosphodiesterase-like 
1; AltName: Full=Protein SHV3-LIKE 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08565.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU94382.1| At5g55480 [Arabidopsis thaliana]
 gb|AAV59273.1| At5g55480 [Arabidopsis thaliana]
 gb|AED96633.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
Length=766

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +2

Query  308  NSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGI  487
             S S WQTL+GDAPLVIARGGFSGL PDSS +AYSF   TS+   ++WCDVQLTKD +G+
Sbjct  37   RSKSPWQTLTGDAPLVIARGGFSGLLPDSSLDAYSFVSQTSVPGAVLWCDVQLTKDAIGL  96

Query  488  CFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            CFPD+K+ NASN+  ++  ++++YL+NGVPT  WF
Sbjct  97   CFPDVKMMNASNIQDVYPKRKTSYLLNGVPTQDWF  131



>ref|XP_010448228.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 87/114 (76%), Gaps = 3/114 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            LLLC  V   L+++Q  +  S S W TL+G+APLVIARGGFSGLFPDSS++AY+FA LTS
Sbjct  9    LLLCGVVLIQLLSSQIHAQRSKSPWPTLTGEAPLVIARGGFSGLFPDSSYDAYNFAMLTS  68

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            + + ++WCDVQLTKD +GICFPD+ + NASN+  + K++  +Y VNGVPT   F
Sbjct  69   VPDAVLWCDVQLTKDALGICFPDLTMSNASNIEVVHKNQLKSYSVNGVPTQGLF  122



>ref|XP_007214645.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
 gb|EMJ15844.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
Length=756

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 83/107 (78%), Gaps = 1/107 (1%)
 Frame = +2

Query  272  SAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMW  451
            S V LV+A+GS NSTS+W+TLSGDAPLVIARGGFSGLFP  S  A+S A +TS+ +V++W
Sbjct  16   SVVALVSAKGS-NSTSQWKTLSGDAPLVIARGGFSGLFPGFSSAAFSLALITSVPDVVLW  74

Query  452  CDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            CDVQLTKD  GICFPDI L+N S+V  +F  K  TYLVNG  T  WF
Sbjct  75   CDVQLTKDEAGICFPDILLNNNSDVQDVFAKKDKTYLVNGASTHGWF  121



>ref|XP_009361078.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 82/111 (74%), Gaps = 4/111 (4%)
 Frame = +2

Query  260  LLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTN  439
            LLL S V LV+AQGS    SKW+TLSGD P V+ARGGFSGLFP  S  A++ A LTSL +
Sbjct  12   LLLHSVVALVSAQGS----SKWKTLSGDPPKVVARGGFSGLFPGYSSAAFNLALLTSLQD  67

Query  440  VIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
             ++WCDVQLTKDG GICFPD+ L+N SN+  +   +  +YLVNGVPT  WF
Sbjct  68   AVLWCDVQLTKDGAGICFPDLLLNNNSNIDMVLPKRDKSYLVNGVPTKGWF  118



>emb|CDX89312.1| BnaA01g15810D [Brassica napus]
Length=757

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 85/114 (75%), Gaps = 3/114 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            LLLC  V   L+A Q  +    ++W+TLSG +P VIARGGFSGLFPDSS +AY+FA  TS
Sbjct  9    LLLCGVVLIQLLAVQIDAQRPKTQWKTLSGFSPRVIARGGFSGLFPDSSLDAYNFAMQTS  68

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            + + ++WCD+QLTKDG GICFPD+ + NASNV +++   QSTY VNGVPT  WF
Sbjct  69   VLDAVLWCDLQLTKDGAGICFPDLTMSNASNVESVYPKGQSTYPVNGVPTPGWF  122



>ref|XP_009142640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=757

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 85/114 (75%), Gaps = 3/114 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            LLLC  V   L+A Q  +    ++W+TLSG +P VIARGGFSGLFPDSS +AY+FA  TS
Sbjct  9    LLLCGVVLIQLLAVQIDAQRPKTQWKTLSGFSPRVIARGGFSGLFPDSSLDAYNFAMQTS  68

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            + + ++WCD+QLTKDG GICFPD+ + NASNV +++   QSTY VNGVPT  WF
Sbjct  69   VLDAVLWCDLQLTKDGAGICFPDLTMSNASNVESVYPKGQSTYPVNGVPTPGWF  122



>ref|XP_002300351.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
 gb|EEE85156.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
Length=754

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 81/101 (80%), Gaps = 3/101 (3%)
 Frame = +2

Query  290  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  469
            +AQGS  +   WQTL+G+ PLVIARGGFSGLFPDSS +A+ FA LTSL  V++WCDVQLT
Sbjct  25   SAQGSATT---WQTLTGNPPLVIARGGFSGLFPDSSSDAFQFATLTSLPGVVLWCDVQLT  81

Query  470  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            KD VGIC PD++LDN++++A + ++K   YLVNG+PT  WF
Sbjct  82   KDSVGICAPDLRLDNSTSIAQVMQNKDKLYLVNGIPTRGWF  122



>ref|XP_002888566.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64825.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=1089

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = +2

Query  278  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  454
            + L AAQ  +  STS WQTLSG+APLVIARGGFSGLFPDSS  A+ FA   S+  VI+WC
Sbjct  8    LQLFAAQINAQRSTSTWQTLSGEAPLVIARGGFSGLFPDSSLAAFQFAMQASVDEVILWC  67

Query  455  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFP  595
            DVQLTKD VGICFPD+ L NASN+  ++  ++ +Y VNGV T  WFP
Sbjct  68   DVQLTKDEVGICFPDLNLANASNIQDVYSTRRKSYPVNGVTTQGWFP  114



>ref|XP_010470589.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=765

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 89/124 (72%), Gaps = 5/124 (4%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  400
            M  LRS  + +LLCS V   L A Q  +  S S+WQTLSGDAPLVIARGGFSGL PDSS 
Sbjct  14   MLLLRS--STILLCSVVLIQLFAPQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSL  71

Query  401  NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  580
            +AY+ A  TS+ +VI+WCDV LTKDG+GICFP++ L NAS +  ++ + Q +Y VNGV T
Sbjct  72   DAYNLAIQTSVADVILWCDVHLTKDGIGICFPNLNLANASTIQYVYPNGQKSYPVNGVIT  131

Query  581  TAWF  592
              WF
Sbjct  132  QGWF  135



>ref|XP_006283180.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
 gb|EOA16078.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
Length=757

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 84/114 (74%), Gaps = 3/114 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            LLLC  V   L+A+   +  S S W TL+GDAPLVIARGGFSGLFPDSS++AY+FA LTS
Sbjct  10   LLLCVVVLIQLLASHIHAQRSKSPWPTLTGDAPLVIARGGFSGLFPDSSYDAYNFAMLTS  69

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            + +  +WCDVQLTKD +GICFPD+ + NAS +  ++   Q +Y VNGVPT  WF
Sbjct  70   VPDAALWCDVQLTKDALGICFPDLNMANASTIDGVYPKGQKSYSVNGVPTQGWF  123



>emb|CDY46687.1| BnaA03g48210D [Brassica napus]
Length=717

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +2

Query  278  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  454
            + L+AAQ  +  S SKWQTL+G +P VIARGGFSGLFPDSS +AY+FA LTS+ +V++WC
Sbjct  13   IQLLAAQTDAQGSKSKWQTLTGFSPRVIARGGFSGLFPDSSIDAYNFAMLTSVEDVVLWC  72

Query  455  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            D+QLTKDG GICFP + + NASN+   + ++ +TYLVNGV T  WF
Sbjct  73   DLQLTKDGAGICFPGLTMSNASNIEAAYPNRTNTYLVNGVSTQGWF  118



>ref|XP_009137609.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=759

 Score =   139 bits (349),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +2

Query  278  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  454
            + L+AAQ  +  S SKWQTL+G +P VIARGGFSGLFPDSS +AY+FA LTS+ +V++WC
Sbjct  13   IQLLAAQTDAQGSKSKWQTLTGFSPRVIARGGFSGLFPDSSIDAYNFAMLTSVEDVVLWC  72

Query  455  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            D+QLTKDG GICFP + + NASN+   + ++ +TYLVNGV T  WF
Sbjct  73   DLQLTKDGAGICFPGLTMSNASNIEAAYPNRTNTYLVNGVSTQGWF  118



>ref|XP_010443178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Camelina sativa]
Length=767

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +2

Query  308  NSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGI  487
             S S WQTL+GDAP +IARGGFSGL PDSS +AYSF G TS+ + ++WCD+QLTK+ +GI
Sbjct  38   RSKSPWQTLTGDAPRIIARGGFSGLLPDSSLDAYSFVGQTSVPDAVLWCDLQLTKEAIGI  97

Query  488  CFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            CFPD+K+ NASN+  ++  + ++YL+NGVPT  WF
Sbjct  98   CFPDVKMMNASNIQEVYPKRTNSYLLNGVPTQDWF  132



>ref|XP_010482994.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Camelina 
sativa]
Length=769

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  311  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  490
            S S WQTL+GDAP +IARGGFSGL PDSS +AYSF G TS+ + ++WCD+QLTKD  GIC
Sbjct  41   SKSPWQTLTGDAPRIIARGGFSGLLPDSSLDAYSFVGQTSVPDAVLWCDLQLTKDAFGIC  100

Query  491  FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            FPD+K+ NASN+  ++  + ++YL+NGVPT  WF
Sbjct  101  FPDVKMMNASNIQEVYPKRTNSYLLNGVPTQDWF  134



>ref|XP_009137635.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=1321

 Score =   139 bits (351),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 81/114 (71%), Gaps = 3/114 (3%)
 Frame = +2

Query  260  LLLCSAVTLVAAQGSTNST---SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            +LLC  V +      T++    S W+TLSGDAP VI+RGGFSGLFPDSS +AY+FA  TS
Sbjct  6    VLLCGVVLIHVFASQTDAQRPRSPWKTLSGDAPRVISRGGFSGLFPDSSLDAYNFALQTS  65

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            + + I+WCDVQLTKDG GICFPD+ + NAS +  ++   Q TY VNGVPT  WF
Sbjct  66   VADAILWCDVQLTKDGAGICFPDLNMSNASTIEVVYPKGQKTYPVNGVPTQGWF  119



>emb|CDX92806.1| BnaC07g40640D [Brassica napus]
Length=716

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = +2

Query  278  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  454
            + L+A Q  +  S SKWQTL+G +P VIARGGFSGLFPDSS +AY+FA LTS+ +V++WC
Sbjct  13   IQLLAVQTDAQRSKSKWQTLTGFSPRVIARGGFSGLFPDSSIDAYNFAMLTSVEDVVLWC  72

Query  455  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            D+QLTKDG GICFP + + NASN+   + ++ +TYLVNGV T  WF
Sbjct  73   DLQLTKDGAGICFPGLTMSNASNIEAAYPNRTNTYLVNGVSTQGWF  118



>ref|XP_009588257.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana tomentosiformis]
Length=741

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  332  LSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLD  511
             +GDAPLVIARGGFSGLFPDSS++AY  A  TSL NVI WCDVQLTKDGVGIC PD+KLD
Sbjct  23   FAGDAPLVIARGGFSGLFPDSSYDAYMVAMETSLANVIAWCDVQLTKDGVGICLPDLKLD  82

Query  512  NASNVATLFKDKQSTYLVNGVPTTAWF  592
            NAS++   FK+K+S Y VNGVP   WF
Sbjct  83   NASDIDVYFKNKKSKYSVNGVPMQGWF  109



>ref|XP_006300798.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33696.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=678

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 89/125 (71%), Gaps = 7/125 (6%)
 Frame = +2

Query  239  LRSI---FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  400
            LR +   ++ +LLC  V   L +AQ  +  S S+WQTLSGDAPLVIARGGFSGL PDSS 
Sbjct  9    LREVVMRYSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSL  68

Query  401  NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD-KQSTYLVNGVP  577
            +AYS A  TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ + K  +Y VNGV 
Sbjct  69   DAYSLATQTSVADVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPNHKPKSYPVNGVT  128

Query  578  TTAWF  592
               WF
Sbjct  129  RQGWF  133



>ref|XP_006300799.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33697.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=701

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 89/125 (71%), Gaps = 7/125 (6%)
 Frame = +2

Query  239  LRSI---FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  400
            LR +   ++ +LLC  V   L +AQ  +  S S+WQTLSGDAPLVIARGGFSGL PDSS 
Sbjct  9    LREVVMRYSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSL  68

Query  401  NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD-KQSTYLVNGVP  577
            +AYS A  TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ + K  +Y VNGV 
Sbjct  69   DAYSLATQTSVADVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPNHKPKSYPVNGVT  128

Query  578  TTAWF  592
               WF
Sbjct  129  RQGWF  133



>ref|XP_006300797.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33695.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=704

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 89/125 (71%), Gaps = 7/125 (6%)
 Frame = +2

Query  239  LRSI---FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  400
            LR +   ++ +LLC  V   L +AQ  +  S S+WQTLSGDAPLVIARGGFSGL PDSS 
Sbjct  9    LREVVMRYSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSL  68

Query  401  NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD-KQSTYLVNGVP  577
            +AYS A  TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ + K  +Y VNGV 
Sbjct  69   DAYSLATQTSVADVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPNHKPKSYPVNGVT  128

Query  578  TTAWF  592
               WF
Sbjct  129  RQGWF  133



>ref|XP_009120058.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=768

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 83/112 (74%), Gaps = 3/112 (3%)
 Frame = +2

Query  257  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  436
            L+L+    T + AQ    S S WQTL+G APL+IARGGFSGL PDSS +AYS    TS++
Sbjct  24   LILIHLLPTQLLAQ---RSKSPWQTLTGSAPLIIARGGFSGLLPDSSVDAYSIVSQTSVS  80

Query  437  NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
              ++WCDVQLTKDGVGICFPD+K+ NAS++   +  ++++YLVNGVPT  WF
Sbjct  81   GAVLWCDVQLTKDGVGICFPDVKMMNASSIQDAYPKRKNSYLVNGVPTQDWF  132



>emb|CDY17323.1| BnaA10g09570D [Brassica napus]
Length=768

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 83/112 (74%), Gaps = 3/112 (3%)
 Frame = +2

Query  257  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  436
            L+L+    T + AQ    S S WQTL+G APL+IARGGFSGL PDSS +AYS    TS++
Sbjct  24   LILIQLLPTQLLAQ---RSKSPWQTLTGSAPLIIARGGFSGLLPDSSVDAYSIVSQTSVS  80

Query  437  NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
              ++WCDVQLTKDGVGICFPD+K+ NAS++   +  ++++YLVNGVPT  WF
Sbjct  81   GAVLWCDVQLTKDGVGICFPDVKMMNASSIQDAYPKRKNSYLVNGVPTQDWF  132



>emb|CDY12600.1| BnaA02g12680D [Brassica napus]
Length=831

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = +2

Query  278  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  454
            + L AAQ  +  S S WQTLSGDAPLVIA GGFSGLFPDS  +AY  A  TS+   ++WC
Sbjct  622  IQLFAAQTNAKRSRSPWQTLSGDAPLVIASGGFSGLFPDSILDAYKLAMQTSVPGAVLWC  681

Query  455  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DVQLTKD  GIC+PD+KL+N S + +++  ++ +YLVNGVPT  WF
Sbjct  682  DVQLTKDDFGICYPDLKLNNHSTIESVYPKRRKSYLVNGVPTNGWF  727



>ref|XP_010511611.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
protein kinase domain-containing GDPDL2-like [Camelina 
sativa]
Length=1150

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = +2

Query  278  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  454
            + L A Q  +  S S+WQTLSG+APLVI RGGFSGL PDSS +AY+ A  TS+ +V++WC
Sbjct  49   IQLFAPQIDAQRSRSRWQTLSGEAPLVIDRGGFSGLLPDSSLDAYNLAIQTSVADVVLWC  108

Query  455  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DVQLTKDGVGICFPD+ L NASN+  ++ + Q +Y VNGV T  WF
Sbjct  109  DVQLTKDGVGICFPDLNLFNASNIEDVYPNGQKSYPVNGVTTQGWF  154



>ref|XP_010675854.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=764

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = +2

Query  245  SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  424
            S+  +++        +AQ +T S S W TL+G  PLVIA+GGFSGLFPDSS NAY FA +
Sbjct  20   SLIVIIVFLQFFAFASAQQAT-SNSPWLTLNGSPPLVIAKGGFSGLFPDSSANAYQFATM  78

Query  425  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFP  595
             S+ +V++WCDVQLT+DGVGICFP++KLDN+S +  +F +  ++Y VNGVPT  +FP
Sbjct  79   VSVPDVVLWCDVQLTRDGVGICFPNLKLDNSSGIEHVFPNGSNSYDVNGVPTDGFFP  135



>ref|XP_009127505.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=1313

 Score =   136 bits (343),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = +2

Query  278  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  454
            + L AAQ  +  S S WQTLSGDAPLVIA GGFSGLFPDS  +AY  A  TS+   ++WC
Sbjct  14   IQLFAAQTNAKRSRSPWQTLSGDAPLVIASGGFSGLFPDSILDAYKLAMQTSVPGAVLWC  73

Query  455  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DVQLTKD  GIC+PD+KL+N S + +++  ++ +YLVNGVPT  WF
Sbjct  74   DVQLTKDDFGICYPDLKLNNHSTIESVYPKRRKSYLVNGVPTNGWF  119



>ref|XP_010253010.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Nelumbo nucifera]
Length=734

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 88/112 (79%), Gaps = 4/112 (4%)
 Frame = +2

Query  257  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  436
            LL +  +V LV A  S NS+S W TL+G+APLVIARGGF G+FPDSSF +Y  A  TSL+
Sbjct  9    LLFVLHSVGLVVA--SRNSSS-WLTLTGNAPLVIARGGFPGIFPDSSFASYQLALNTSLS  65

Query  437  NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            NVI+WCDVQLTKDG GICFP+IKL+N+S+++++F++ +  YLVNG  T  WF
Sbjct  66   NVILWCDVQLTKDGAGICFPNIKLENSSDISSVFRNSR-IYLVNGQSTRGWF  116



>ref|XP_006279181.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12079.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=677

 Score =   134 bits (338),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 85/118 (72%), Gaps = 4/118 (3%)
 Frame = +2

Query  251  FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  421
            ++ +LLC  V   L +AQ  +  S S+WQTLSGD PLVIARGGFSGL PDSS +AY FA 
Sbjct  16   YSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDPPLVIARGGFSGLLPDSSIDAYGFAI  75

Query  422  LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD-KQSTYLVNGVPTTAWF  592
             TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ + K  +Y VNGV    WF
Sbjct  76   QTSVDDVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPNHKPKSYPVNGVTRQGWF  133



>emb|CDY60415.1| BnaC02g45340D [Brassica napus]
Length=1186

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = +2

Query  278  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  454
            + L AAQ  +  S S WQTLSGDAPLVIA GGFSGLFPDS  +AY  A  TS+   ++WC
Sbjct  14   IQLFAAQTNAKRSRSPWQTLSGDAPLVIASGGFSGLFPDSILDAYKLAMQTSVPGAVLWC  73

Query  455  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DVQLTKD  G+C+PD+KL+N S + +++  ++ +YLVNGVPT  WF
Sbjct  74   DVQLTKDDFGMCYPDLKLNNHSTIESVYPKRRKSYLVNGVPTNGWF  119



>ref|XP_006279182.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12080.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=760

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 85/118 (72%), Gaps = 4/118 (3%)
 Frame = +2

Query  251  FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  421
            ++ +LLC  V   L +AQ  +  S S+WQTLSGD PLVIARGGFSGL PDSS +AY FA 
Sbjct  16   YSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDPPLVIARGGFSGLLPDSSIDAYGFAI  75

Query  422  LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD-KQSTYLVNGVPTTAWF  592
             TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ + K  +Y VNGV    WF
Sbjct  76   QTSVDDVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPNHKPKSYPVNGVTRQGWF  133



>ref|XP_006280048.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12946.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=767

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +2

Query  302  STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGV  481
            +  S S WQTL+GDAPL++ARGGFSGLFPDSS ++YSF   TS+   ++WCD+QLTKD +
Sbjct  36   AQRSKSPWQTLTGDAPLIVARGGFSGLFPDSSLDSYSFVAQTSVQGTVLWCDLQLTKDAI  95

Query  482  GICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            GICFPD+K+ NASN+  +F  ++++YL++GV T  WF
Sbjct  96   GICFPDVKMMNASNIQVVFPKQKNSYLLDGVLTQDWF  132



>gb|AFW58563.1| hypothetical protein ZEAMMB73_741781 [Zea mays]
Length=178

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = +2

Query  299  GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDG  478
             +    S W+TLSG AP ++A+GGFSGLFPDSS  AY FA L S  + I++CDV+LTKD 
Sbjct  21   AAAQKASSWKTLSGKAPAIVAKGGFSGLFPDSSEYAYQFALLASSPDTILYCDVRLTKDE  80

Query  479  VGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            +GIC PDIK+DN +N+   +   Q +YLVNGVPT+ WF
Sbjct  81   IGICLPDIKMDNCTNIPDFYAQGQKSYLVNGVPTSGWF  118



>emb|CDX92782.1| BnaC07g40400D [Brassica napus]
Length=1322

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 80/114 (70%), Gaps = 3/114 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            + LC  V   L A+Q  +    S W+TLSGDAP VI+RGGFSGLFPDSS +AY FA  TS
Sbjct  6    VFLCGVVLIHLFASQTDAQRPRSPWKTLSGDAPRVISRGGFSGLFPDSSLDAYIFALQTS  65

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            + + ++WCDVQLTKDG GICFPD+ + NAS +  ++   Q TY VNGVPT  WF
Sbjct  66   VADAVLWCDVQLTKDGAGICFPDLNMSNASIIEVVYPKGQKTYPVNGVPTQGWF  119



>gb|EYU27402.1| hypothetical protein MIMGU_mgv1a001806mg [Erythranthe guttata]
Length=757

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 84/121 (69%), Gaps = 1/121 (1%)
 Frame = +2

Query  233  WKLRSIFNLLLLCSAVTLVAAQGSTNSTS-KWQTLSGDAPLVIARGGFSGLFPDSSFNAY  409
            W   ++     LCS+  +VA +  ++S   KWQTL+G+ PLVIA+GGFSG+FPDSS NAY
Sbjct  5    WHFCTLILFFWLCSSPPVVAGRRGSSSGGGKWQTLTGNPPLVIAKGGFSGIFPDSSLNAY  64

Query  410  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  589
              A  T L N + WC+V LTKDG GICFP+++L+NASN+  ++ DK +TY VNGV    W
Sbjct  65   RLAVETGLRNSLAWCEVYLTKDGAGICFPELRLENASNIGEVYGDKHNTYTVNGVSVEGW  124

Query  590  F  592
            F
Sbjct  125  F  125



>ref|XP_007146559.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
 gb|ESW18553.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
Length=765

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = +2

Query  272  SAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMW  451
            S + LV+AQGS  +T+ W TLSG  PLVIARGGFSG++PDSS  AYS A  TSL NVI+W
Sbjct  22   SVLPLVSAQGS--NTTSWNTLSGSPPLVIARGGFSGIYPDSSDIAYSLAAQTSLANVILW  79

Query  452  CDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            CDVQLTKD  GIC PDIKL+NA+++  + + K  TY VNGV T+ +F
Sbjct  80   CDVQLTKDREGICIPDIKLENATDIGHVSEFKSKTYSVNGVQTSGYF  126



>ref|XP_003579951.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Brachypodium distachyon]
Length=744

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 83/117 (71%), Gaps = 12/117 (10%)
 Frame = +2

Query  266  LCSAVT--------LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  421
            +CSAV         + AAQG+    S W+TLSGDAP +IA+GGFSGLFPDSS  AY FA 
Sbjct  7    VCSAVASFVLLWLGVAAAQGA----SSWKTLSGDAPAIIAKGGFSGLFPDSSEFAYQFAL  62

Query  422  LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            + S  + I++CDV+LTKDG+G+C PDIKLDN +N+   + D + +YLVNGV TT WF
Sbjct  63   IASSPDTILYCDVRLTKDGLGVCLPDIKLDNCTNIPEFYADGKKSYLVNGVSTTGWF  119



>ref|XP_010496108.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=764

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 81/114 (71%), Gaps = 3/114 (3%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
            LL C  V   L A Q  +  S S+WQTL+G+ P VIARGGFSGL PDSS +AY+ A  TS
Sbjct  16   LLFCGVVLIHLFATQIDAQRSRSRWQTLTGEVPRVIARGGFSGLLPDSSLDAYNLAIQTS  75

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            + +V++WCDVQLTKDGVGIC+PD+ L NAS V  ++ + Q +Y VNGV T  WF
Sbjct  76   VADVVLWCDVQLTKDGVGICYPDLNLANASTVQFVYPNGQKSYPVNGVTTQGWF  129



>ref|NP_001185333.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 gb|AEE34580.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=785

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 87/137 (64%), Gaps = 25/137 (18%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSG----------------------DAPLVIAR  364
            LL C  V   L AAQ  +  STS+WQTL+G                      DAPLVIAR
Sbjct  18   LLFCGVVLIHLFAAQIDAQRSTSRWQTLNGESCSHFISFFCALFPRKQENLCDAPLVIAR  77

Query  365  GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  544
            GGFSGL+PDSS  AY  A LTS+ +V++WCD+QLTKDG+GICFPD+ L NAS +  ++ +
Sbjct  78   GGFSGLYPDSSIAAYQLATLTSVADVVLWCDLQLTKDGLGICFPDLNLANASTIDRVYPN  137

Query  545  KQSTYLVNGVPTTAWFP  595
            ++ +Y VNGV T  WFP
Sbjct  138  REKSYSVNGVTTKGWFP  154



>ref|XP_007146552.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
 gb|ESW18546.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
Length=714

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 82/112 (73%), Gaps = 3/112 (3%)
 Frame = +2

Query  257  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  436
            L+L  S V LV++ G     S W+TL G  PLVIARGGFSG+FPDSS  AY+ A  TS  
Sbjct  14   LILQYSLVALVSSAGPP---SGWKTLQGSPPLVIARGGFSGIFPDSSSLAYNLALNTSSP  70

Query  437  NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            NVI+WCDVQLTKDG GICFP++KLDNA++++ +++ K   + V+GVPT  WF
Sbjct  71   NVILWCDVQLTKDGTGICFPELKLDNATDISVVYQGKAKDHFVSGVPTRGWF  122



>emb|CDY11996.1| BnaC03g14220D [Brassica napus]
Length=773

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 85/122 (70%), Gaps = 1/122 (1%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAVTLVAAQG-STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  406
            M+  R+   +L +   + L+  Q  +  S S WQTL+G+APL+IARGGFSG+FPDSSFNA
Sbjct  12   MFGFRASKFILSVLVLIQLLPTQLLAQRSKSPWQTLTGEAPLIIARGGFSGMFPDSSFNA  71

Query  407  YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  586
            YSF   TS  + ++WCDVQLTKDGVGICFP + + N SNV   +   +++YL+NGV T  
Sbjct  72   YSFVASTSAPDAVLWCDVQLTKDGVGICFPYVTMYNDSNVRDAYPKNKNSYLLNGVLTQD  131

Query  587  WF  592
            WF
Sbjct  132  WF  133



>ref|XP_010913178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 isoform 
X2 [Elaeis guineensis]
Length=674

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 85/120 (71%), Gaps = 2/120 (2%)
 Frame = +2

Query  233  WKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYS  412
            W++  +    L    + LV AQG TNS S+WQTLSG+AP +IA+GGFSGLFPDSS  A+ 
Sbjct  8    WEVSFLVAFFLAVQHLGLVTAQG-TNS-SRWQTLSGNAPAIIAKGGFSGLFPDSSAYAFQ  65

Query  413  FAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            FA   S ++ I+WCDVQLT D VGIC PDIKL+N +N+A+++  ++  Y VNGV T  WF
Sbjct  66   FALAISSSDTILWCDVQLTMDKVGICVPDIKLNNCTNIASVYPSREKVYDVNGVRTPGWF  125



>ref|XP_010496109.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Camelina sativa]
Length=1128

 Score =   133 bits (335),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = +2

Query  278  VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  454
            + L A Q  +  S S+WQTLSG+AP VIARGGFSGL PDSS +AY+ A  TS+ +V++WC
Sbjct  30   IQLFAPQIDAQRSRSRWQTLSGEAPRVIARGGFSGLLPDSSIDAYNLAIQTSVADVVLWC  89

Query  455  DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DVQLTKDGVGICFPD+ L NAS V  ++ + Q++Y V+GV T  WF
Sbjct  90   DVQLTKDGVGICFPDLNLANASTVQFVYTNGQNSYPVHGVTTQGWF  135



>ref|XP_010913177.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 isoform 
X1 [Elaeis guineensis]
Length=759

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 85/120 (71%), Gaps = 2/120 (2%)
 Frame = +2

Query  233  WKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYS  412
            W++  +    L    + LV AQG TNS S+WQTLSG+AP +IA+GGFSGLFPDSS  A+ 
Sbjct  8    WEVSFLVAFFLAVQHLGLVTAQG-TNS-SRWQTLSGNAPAIIAKGGFSGLFPDSSAYAFQ  65

Query  413  FAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            FA   S ++ I+WCDVQLT D VGIC PDIKL+N +N+A+++  ++  Y VNGV T  WF
Sbjct  66   FALAISSSDTILWCDVQLTMDKVGICVPDIKLNNCTNIASVYPSREKVYDVNGVRTPGWF  125



>ref|XP_002864395.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH40654.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=757

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +2

Query  308  NSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGI  487
             S S WQTL+GDAP +IARGGFSGL PDSS +AYSF   TS+   ++WCDVQLTKD +GI
Sbjct  28   RSKSPWQTLTGDAPRIIARGGFSGLLPDSSIDAYSFVSQTSVPGTLLWCDVQLTKDAIGI  87

Query  488  CFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            CFPD+K+ NAS++  ++  ++++YL+NGV T  WF
Sbjct  88   CFPDVKMMNASHIQDVYPKRKNSYLLNGVLTQDWF  122



>ref|XP_004294052.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=753

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 88/123 (72%), Gaps = 6/123 (5%)
 Frame = +2

Query  230  MWKLRSIFNLL--LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFN  403
            MW  R+   +L  LL  ++ LV+AQGS    S W+TL+GD PLVIARGGFSGLFP  S  
Sbjct  1    MWNSRAPLFVLAALLFYSLALVSAQGS----SPWKTLTGDPPLVIARGGFSGLFPGFSSA  56

Query  404  AYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTT  583
            AY+ A +TS+ +V+++CDVQLTK+  GICFPD+ L+N+SNV  +F+ K+ TY VNG PT 
Sbjct  57   AYNLALITSVPDVVLYCDVQLTKEAAGICFPDLLLNNSSNVDQVFEKKEKTYPVNGFPTK  116

Query  584  AWF  592
              F
Sbjct  117  GSF  119



>ref|XP_009415406.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=760

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 82/111 (74%), Gaps = 5/111 (5%)
 Frame = +2

Query  260  LLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTN  439
             L    VT++A      + S W TL+G+AP ++A+GGFSGLFPDSS +AYSFA + S  +
Sbjct  20   FLFLQQVTVIA-----RNASAWLTLTGNAPAIVAKGGFSGLFPDSSHDAYSFALIASSPD  74

Query  440  VIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
             I+WCDV+LTKDG+GIC PDIKLDN ++++ ++ + Q+ YLVNGV TT WF
Sbjct  75   TILWCDVRLTKDGLGICLPDIKLDNCTDISNIYPNGQNVYLVNGVNTTGWF  125



>gb|KHN28413.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = +2

Query  305  TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVG  484
            TNST+ W TL+G  PLVIARGGFSG+FPDSS  AY FA  T L N+I WCDVQLTKD  G
Sbjct  31   TNSTT-WNTLTGAPPLVIARGGFSGIFPDSSDLAYIFAVRTGLKNLIAWCDVQLTKDRQG  89

Query  485  ICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            ICFPDIKL+NA+++   F ++  TY VNGVPTTA+F
Sbjct  90   ICFPDIKLENATDINYAFPNRSQTYPVNGVPTTAYF  125



>ref|XP_009348463.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 75/101 (74%), Gaps = 4/101 (4%)
 Frame = +2

Query  290  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  469
            +AQGS    SKW+TLSGD P V+ARGGFSGLFP  S  A+S A LTSL + ++WCDVQLT
Sbjct  22   SAQGS----SKWKTLSGDPPKVVARGGFSGLFPGYSSAAFSLALLTSLQDAVLWCDVQLT  77

Query  470  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            KDG GICFPD+ L+N SN+  +   +  +YLVNGVPT  WF
Sbjct  78   KDGAGICFPDLLLNNNSNIDMVLPKRDKSYLVNGVPTKGWF  118



>ref|XP_009396661.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=744

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 2/114 (2%)
 Frame = +2

Query  251  FNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  430
             N+LL    V L  A  +  S +KWQTLSG+AP VIARGGFSGLFP+SS  AY FA  TS
Sbjct  3    LNVLLFI--VLLHGAAAAVVSPTKWQTLSGNAPAVIARGGFSGLFPESSQFAYQFAQSTS  60

Query  431  LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            L NV+++CD+QLTKDG GIC  D++LDN++ ++ +F   ++TY VNG P   WF
Sbjct  61   LKNVVLYCDLQLTKDGAGICHSDLRLDNSTTISAVFPKGRTTYSVNGRPVQGWF  114



>ref|XP_010415240.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=780

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = +2

Query  266  LCSAVTLV---AAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  433
            LC  + L+   AAQ  +  STS++  L GDAP VIARGGFSGL PDSS +AY+ A  TS+
Sbjct  20   LCCGIVLILLFAAQIDAQRSTSRFIYLPGDAPRVIARGGFSGLLPDSSLDAYNLAIQTSV  79

Query  434  TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
             +V++WCDVQLTKDGVGICFPD+ + NAS V  ++ + Q +Y VNGV T  WF
Sbjct  80   ADVVLWCDVQLTKDGVGICFPDLNMANASTVQNVYPNGQKSYPVNGVSTQGWF  132



>ref|XP_004150252.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cucumis sativus]
 ref|XP_004163282.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cucumis sativus]
 gb|KGN59083.1| Glycerophosphoryl diester phosphodiesterase [Cucumis sativus]
Length=764

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = +2

Query  284  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQ  463
            LV+AQGS N+   WQTLSGDAP V+ARGGFSGLFPDSS  AY+FA + S+ +VI+WCDVQ
Sbjct  22   LVSAQGS-NTPPLWQTLSGDAPFVVARGGFSGLFPDSSGVAYNFAAIVSVPDVILWCDVQ  80

Query  464  LTKDGVGICFPDIKLDNASNVATLF-KDKQSTYLVNGVPTTAWF  592
            LTKDGVGIC PD++LDNA++ + +    +  +Y VNGV  +  F
Sbjct  81   LTKDGVGICLPDLRLDNATDASVILGTTRTRSYSVNGVSMSGLF  124



>ref|XP_008364336.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=549

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 75/102 (74%), Gaps = 4/102 (4%)
 Frame = +2

Query  287  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  466
            V+AQGS    SKW+TLSGD P VIARGGFSGLFP  S  A+S A +TS+ + ++WCDVQL
Sbjct  21   VSAQGS----SKWKTLSGDPPKVIARGGFSGLFPGYSSAAFSLALITSVQDAVLWCDVQL  76

Query  467  TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            TKD  GICFPD+ L+N SN+  +   K  +YLVNGVPT  WF
Sbjct  77   TKDXAGICFPDLLLNNNSNIDMVLPKKDKSYLVNGVPTKGWF  118



>ref|XP_010419030.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=772

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 84/124 (68%), Gaps = 5/124 (4%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  400
            M  LRS  + +LLC  V   L A +  +  S S+WQTLSG+AP VIARGGFSGL PDSS 
Sbjct  14   MLLLRS--STILLCGVVLIQLFAPRIDAQRSRSRWQTLSGEAPRVIARGGFSGLLPDSSL  71

Query  401  NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  580
            +AY+ A   S+ +V++WCDVQLTK GVGICFPD+ L NAS V   +   Q +Y VNGV T
Sbjct  72   DAYNLAIQKSVADVVLWCDVQLTKYGVGICFPDLNLANASTVQYAYPKGQKSYPVNGVTT  131

Query  581  TAWF  592
              WF
Sbjct  132  QGWF  135



>gb|KHN28414.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=709

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 79/117 (68%), Gaps = 3/117 (3%)
 Frame = +2

Query  242  RSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  421
            R +  L+L  S V LV++ G       W+TL G  PLVIARGGFSG+FPDSS  AYS   
Sbjct  5    RVLAILILQYSLVALVSSAGPRGG---WKTLQGSPPLVIARGGFSGIFPDSSSLAYSLTL  61

Query  422  LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
             T   NV +WCDVQLTKDGVGICFP++KLDNAS+++  +  K   YLVNGV T  WF
Sbjct  62   DTCGPNVTLWCDVQLTKDGVGICFPELKLDNASDISIAYPGKAKDYLVNGVSTRGWF  118



>ref|XP_007142367.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
 gb|ESW14361.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
Length=753

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 87/121 (72%), Gaps = 5/121 (4%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  409
            MW  R++  +LLL S + +V+AQ      S W+TL+G  PLV+ARGGFSG+FPDSS +AY
Sbjct  1    MWNPRALSAVLLLHSLIAIVSAQ-----ISAWKTLNGGPPLVVARGGFSGIFPDSSDSAY  55

Query  410  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  589
            S A +T+  +V + CDVQLTKD VGIC PDI L N++ +A+ + ++ ++YLVNGVP   +
Sbjct  56   SLAVITTGPDVYVSCDVQLTKDAVGICLPDINLANSTYIASRYPNETTSYLVNGVPIRGY  115

Query  590  F  592
            F
Sbjct  116  F  116



>ref|XP_003530776.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=727

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = +2

Query  257  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  436
            L +L    +LVA   S    S W+TL G  P+VIARGGFSG+FPDSS  AY  A  T   
Sbjct  7    LAILILQYSLVALVSSAGPPSGWKTLQGSPPMVIARGGFSGIFPDSSSLAYGLALDTCGP  66

Query  437  NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            NV +WCDVQLTKDGVGICFP++KLDNA++++  +  K   YLVNGV T  WF
Sbjct  67   NVTLWCDVQLTKDGVGICFPELKLDNATDISIAYPGKAKDYLVNGVSTRGWF  118



>gb|KHM99502.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=727

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = +2

Query  257  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  436
            L +L    +LVA   S    S W+TL G  P+VIARGGFSG+FPDSS  AY  A  T   
Sbjct  7    LAILILQYSLVALVSSAGPPSGWKTLQGSPPMVIARGGFSGIFPDSSSLAYGLALDTCGP  66

Query  437  NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            NV +WCDVQLTKDGVGICFP++KLDNA++++  +  K   YLVNGV T  WF
Sbjct  67   NVTLWCDVQLTKDGVGICFPELKLDNATDISIAYPGKAKDYLVNGVSTRGWF  118



>dbj|BAD17454.1| glycerophosphoryl diester phosphodiesterase 2 precursor-like 
protein [Oryza sativa Japonica Group]
Length=136

 Score =   119 bits (298),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S W+TLSG+ P +IA+GGFSGLFPDSS  AY F    S  +  +WCDVQLTKDG GIC P
Sbjct  30   STWKTLSGNPPAIIAKGGFSGLFPDSSDFAYGFVAAASSPDTALWCDVQLTKDGAGICLP  89

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DI++DN +N+A ++   + TY VNGV T  WF
Sbjct  90   DIRMDNCTNIANVYPKGKKTYSVNGVSTPGWF  121



>ref|XP_004975931.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=747

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 78/103 (76%), Gaps = 4/103 (4%)
 Frame = +2

Query  284  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQ  463
            + AAQ +T+    W+TLSG AP ++A+GGFSGLFPDSS +AY F   +S  + +++CDV+
Sbjct  20   VAAAQKATS----WKTLSGKAPAIVAKGGFSGLFPDSSPDAYGFVQYSSSPDTVLYCDVR  75

Query  464  LTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            LTKD VG+C PDIK+DN +N+A ++   Q +YLVNGVPT+ WF
Sbjct  76   LTKDEVGLCLPDIKMDNCTNIADIYAQGQKSYLVNGVPTSGWF  118



>ref|XP_009364631.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Pyrus x bretschneideri]
 ref|XP_009364652.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Pyrus x bretschneideri]
Length=447

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 87/122 (71%), Gaps = 5/122 (4%)
 Frame = +2

Query  230  MWKLRS-IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  406
            M  LR+ +   LLL S V LV+AQ S    S+W+TLSGDAP V+ARGGFSGLFP  S  A
Sbjct  1    MCNLRALVVAALLLHSVVALVSAQRS----SQWKTLSGDAPKVVARGGFSGLFPGFSSAA  56

Query  407  YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  586
            +  A +TS+ +VI+WCDVQLTKDG GICFPD+ L+N SN+  +   K+ TYLVNGV T  
Sbjct  57   FDLALITSVPDVILWCDVQLTKDGAGICFPDLLLNNNSNINDVLPQKEKTYLVNGVSTKG  116

Query  587  WF  592
            WF
Sbjct  117  WF  118



>ref|NP_001168748.1| uncharacterized protein LOC100382543 precursor [Zea mays]
 gb|ACN30591.1| unknown [Zea mays]
Length=747

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = +2

Query  299  GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDG  478
             +    S W+TLSG AP ++A+GGFSGLFPDSS  AY FA L S  + I++CDV+LTKD 
Sbjct  21   AAAQKASSWKTLSGKAPAIVAKGGFSGLFPDSSEYAYQFALLASSPDTILYCDVRLTKDE  80

Query  479  VGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            +GIC PDIK+DN +N+   +   Q +YLVNGVPT+ WF
Sbjct  81   IGICLPDIKMDNCTNIPDFYAQGQKSYLVNGVPTSGWF  118



>emb|CDY46667.1| BnaA03g48410D [Brassica napus]
Length=1323

 Score =   128 bits (322),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = +2

Query  260  LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGD--APLVIARGGFSGLFPDSSFNAYSFAGL  424
            +LLC  V   L A+Q  +    S W+TLSG+  AP VI+RGGFSGLFPDSS +AY+FA  
Sbjct  6    VLLCGVVLIHLFASQTDAQRPGSPWKTLSGESVAPRVISRGGFSGLFPDSSLDAYNFALQ  65

Query  425  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            TS+ + +MWCDVQLTKDG GICFP + + NASN+   + ++ +TYLV+GV T  WF
Sbjct  66   TSVADAVMWCDVQLTKDGAGICFPGLTMSNASNIEAAYPNRTNTYLVSGVSTQGWF  121



>ref|XP_008806340.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=808

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 79/112 (71%), Gaps = 2/112 (2%)
 Frame = +2

Query  257  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  436
              L    + LV A+  T+++S+WQTLSG AP +IARGGFSGLFPDSS +A+ F    S  
Sbjct  64   FFLAVQHLGLVTAK--TSNSSRWQTLSGRAPAIIARGGFSGLFPDSSLDAFLFGVSVSSN  121

Query  437  NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            +  +WC+VQLTKD VGIC PDIKLDN +N+A ++  ++  Y+VNGV T  WF
Sbjct  122  DSFLWCNVQLTKDNVGICVPDIKLDNCTNIANVYPGREKVYVVNGVRTPGWF  173



>ref|XP_010474169.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Camelina sativa]
Length=388

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +2

Query  323  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  502
            +  L GDAP VIARGGFSGL PDSS +AY+ A  TS+ +V++WCDVQLTKDGVGICFPD+
Sbjct  107  YHYLPGDAPRVIARGGFSGLLPDSSIDAYNLAIQTSVADVVLWCDVQLTKDGVGICFPDL  166

Query  503  KLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
             L NAS V  ++ + Q +Y VNGV T  WF
Sbjct  167  NLANASTVQFVYPNGQKSYPVNGVTTQGWF  196



>ref|XP_009335427.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 88/122 (72%), Gaps = 5/122 (4%)
 Frame = +2

Query  230  MWKLRS-IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  406
            M  LR+ +   LLL S V LV+AQ S    S+W+TLSGD P V+ARGGFSGLFP  +  A
Sbjct  1    MCNLRALVVAALLLHSVVALVSAQRS----SQWKTLSGDPPKVVARGGFSGLFPGFTSAA  56

Query  407  YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  586
            ++FA +TS+ +VI+WCDVQLTKDG GICFPD+ L+N SN+  +   K+ TYLVNGV T  
Sbjct  57   FNFALITSVPDVILWCDVQLTKDGAGICFPDLLLNNNSNINEVLPQKEKTYLVNGVSTKG  116

Query  587  WF  592
            WF
Sbjct  117  WF  118



>ref|NP_001142429.1| uncharacterized protein LOC100274608 [Zea mays]
 gb|ACG23909.1| hypothetical protein [Zea mays]
Length=364

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 78/115 (68%), Gaps = 1/115 (1%)
 Frame = +2

Query  251  FNLLLLCSAVTLVAAQGS-TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  427
            F  LL C    +V A G      S ++TLSG APLV+A+GGFSG+FPDSS  AYSFA +T
Sbjct  28   FAALLGCVVALVVGAAGQGPRPPSDYKTLSGAAPLVVAKGGFSGVFPDSSQGAYSFAMIT  87

Query  428  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            S  +  MWCDVQLTKDGVG+C  DI + N ++V   + +++ TY+++GV  T WF
Sbjct  88   SAPDTAMWCDVQLTKDGVGVCLRDINMKNCTSVDQAYPERKRTYVIDGVRKTGWF  142



>gb|EMT15515.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=880

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 74/101 (73%), Gaps = 7/101 (7%)
 Frame = +2

Query  290  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  469
            A +GST     W+TLSGDAP VIA+GGFSGLFPDSS  AYSFA   S  +   WCDV+LT
Sbjct  26   AQKGST-----WKTLSGDAPAVIAKGGFSGLFPDSSDPAYSFAA--SNQDSAQWCDVRLT  78

Query  470  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            KDGVGIC PDIK+DN + ++ LF   + TYLVNGV TT WF
Sbjct  79   KDGVGICLPDIKMDNCTTISDLFPKGKKTYLVNGVSTTGWF  119



>gb|EMT29224.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=849

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 76/103 (74%), Gaps = 4/103 (4%)
 Frame = +2

Query  284  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQ  463
            + AAQG     S W+TLSG+AP +IA+GGFSGLFPDSS  AY FA + S  + I++CDV+
Sbjct  20   VAAAQGD----SPWKTLSGNAPAIIAKGGFSGLFPDSSEFAYQFAMIASSPDTILYCDVR  75

Query  464  LTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            LTKDG+G+C PDIK+DN +N+   +   + +YLVNGV TT WF
Sbjct  76   LTKDGLGVCLPDIKMDNCTNIPDFYPKGKKSYLVNGVSTTGWF  118



>ref|XP_010545539.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL5 [Tarenaya 
hassleriana]
Length=732

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 76/113 (67%), Gaps = 5/113 (4%)
 Frame = +2

Query  257  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  436
            LL L    TL      T S+S W TL+G+ P+VIARGGFSG+FPDSS  AY  A +TS  
Sbjct  12   LLFLIHFFTL-----QTTSSSSWLTLNGEPPVVIARGGFSGMFPDSSIVAYDSATVTSTP  66

Query  437  NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFP  595
            NV +WCD+QL KD +G CFP +  +N SN+  +F  ++ +Y+VNGVP+  WFP
Sbjct  67   NVTLWCDLQLAKDDIGFCFPHLSFENGSNIEYVFPGQKKSYIVNGVPSKGWFP  119



>ref|XP_008349893.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 3 [Malus domestica]
Length=448

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 87/122 (71%), Gaps = 5/122 (4%)
 Frame = +2

Query  230  MWKLRS-IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  406
            M  LR+ +   LLL S   LV+AQ S    S+W+TLSGDAP V+ARGGFSGLFP  S  A
Sbjct  1    MCNLRALVVAALLLHSVXALVSAQRS----SQWKTLSGDAPKVVARGGFSGLFPGFSSAA  56

Query  407  YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  586
            ++ A +TS+ +VI+WCDVQLTKDG GICFPD+ L+N SN+  +   K+ TYLVNGV T  
Sbjct  57   FNLALITSVPDVILWCDVQLTKDGAGICFPDLLLNNNSNINEVLPQKEKTYLVNGVSTKG  116

Query  587  WF  592
            WF
Sbjct  117  WF  118



>ref|XP_003553031.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=722

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 76/112 (68%), Gaps = 3/112 (3%)
 Frame = +2

Query  257  LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  436
            L+L  S V LV++ G       W+TL G  PLVIARGGFSG+FPDSS  AYS    T   
Sbjct  10   LILQYSLVALVSSAGPRGG---WKTLQGSPPLVIARGGFSGIFPDSSSLAYSLTLDTCGP  66

Query  437  NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            NV +WCDVQLTKDGVGICFP++KLDNAS+++  +  K   YLVN V T  WF
Sbjct  67   NVTLWCDVQLTKDGVGICFPELKLDNASDISIAYPGKAKDYLVNEVSTRGWF  118



>gb|EMS58329.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=744

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 76/103 (74%), Gaps = 4/103 (4%)
 Frame = +2

Query  284  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQ  463
            + AAQG     S W+TLSG+AP +IA+GGFSGLFPDSS  AY FA + S  + I++CDV+
Sbjct  20   VAAAQGD----SPWKTLSGNAPAIIAKGGFSGLFPDSSEFAYQFAMIASSPDTILYCDVR  75

Query  464  LTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            LTKDG+G+C P+IK+DN +N+   +   + +YLVNGV TT WF
Sbjct  76   LTKDGLGVCLPEIKMDNCTNIPDFYPKGKKSYLVNGVSTTGWF  118



>ref|XP_002446646.1| hypothetical protein SORBIDRAFT_06g019730 [Sorghum bicolor]
 gb|EES10974.1| hypothetical protein SORBIDRAFT_06g019730 [Sorghum bicolor]
Length=749

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S W+TLSG AP ++A+GGFSGLFPDSS  AY FA + S  + I++CDV+LTKD +GIC P
Sbjct  29   SSWKTLSGKAPAIVAKGGFSGLFPDSSEYAYQFALVASSPDTILYCDVRLTKDEIGICLP  88

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DI++DN +N+   +   Q +YLVNGVPT+ WF
Sbjct  89   DIRMDNCTNIPDFYAQGQKSYLVNGVPTSGWF  120



>ref|XP_008366428.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=752

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 87/122 (71%), Gaps = 5/122 (4%)
 Frame = +2

Query  230  MWKLRS-IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  406
            M  LR+ +   LLL S   LV+AQ S    S+W+TLSGDAP V+ARGGFSGLFP  S  A
Sbjct  1    MCNLRALVVAALLLHSVXALVSAQRS----SQWKTLSGDAPKVVARGGFSGLFPGFSSAA  56

Query  407  YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  586
            ++ A +TS+ +VI+WCDVQLTKDG GICFPD+ L+N SN+  +   K+ TYLVNGV T  
Sbjct  57   FNLALITSVPDVILWCDVQLTKDGAGICFPDLLLNNNSNINEVLPQKEKTYLVNGVSTKG  116

Query  587  WF  592
            WF
Sbjct  117  WF  118



>gb|AES70468.2| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=717

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S W+TL G  P+VIARGGFSG+FPDSS  +Y+ A   S  N+ +WCD+QLTKDGVGICFP
Sbjct  26   SGWKTLQGSPPVVIARGGFSGIFPDSSLASYNLALKASSPNITLWCDLQLTKDGVGICFP  85

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            D+KLDNA++++ ++  K   Y VN VPT  WF
Sbjct  86   DVKLDNATDISVVYPGKAKDYSVNMVPTRGWF  117



>ref|XP_010252664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=756

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 84/127 (66%), Gaps = 8/127 (6%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAVTLVAAQ---GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  400
            M     +F L +L SAV LVAAQ    S N+TS WQTL G+APLVIA+GGFSG+FPDSS 
Sbjct  1    MTTSHPLFLLFVLHSAV-LVAAQSYRASKNTTSPWQTLHGNAPLVIAKGGFSGIFPDSSI  59

Query  401  NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQST---YLVNG  571
            +AY  + L  L+NVI+WCDVQLTKDG GICFP + LDN+S++     +       Y VNG
Sbjct  60   DAYE-STLLLLSNVILWCDVQLTKDGAGICFPYLNLDNSSDITFYIPNDSKNNRIYYVNG  118

Query  572  VPTTAWF  592
             P    F
Sbjct  119  QPMQGHF  125



>ref|XP_003600217.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
Length=740

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S W+TL G  P+VIARGGFSG+FPDSS  +Y+ A   S  N+ +WCD+QLTKDGVGICFP
Sbjct  49   SGWKTLQGSPPVVIARGGFSGIFPDSSLASYNLALKASSPNITLWCDLQLTKDGVGICFP  108

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            D+KLDNA++++ ++  K   Y VN VPT  WF
Sbjct  109  DVKLDNATDISVVYPGKAKDYSVNMVPTRGWF  140



>dbj|BAJ87963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 75/103 (73%), Gaps = 4/103 (4%)
 Frame = +2

Query  284  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQ  463
            +  AQG     S W+TLSG+AP +IA+GGFSGLFPDSS  AY FA + S  + +++CDV+
Sbjct  20   VATAQGD----SPWKTLSGNAPAIIAKGGFSGLFPDSSEFAYQFAMIASSPDTVLYCDVR  75

Query  464  LTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            LTKDG+G+C PDIK+DN +N+   +   + +YLVNGV TT WF
Sbjct  76   LTKDGLGVCLPDIKMDNCTNIPDFYPKGKKSYLVNGVSTTGWF  118



>dbj|BAJ85772.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 75/103 (73%), Gaps = 4/103 (4%)
 Frame = +2

Query  284  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQ  463
            +  AQG     S W+TLSG+AP +IA+GGFSGLFPDSS  AY FA + S  + +++CDV+
Sbjct  20   VATAQGD----SPWKTLSGNAPAIIAKGGFSGLFPDSSEFAYQFAMIASSPDTVLYCDVR  75

Query  464  LTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            LTKDG+G+C PDIK+DN +N+   +   + +YLVNGV TT WF
Sbjct  76   LTKDGLGVCLPDIKMDNCTNIPDFYPKGKKSYLVNGVSTTGWF  118



>emb|CAH67272.1| B0806H07.1 [Oryza sativa Indica Group]
 gb|EEC77457.1| hypothetical protein OsI_16271 [Oryza sativa Indica Group]
Length=740

 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +2

Query  263  LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNV  442
            L+ S V L     +    S W+TLSG+AP +IA+GGFSG+FPDSS  AY FA + S  + 
Sbjct  9    LVSSLVFLWLGVAAAQKASSWKTLSGNAPAIIAKGGFSGIFPDSSEFAYQFALIASSPDT  68

Query  443  IMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            I++CDV+LTKDG+GIC PDIK+DN +N+   ++  + +YLVNGV T  WF
Sbjct  69   ILYCDVRLTKDGLGICLPDIKMDNCTNIPDFYQQGRKSYLVNGVSTAGWF  118



>ref|NP_001053060.1| Os04g0472300 [Oryza sativa Japonica Group]
 emb|CAE02867.2| OSJNBb0022F23.4 [Oryza sativa Japonica Group]
 dbj|BAF14974.1| Os04g0472300 [Oryza sativa Japonica Group]
 dbj|BAG91894.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61172.1| hypothetical protein OsJ_15144 [Oryza sativa Japonica Group]
Length=740

 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +2

Query  263  LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNV  442
            L+ S V L     +    S W+TLSG+AP +IA+GGFSG+FPDSS  AY FA + S  + 
Sbjct  9    LVSSLVFLWLGVAAAQKASSWKTLSGNAPAIIAKGGFSGIFPDSSEFAYQFALIASSPDT  68

Query  443  IMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            I++CDV+LTKDG+GIC PDIK+DN +N+   ++  + +YLVNGV T  WF
Sbjct  69   ILYCDVRLTKDGLGICLPDIKMDNCTNIPDFYQQGRKSYLVNGVSTAGWF  118



>ref|XP_006652401.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Oryza brachyantha]
Length=745

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 81/113 (72%), Gaps = 5/113 (4%)
 Frame = +2

Query  254  NLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  433
            +L+LL   V   A +GS+     W+TL+G+AP +IA+GGFSG+FPDSS  AY FA + S 
Sbjct  12   SLVLLWLGVAAAAQKGSS-----WKTLNGNAPAIIAKGGFSGIFPDSSEFAYQFALIASS  66

Query  434  TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            ++ I++CDV+LTKDG+GIC PDIK+DN +N+   ++    +YLVNGV T  WF
Sbjct  67   SDTILYCDVRLTKDGLGICLPDIKMDNCTNIPDFYQQGSKSYLVNGVSTAGWF  119



>emb|CBI18678.3| unnamed protein product [Vitis vinifera]
Length=756

 Score =   123 bits (309),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 86/121 (71%), Gaps = 7/121 (6%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  409
            M +   +F+LL+L ++     AQ +++ T  WQTL+GD P+VIARGGFSGLFP+SS  A+
Sbjct  1    MIRCLVLFSLLILSTS-----AQKTSSQT--WQTLNGDEPVVIARGGFSGLFPESSQFAH  53

Query  410  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  589
              A  TSL+NVI++C++QLTKD VGIC  DI+LDN++N+A +F   Q TY +NG     W
Sbjct  54   QIALSTSLSNVILYCNLQLTKDSVGICQTDIRLDNSTNIAAVFPKSQKTYTINGENVQGW  113

Query  590  F  592
            F
Sbjct  114  F  114



>gb|KHN43860.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=753

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 78/103 (76%), Gaps = 5/103 (5%)
 Frame = +2

Query  287  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  466
            ++AQ ST     W TLSG APLV+ARGGFSG+ PDSS  +Y+ A +TS  +V +WCDVQL
Sbjct  23   ISAQRST-----WNTLSGGAPLVVARGGFSGMLPDSSDASYNLAVITSGPDVYIWCDVQL  77

Query  467  TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFP  595
            TKDG+GIC PDI L N++ +A+ + +K ++YLVNGVPT  +FP
Sbjct  78   TKDGLGICQPDINLANSTYIASAYPNKTTSYLVNGVPTRGYFP  120



>tpg|DAA63616.1| TPA: hypothetical protein ZEAMMB73_629479 [Zea mays]
Length=364

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 79/116 (68%), Gaps = 3/116 (3%)
 Frame = +2

Query  251  FNLLLLCSAVTLV--AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  424
            F  LL C  V LV  AA       S ++TLSG APLV+A+GGFSG+FPDSS  AYSFA +
Sbjct  28   FAALLGC-VVALVGGAAGQGPRPPSDYKTLSGAAPLVVAKGGFSGVFPDSSQGAYSFAMI  86

Query  425  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            TS  +  MWCDVQLTKDGVG+C  DI + N ++V   + +++ TY+++GV  T WF
Sbjct  87   TSAPDTAMWCDVQLTKDGVGVCLRDINMKNCTSVDQAYPERKRTYVIDGVRKTGWF  142



>ref|XP_006586115.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X2 [Glycine max]
Length=666

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +2

Query  293  AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  472
            A+GS  +T  W TL+G  PLVIARGG SG+FPDSS  AY  A   SL N+I+WCDVQLTK
Sbjct  27   ARGSHRTT--WNTLTGSPPLVIARGGSSGIFPDSSEYAYELAAQISLKNLIVWCDVQLTK  84

Query  473  DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DG GIC  +IKL+NA+++  +F+++  TY VNGV T+A+F
Sbjct  85   DGEGICISNIKLENATDIDKIFENRSKTYSVNGVQTSAYF  124



>gb|AAV64200.1| unknown [Zea mays]
 tpg|DAA63617.1| TPA: hypothetical protein ZEAMMB73_629479 [Zea mays]
Length=382

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 79/116 (68%), Gaps = 3/116 (3%)
 Frame = +2

Query  251  FNLLLLCSAVTLV--AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  424
            F  LL C  V LV  AA       S ++TLSG APLV+A+GGFSG+FPDSS  AYSFA +
Sbjct  28   FAALLGC-VVALVGGAAGQGPRPPSDYKTLSGAAPLVVAKGGFSGVFPDSSQGAYSFAMI  86

Query  425  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            TS  +  MWCDVQLTKDGVG+C  DI + N ++V   + +++ TY+++GV  T WF
Sbjct  87   TSAPDTAMWCDVQLTKDGVGVCLRDINMKNCTSVDQAYPERKRTYVIDGVRKTGWF  142



>ref|XP_003519608.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=753

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 78/103 (76%), Gaps = 5/103 (5%)
 Frame = +2

Query  287  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  466
            ++AQ ST     W TLSG APLV+ARGGFSG+ PDSS  +Y+ A +TS  +V +WCDVQL
Sbjct  23   ISAQRST-----WNTLSGGAPLVVARGGFSGMLPDSSDASYNLAVITSGPDVYIWCDVQL  77

Query  467  TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFP  595
            TKDG+GIC PDI L N++ +A+ + +K ++YLVNGVPT  +FP
Sbjct  78   TKDGLGICQPDINLANSTYIASAYPNKTTSYLVNGVPTRGYFP  120



>ref|XP_010656583.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Vitis 
vinifera]
Length=750

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 86/121 (71%), Gaps = 7/121 (6%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  409
            M +   +F+LL+L ++     AQ +++ T  WQTL+GD P+VIARGGFSGLFP+SS  A+
Sbjct  1    MIRCLVLFSLLILSTS-----AQKTSSQT--WQTLNGDEPVVIARGGFSGLFPESSQFAH  53

Query  410  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  589
              A  TSL+NVI++C++QLTKD VGIC  DI+LDN++N+A +F   Q TY +NG     W
Sbjct  54   QIALSTSLSNVILYCNLQLTKDSVGICQTDIRLDNSTNIAAVFPKSQKTYTINGENVQGW  113

Query  590  F  592
            F
Sbjct  114  F  114



>ref|XP_007146553.1| hypothetical protein PHAVU_006G0504001g, partial [Phaseolus vulgaris]
 gb|ESW18547.1| hypothetical protein PHAVU_006G0504001g, partial [Phaseolus vulgaris]
Length=503

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 74/102 (73%), Gaps = 2/102 (2%)
 Frame = +2

Query  287  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  466
            V+AQ S  +T  W TLSG+ PLVIARGGFSG+FPDSS  AY F    SL NVI+WCDVQL
Sbjct  28   VSAQVSNATT--WNTLSGNPPLVIARGGFSGIFPDSSEKAYIFGVTASLKNVIVWCDVQL  85

Query  467  TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            TKD  GIC P++KL+NA+++A   K K  +Y VNGV T  +F
Sbjct  86   TKDSQGICVPNVKLENATDIAQNNKYKSKSYQVNGVQTDGYF  127



>ref|XP_003530778.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Glycine max]
Length=761

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +2

Query  293  AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  472
            A+GS  +T  W TL+G  PLVIARGG SG+FPDSS  AY  A   SL N+I+WCDVQLTK
Sbjct  27   ARGSHRTT--WNTLTGSPPLVIARGGSSGIFPDSSEYAYELAAQISLKNLIVWCDVQLTK  84

Query  473  DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DG GIC  +IKL+NA+++  +F+++  TY VNGV T+A+F
Sbjct  85   DGEGICISNIKLENATDIDKIFENRSKTYSVNGVQTSAYF  124



>gb|KCW78936.1| hypothetical protein EUGRSUZ_C00368 [Eucalyptus grandis]
Length=737

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 83/121 (69%), Gaps = 0/121 (0%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  409
            M++    F+LL+  S     +    T+S +KW+TL+GD P+VIARGGFSG+FPDSS  A 
Sbjct  1    MFRCLLFFSLLIHSSLAQKSSGGSGTSSPTKWKTLNGDKPVVIARGGFSGIFPDSSEFAV  60

Query  410  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  589
              A  +S+ +V+++CD+QLTKDG+GIC PDIKLDN +++A +F   + TY VNG     W
Sbjct  61   DMATTSSMGDVVLYCDLQLTKDGIGICQPDIKLDNTTDIAMVFPKGEKTYTVNGQDLKGW  120

Query  590  F  592
            F
Sbjct  121  F  121



>ref|XP_010252665.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=754

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = +2

Query  314  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  493
            TS WQTLSG+APLVIA+GGFSG+FPDSS++AY+ A +TSL NV++WCDVQLTKDG GICF
Sbjct  32   TSPWQTLSGNAPLVIAKGGFSGIFPDSSYHAYALALITSLPNVVLWCDVQLTKDGDGICF  91

Query  494  PDIKLDNASNVATLFKDKQSTYLVNG  571
            P + L N+S+++ +F D +  Y VNG
Sbjct  92   PYLNLGNSSSISYVFNDTK-MYRVNG  116


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 51/100 (51%), Gaps = 9/100 (9%)
 Frame = +2

Query  293  AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  472
            A  STNS       SG APLVI+  G SG++P S+  AY  A      +VI  C VQ+T+
Sbjct  346  AHLSTNS-------SGKAPLVISHNGASGIYPSSTDIAYKQA-FDDGADVID-CAVQMTQ  396

Query  473  DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DGV IC   I L + +NV     + +ST +    P    F
Sbjct  397  DGVSICLGSINLMDGTNVVQTDFNSRSTTIRQIQPIPGIF  436



>gb|AAV64238.1| unknown [Zea mays]
Length=382

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 79/116 (68%), Gaps = 3/116 (3%)
 Frame = +2

Query  251  FNLLLLCSAVTLV--AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  424
            F  LL C  V LV  AA       S ++TLSG APLV+A+GGFSG+FPDSS  AYSFA +
Sbjct  28   FAALLGC-VVALVGGAAGQGPRLPSDYKTLSGAAPLVVAKGGFSGVFPDSSQGAYSFAMI  86

Query  425  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            TS  +  MWCDVQLTKDGVG+C  DI + N ++V   + +++ TY+++GV  T WF
Sbjct  87   TSAPDTAMWCDVQLTKDGVGVCLRDINMKNCTSVDQAYPERKRTYVIDGVRKTGWF  142



>ref|XP_003544723.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=754

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S W TL G APLV+ARGGFSG+ PDSS  AY+ A +++  +V +WCDVQLTKDGVGIC P
Sbjct  28   STWNTLGGGAPLVVARGGFSGILPDSSGAAYNLAVISTGPDVYIWCDVQLTKDGVGICQP  87

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFP  595
            DI L N++ +AT++ +K ++Y VNGVPT+ +FP
Sbjct  88   DINLANSTYIATIYPNKTTSYSVNGVPTSGYFP  120



>ref|XP_004500131.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=704

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S W+TL G  PLVIARGGFSG+FPDSS  +Y+ A  TS  NV +WCDVQLTKDGVGICFP
Sbjct  22   SGWKTLQGSPPLVIARGGFSGIFPDSSSPSYNLALKTSSLNVTLWCDVQLTKDGVGICFP  81

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            D KLDNA++++ ++  K   Y VN   T  WF
Sbjct  82   DFKLDNATDISVVYPGKAKDYSVNNFSTRGWF  113



>gb|EMS62136.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=748

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 68/92 (74%), Gaps = 2/92 (2%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S W+TLSGDAP VIA+GGFSGLFPDSS  AY FA   S  +   WCDV+LTKDGVGIC P
Sbjct  31   SAWKTLSGDAPAVIAKGGFSGLFPDSSDPAYLFAA--SNQDSAQWCDVRLTKDGVGICLP  88

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DIK+DN + ++ LF   + TY VNGV TT WF
Sbjct  89   DIKMDNCTTISDLFPKGKKTYRVNGVSTTGWF  120



>gb|KHN23877.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=754

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S W TL G APLV+ARGGFSG+ PDSS  AY+ A +++  +V +WCDVQLTKDGVGIC P
Sbjct  28   STWNTLGGGAPLVVARGGFSGILPDSSGAAYNLAVISTGPDVYIWCDVQLTKDGVGICQP  87

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFP  595
            DI L N++ +AT++ +K ++Y VNGVPT+ +FP
Sbjct  88   DINLANSTYIATIYPNKTTSYSVNGVPTSGYFP  120



>ref|XP_007146557.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18551.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=667

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 75/102 (74%), Gaps = 2/102 (2%)
 Frame = +2

Query  287  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  466
            V+AQ S  +T  W TLSG+ PLVIARGGFSG+FPDSS +AY F    SL NVI+WCDVQL
Sbjct  27   VSAQVSNATT--WDTLSGNPPLVIARGGFSGIFPDSSESAYIFGVTASLKNVIVWCDVQL  84

Query  467  TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            TKD  GIC P++KL+NA+++A   K K  +Y VNGV T  +F
Sbjct  85   TKDSQGICVPNVKLENATDIAQNNKYKSKSYQVNGVQTDGYF  126



>ref|XP_007146558.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18552.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=762

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 75/102 (74%), Gaps = 2/102 (2%)
 Frame = +2

Query  287  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  466
            V+AQ S  +T  W TLSG+ PLVIARGGFSG+FPDSS +AY F    SL NVI+WCDVQL
Sbjct  27   VSAQVSNATT--WDTLSGNPPLVIARGGFSGIFPDSSESAYIFGVTASLKNVIVWCDVQL  84

Query  467  TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            TKD  GIC P++KL+NA+++A   K K  +Y VNGV T  +F
Sbjct  85   TKDSQGICVPNVKLENATDIAQNNKYKSKSYQVNGVQTDGYF  126



>ref|XP_004973845.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X2 [Setaria italica]
Length=679

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 78/115 (68%), Gaps = 6/115 (5%)
 Frame = +2

Query  263  LLCSAVTLV-----AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  427
            LLC    +V     AAQG     S ++TL GDAP V+A+GGFSG+FPDSS +AYSFA + 
Sbjct  19   LLCCGCVMVLAGAAAAQGP-RLPSAYKTLRGDAPRVVAKGGFSGVFPDSSSDAYSFALIA  77

Query  428  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            S     +WCDVQLTKDGVG+C  DI ++N +NVA  ++ ++ TY+++GV    WF
Sbjct  78   SAPGTTLWCDVQLTKDGVGVCLRDINMNNCTNVAHTYQARKRTYVIDGVRKNGWF  132



>ref|NP_001047275.1| Os02g0588500 [Oryza sativa Japonica Group]
 dbj|BAD17453.1| putative GPI-anchored protein [Oryza sativa Japonica Group]
 dbj|BAF09189.1| Os02g0588500 [Oryza sativa Japonica Group]
 gb|EAZ23618.1| hypothetical protein OsJ_07316 [Oryza sativa Japonica Group]
Length=749

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S W+TLSG+ P +IA+GGFSGLFPDSS  AY F    S  +  +WCDVQLTKDG GIC P
Sbjct  30   STWKTLSGNPPAIIAKGGFSGLFPDSSDFAYGFVAAASSPDTALWCDVQLTKDGAGICLP  89

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DI++DN +N+A ++   + TY VNGV T  WF
Sbjct  90   DIRMDNCTNIANVYPKGKKTYSVNGVSTPGWF  121



>ref|XP_008782908.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=767

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S WQTL+G+AP+VIA+GGFSG+FPDSS  AY    +   ++ I WCDV+LTKDGVGIC P
Sbjct  40   SPWQTLTGNAPVVIAKGGFSGIFPDSSDAAYKLTYIAGSSDTISWCDVRLTKDGVGICLP  99

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            ++ ++N +N+  ++   +  YLVNGVPT+ WF
Sbjct  100  ELTINNGTNIQVVYSQGEKNYLVNGVPTSGWF  131



>ref|NP_001169682.1| hypothetical protein precursor [Zea mays]
 gb|ACN34414.1| unknown [Zea mays]
 gb|ACN34504.1| unknown [Zea mays]
 gb|AFW62775.1| hypothetical protein ZEAMMB73_123565 [Zea mays]
Length=753

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 71/102 (70%), Gaps = 5/102 (5%)
 Frame = +2

Query  287  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  466
            VA  GST     W+TLSG AP V+A+GGFSGLFPDSS  AY F G++S  +  +WCDV+L
Sbjct  31   VAQNGST-----WKTLSGKAPAVVAKGGFSGLFPDSSDYAYQFVGISSSPDTTVWCDVRL  85

Query  467  TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            TKDG GIC P I +DN + +A++F   + TY VNGV T  WF
Sbjct  86   TKDGAGICLPSINMDNCTIIASVFPQGKKTYKVNGVSTAGWF  127



>ref|XP_004973844.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Setaria italica]
Length=768

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 78/115 (68%), Gaps = 6/115 (5%)
 Frame = +2

Query  263  LLCSAVTLV-----AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  427
            LLC    +V     AAQG     S ++TL GDAP V+A+GGFSG+FPDSS +AYSFA + 
Sbjct  19   LLCCGCVMVLAGAAAAQGP-RLPSAYKTLRGDAPRVVAKGGFSGVFPDSSSDAYSFALIA  77

Query  428  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            S     +WCDVQLTKDGVG+C  DI ++N +NVA  ++ ++ TY+++GV    WF
Sbjct  78   SAPGTTLWCDVQLTKDGVGVCLRDINMNNCTNVAHTYQARKRTYVIDGVRKNGWF  132



>ref|XP_010928867.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Elaeis guineensis]
Length=767

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S WQTL+G+AP+VIA+GGFSG+FPDSS  AY    +   ++ I WCDV+LTKDGVGIC P
Sbjct  40   SPWQTLTGNAPVVIAKGGFSGVFPDSSDAAYKLTYIAGSSDTISWCDVRLTKDGVGICLP  99

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            ++ ++N +N+  ++   +  YLVNGVPT+ WF
Sbjct  100  ELTINNGTNIQVVYPQGEKNYLVNGVPTSGWF  131



>gb|EAY86479.1| hypothetical protein OsI_07859 [Oryza sativa Indica Group]
Length=709

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S W+TLSG+ P +IA+GGFSGLFPDSS  AY F    S  +  +WCDVQLT+DG GIC P
Sbjct  30   STWKTLSGNPPAIIAKGGFSGLFPDSSDFAYGFVAAASSPDTALWCDVQLTRDGAGICLP  89

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DI++DN +N+A ++   + TY VNGV T  WF
Sbjct  90   DIRMDNCTNIANVYPKGKKTYSVNGVSTPGWF  121



>ref|XP_009417318.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=753

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +2

Query  311  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  490
            +  KW TLSG+AP +IA+GGFSGLF DSS+NAY    L S ++  +WCDV+LTKDGVGIC
Sbjct  26   TAQKWLTLSGNAPAIIAKGGFSGLFADSSYNAYKSVSLFSSSDTTLWCDVRLTKDGVGIC  85

Query  491  FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
             PDI L+N +++   +   + +Y+VNGVPT+ WF
Sbjct  86   LPDITLNNCTDIQYSYPQGKKSYMVNGVPTSGWF  119



>ref|XP_006344951.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2-like, partial [Solanum tuberosum]
Length=397

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +2

Query  329  TLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL-TSLTNVIMWCDVQLTKDGVGICFPDIK  505
            TLSGDAPLVIA GGFSGLF DSS+ AY  A L TSL NVI+WCDVQLTK+ V +CFPD+K
Sbjct  3    TLSGDAPLVIAXGGFSGLFLDSSYEAYIMAILETSLPNVIIWCDVQLTKNEVDMCFPDLK  62

Query  506  LDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            LDN S++   +K+ +S YL+N V T  WF
Sbjct  63   LDNTSDIDAYYKNNKSKYLMNIVLTQGWF  91



>ref|XP_008798763.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 isoform X1 [Phoenix dactylifera]
Length=763

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S WQTL+G+AP+VIA+GGFSG+FPDSS  AY    L   ++ I WCDV+LTKDGVGIC P
Sbjct  42   SAWQTLTGNAPVVIAKGGFSGIFPDSSDLAYKLTYLVGSSDTISWCDVRLTKDGVGICLP  101

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            ++ ++N +N+  ++   +  YLVNGVPT+ WF
Sbjct  102  ELTINNGTNIQMVYPQGKKNYLVNGVPTSGWF  133



>ref|XP_004979884.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=1128

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 76/115 (66%), Gaps = 6/115 (5%)
 Frame = +2

Query  263  LLCSAVTLVAAQGSTNSTSKW-----QTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  427
            LLC    +V A G+  +   W     +TLSGDAP V+A+GGFSG+FPDSS +AYSF  + 
Sbjct  19   LLCCGCVMVLA-GAAAAQGPWLPYAYKTLSGDAPRVVAKGGFSGVFPDSSSDAYSFTLMA  77

Query  428  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            S     +WCDVQLTKDGVG+C  DI +DN +NVA  +  ++ TY+++GV    WF
Sbjct  78   SAAGTTLWCDVQLTKDGVGVCLRDINMDNCTNVAQAYPARKRTYVIDGVRKNGWF  132



>ref|XP_010064948.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Eucalyptus grandis]
Length=746

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  347  PLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNV  526
            PLVIA+GGFSG+FPDSS+ AYS A +TS+ +V+ WCDVQLTKDG GIC P +KLDN++++
Sbjct  32   PLVIAKGGFSGIFPDSSYAAYSLALITSVPDVVSWCDVQLTKDGAGICAPSVKLDNSTDI  91

Query  527  ATLFKDKQSTYLVNGVPTTAWF  592
            + +FKD+  TY VNG+ T  WF
Sbjct  92   SNIFKDQSRTYSVNGMDTQGWF  113



>ref|XP_009390640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=755

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +2

Query  302  STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGV  481
            +  ++S W+TLSG++P +IA+GGFSGLFPDSSF AY    L S  +  +WCDV+LTKD V
Sbjct  26   TARTSSAWRTLSGNSPAIIAKGGFSGLFPDSSFYAYKSVSLFSANDTTLWCDVRLTKDSV  85

Query  482  GICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            GIC PDIKLDN + +   F   + TY+VNG  T+ WF
Sbjct  86   GICLPDIKLDNCTTIQYYFDKGKKTYVVNGANTSGWF  122



>ref|XP_010675853.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=752

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 74/115 (64%), Gaps = 9/115 (8%)
 Frame = +2

Query  248  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  427
            +  L L CSA           + S W TL G  PLVIA  GFSGLFP SS  AY+ A +T
Sbjct  15   LLQLSLFCSA---------QKTPSSWLTLDGFPPLVIAHNGFSGLFPPSSSYAYNLAMMT  65

Query  428  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            S+ +V++WCDVQLTKD  GICFPDIKLDN+SNV  +++D+  TY V+G     +F
Sbjct  66   SVPDVVLWCDVQLTKDAAGICFPDIKLDNSSNVNLVYEDRVKTYDVDGASVKGYF  120



>ref|XP_006829998.1| hypothetical protein AMTR_s00252p00015420 [Amborella trichopoda]
 gb|ERM97414.1| hypothetical protein AMTR_s00252p00015420 [Amborella trichopoda]
Length=756

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +2

Query  320  KWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPD  499
            KW TLSG+AP VIARGGFSGLFP+SS  A SFA   SL+NV++ C++QLTKDG GIC  D
Sbjct  28   KWATLSGNAPEVIARGGFSGLFPESSDFANSFALSVSLSNVVLLCELQLTKDGRGICRSD  87

Query  500  IKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            ++LDN++N+A ++   + TY+VNG P   WF
Sbjct  88   LRLDNSTNIADVYPHNKKTYIVNGKPLQGWF  118



>ref|XP_010913956.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Elaeis guineensis]
Length=763

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = +2

Query  284  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQ  463
            LV AQ    S   WQTL+G+AP+VIA+GGFSG+FPDSS  AY    L   ++ I+WCDV+
Sbjct  32   LVTAQTPKGS---WQTLTGNAPVVIAKGGFSGIFPDSSDLAYKLTYLAGSSDTILWCDVR  88

Query  464  LTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            LTKDGVG+C P++ ++N +N+  ++   +  Y VNGVPT+ WF
Sbjct  89   LTKDGVGVCLPELTINNGTNIDVVYPQGKKNYPVNGVPTSGWF  131



>ref|XP_010943202.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Elaeis guineensis]
Length=770

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            +KW+TLSG+APLVIARGGFSG+FP+SS  AY FA  +SL   ++ CD+QLTKDG GIC  
Sbjct  44   AKWKTLSGNAPLVIARGGFSGIFPESSQFAYQFALASSLKETVLLCDLQLTKDGAGICLS  103

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            D+KLDN++ ++++F  + +TY VNG     WF
Sbjct  104  DLKLDNSTTISSVFPKRDTTYSVNGQSLKGWF  135



>ref|XP_004491450.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=755

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%), Gaps = 4/121 (3%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  409
            MW  R++F+ L    A+       + +  S W TL+G+ PLV+A GGFSG+FP SS  AY
Sbjct  1    MWTPRALFSTL----ALLFHLLHSARSDRSPWNTLTGNPPLVVAHGGFSGVFPQSSEVAY  56

Query  410  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  589
            + A +TS   V +WCDVQLTKD VGIC P++ LDN++ ++ +F +K +TY VN VPT  +
Sbjct  57   NLAVMTSGPEVSIWCDVQLTKDEVGICLPNVILDNSTFISYIFPNKSTTYNVNNVPTNGY  116

Query  590  F  592
            F
Sbjct  117  F  117



>ref|XP_008811210.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3 isoform X2 [Phoenix dactylifera]
Length=600

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +2

Query  323  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  502
            W+TLSG+APLVIARGGFSG+FP+SS  AY FA  TSL   ++ CD+QLTKDG GIC  D+
Sbjct  48   WKTLSGNAPLVIARGGFSGIFPESSQFAYQFALATSLKETVLLCDLQLTKDGAGICRSDL  107

Query  503  KLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            +LDN++ ++T+F  + +TY VNG     WF
Sbjct  108  RLDNSTTISTVFPKRDATYSVNGQSLKGWF  137



>ref|XP_006297062.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
 gb|EOA29960.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
Length=729

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +2

Query  314  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  493
            +S WQTLSG  P+VIARGGFSG+FPDSS  AY  A +T+ T+V +WCD+QLTKDGVGICF
Sbjct  22   SSSWQTLSGKPPVVIARGGFSGIFPDSSIQAYQLASITTSTDVTLWCDLQLTKDGVGICF  81

Query  494  PDIKLDNASNVATLFKDKQSTYLVN  568
            P++ LDN SNV  ++ + + ++ ++
Sbjct  82   PNLNLDNGSNVMNVYPNYKESFSID  106



>gb|EMT33222.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=772

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 71/95 (75%), Gaps = 3/95 (3%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S ++TL GDAPLVIA+GGFSG+FPDSS+ A+SFA L S  +  +WCDVQLTKDGVGIC  
Sbjct  42   SSYKTLRGDAPLVIAKGGFSGVFPDSSYYAFSFALLASAPDTSLWCDVQLTKDGVGICLR  101

Query  497  DIKLDNASNVATLF---KDKQSTYLVNGVPTTAWF  592
            DI + N +N A ++     K++ Y+++GVP T +F
Sbjct  102  DINMSNCTNAAQVYPVKNKKEAKYVIDGVPKTGYF  136



>ref|XP_008811209.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 isoform X1 [Phoenix dactylifera]
Length=768

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +2

Query  323  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  502
            W+TLSG+APLVIARGGFSG+FP+SS  AY FA  TSL   ++ CD+QLTKDG GIC  D+
Sbjct  48   WKTLSGNAPLVIARGGFSGIFPESSQFAYQFALATSLKETVLLCDLQLTKDGAGICRSDL  107

Query  503  KLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            +LDN++ ++T+F  + +TY VNG     WF
Sbjct  108  RLDNSTTISTVFPKRDATYSVNGQSLKGWF  137



>gb|AFW72078.1| hypothetical protein ZEAMMB73_869244 [Zea mays]
Length=360

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S W+TLSG AP+++A+GGFSGLFPDSS  AY   G  S  + +MWCDV+LTKDG GIC P
Sbjct  33   STWKTLSGKAPVIVAKGGFSGLFPDSSDFAYRILGTISSPDTVMWCDVRLTKDGDGICLP  92

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
             I +DN + +  +F + + TY VNGV T  WF
Sbjct  93   SINMDNCTMIDNVFPEGKKTYNVNGVSTVGWF  124



>ref|XP_006856834.1| hypothetical protein AMTR_s00055p00174750 [Amborella trichopoda]
 gb|ERN18301.1| hypothetical protein AMTR_s00055p00174750 [Amborella trichopoda]
Length=763

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +2

Query  302  STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGV  481
            S NST  W+TL+G+AP+VIARGGFSGLFPDSS  A+ F    +L   I WCDVQLTKDG 
Sbjct  29   SRNSTRIWRTLTGNAPVVIARGGFSGLFPDSSTFAFDFPNSLNLPRPISWCDVQLTKDGK  88

Query  482  GICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            G+C P + LDN +N+  +++  + TY VNG   T WF
Sbjct  89   GVCLPSLLLDNCTNIQEIYQTGKKTYTVNGEILTGWF  125



>ref|XP_004952935.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=745

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 72/101 (71%), Gaps = 5/101 (5%)
 Frame = +2

Query  290  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  469
            A +GST     W+TLSG AP++IA+GGFSGLFPDSS  AY F  + S  +  + CDV+LT
Sbjct  27   AQKGST-----WKTLSGKAPVIIAKGGFSGLFPDSSDLAYQFVPIASSPDTALLCDVRLT  81

Query  470  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            KDG GIC P+IK+DN + ++ +F   +STY VNGV TT WF
Sbjct  82   KDGAGICLPNIKMDNCTFISDVFPQGKSTYNVNGVSTTGWF  122



>ref|XP_007142366.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
 gb|ESW14360.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
Length=758

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 79/121 (65%), Gaps = 0/121 (0%)
 Frame = +2

Query  230  MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  409
            MW  R++   L     +       ++   S W+TL+G  PLV+ARGGFSG+FPDSS +AY
Sbjct  1    MWNPRALSAPLAALLLLLHALIAIASAQRSAWKTLNGGPPLVVARGGFSGIFPDSSDSAY  60

Query  410  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  589
            S A +T+  +V + CDVQLTKD VGIC PDI L N++ +AT + +  ++YLVNGVP   +
Sbjct  61   SLAVITTGPDVYVSCDVQLTKDAVGICLPDINLANSTYIATTYPNDTTSYLVNGVPIRGY  120

Query  590  F  592
            F
Sbjct  121  F  121



>ref|XP_002445920.1| hypothetical protein SORBIDRAFT_07g028050 [Sorghum bicolor]
 gb|EES15415.1| hypothetical protein SORBIDRAFT_07g028050 [Sorghum bicolor]
Length=885

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 6/113 (5%)
 Frame = +2

Query  269  CSAVTLV---AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL--  433
            C  + LV   AAQG     S ++TLSG APLVIA+GGFSG+FPDSS +AYSFA + S   
Sbjct  132  CVVMALVGGAAAQGP-RLPSDYKTLSGAAPLVIAKGGFSGVFPDSSQDAYSFAKVASAPG  190

Query  434  TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            T   MWCDVQLTKDGVG+C  DI ++N + V   +  ++ TY+++G+  T WF
Sbjct  191  TGTAMWCDVQLTKDGVGVCLRDINMNNCTTVGQAYPARKRTYVIDGMHKTGWF  243



>ref|XP_002452366.1| hypothetical protein SORBIDRAFT_04g024440 [Sorghum bicolor]
 gb|EES05342.1| hypothetical protein SORBIDRAFT_04g024440 [Sorghum bicolor]
Length=753

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S W+TLSG AP+++A+GGFSGLFP+SS  AY   G  S  + +MWCDV+LTKDG GIC P
Sbjct  35   STWKTLSGKAPVIVAKGGFSGLFPESSLYAYQILGSLSSPDTVMWCDVRLTKDGGGICLP  94

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
             I +DN + +A  F   + TY VNGV T  WF
Sbjct  95   SIDMDNCTTIANFFPQGKKTYNVNGVSTVGWF  126



>ref|XP_006406374.1| hypothetical protein EUTSA_v10020151mg [Eutrema salsugineum]
 gb|ESQ47827.1| hypothetical protein EUTSA_v10020151mg [Eutrema salsugineum]
Length=727

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = +2

Query  305  TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVG  484
            T S S WQTLSG+ P+VIARGGFSGLFPDSS  AY    LT+  +V +WCD+QLTKDGVG
Sbjct  19   TASASSWQTLSGNPPVVIARGGFSGLFPDSSEYAYELVNLTTSEDVTLWCDLQLTKDGVG  78

Query  485  ICFPDIKLDNASNVATLFKDKQSTYLVN  568
            ICFP++ LDN S+V  ++ + +  + V+
Sbjct  79   ICFPNLNLDNGSDVVDVYPNHKEIFSVD  106



>ref|XP_010687738.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687740.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687741.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
Length=751

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = +2

Query  278  VTLVAAQG--STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMW  451
            + L+ AQ   +  +   W TL+G+ P VIARGGFSGLFPDSS  AY F G  SL + I++
Sbjct  12   IGLITAQKPPANPAPPSWLTLNGERPAVIARGGFSGLFPDSSRFAYDFVGQVSLPDSILY  71

Query  452  CDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            CD+QLTKDGVG C  ++KLDN++N+A LF   Q +Y VNG     WF
Sbjct  72   CDLQLTKDGVGFCQSELKLDNSTNIALLFPKGQKSYNVNGKDVRGWF  118



>tpg|DAA47913.1| TPA: hypothetical protein ZEAMMB73_887943 [Zea mays]
Length=607

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 71/111 (64%), Gaps = 4/111 (4%)
 Frame = +2

Query  269  CSAVTLV---AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTN  439
            C  + LV   AAQG     S ++TLSG APLV+ARGGFSG FPDSS  AYSF    S   
Sbjct  35   CVVMALVGGAAAQGP-RLPSDYKTLSGAAPLVVARGGFSGAFPDSSEGAYSFGASASAPG  93

Query  440  VIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
              MWCDVQLTKDGVG+C  D+ + N + V   +  ++ TY+++GV  T WF
Sbjct  94   TAMWCDVQLTKDGVGLCLRDVNMKNCTTVDQTYPGRKRTYVIDGVHKTGWF  144



>ref|XP_003572357.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Brachypodium 
distachyon]
Length=777

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = +2

Query  293  AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  472
            AQG     S ++TL+GD PLVIA+GGFSG+FPDSS +A++FA L S  +  +WCDVQLTK
Sbjct  42   AQG-IRRPSSYKTLTGDVPLVIAKGGFSGVFPDSSQDAFAFALLASAPDTSLWCDVQLTK  100

Query  473  DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFP  595
            DGVGIC PDI + N +++A ++  ++S Y+V+G P T WFP
Sbjct  101  DGVGICLPDINMQNCTDIAQVYSARKSKYVVHGAPKTGWFP  141



>ref|XP_008645839.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 ref|XP_008645847.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 ref|XP_008645851.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 ref|XP_008645857.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 tpg|DAA47914.1| TPA: hypothetical protein ZEAMMB73_887943 [Zea mays]
Length=745

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 71/111 (64%), Gaps = 4/111 (4%)
 Frame = +2

Query  269  CSAVTLV---AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTN  439
            C  + LV   AAQG     S ++TLSG APLV+ARGGFSG FPDSS  AYSF    S   
Sbjct  35   CVVMALVGGAAAQGP-RLPSDYKTLSGAAPLVVARGGFSGAFPDSSEGAYSFGASASAPG  93

Query  440  VIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
              MWCDVQLTKDGVG+C  D+ + N + V   +  ++ TY+++GV  T WF
Sbjct  94   TAMWCDVQLTKDGVGLCLRDVNMKNCTTVDQTYPGRKRTYVIDGVHKTGWF  144



>ref|NP_001170117.1| hypothetical protein [Zea mays]
 gb|ACN35879.1| unknown [Zea mays]
Length=713

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 71/111 (64%), Gaps = 4/111 (4%)
 Frame = +2

Query  269  CSAVTLV---AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTN  439
            C  + LV   AAQG     S ++TLSG APLV+ARGGFSG FPDSS  AYSF    S   
Sbjct  35   CVVMALVGGAAAQGP-RLPSDYKTLSGAAPLVVARGGFSGAFPDSSEGAYSFGASASAPG  93

Query  440  VIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
              MWCDVQLTKDGVG+C  D+ + N + V   +  ++ TY+++GV  T WF
Sbjct  94   TAMWCDVQLTKDGVGLCLRDVNMKNCTTVDQTYPGRKRTYVIDGVHKTGWF  144



>ref|XP_004491451.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cicer arietinum]
Length=762

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 72/102 (71%), Gaps = 2/102 (2%)
 Frame = +2

Query  287  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  466
            V+AQ  TN  S W TL+G+ PLVIA GGFSG+FPDSS  AYS A  TSL +V +WCDVQL
Sbjct  26   VSAQ--TNKRSDWNTLTGNPPLVIAHGGFSGIFPDSSGAAYSLALQTSLPDVALWCDVQL  83

Query  467  TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            TKD  GIC P++ L N++ V+    +K ++Y VNGV T  +F
Sbjct  84   TKDAAGICLPNVNLLNSTYVSIAIPNKTTSYSVNGVSTRGYF  125



>ref|XP_008645878.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Zea mays]
 gb|AFW72077.1| hypothetical protein ZEAMMB73_869244 [Zea mays]
Length=750

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S W+TLSG AP+++A+GGFSGLFPDSS  AY   G  S  + +MWCDV+LTKDG GIC P
Sbjct  33   STWKTLSGKAPVIVAKGGFSGLFPDSSDFAYRILGTISSPDTVMWCDVRLTKDGDGICLP  92

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
             I +DN + +  +F + + TY VNGV T  WF
Sbjct  93   SINMDNCTMIDNVFPEGKKTYNVNGVSTVGWF  124



>emb|CDY58867.1| BnaC09g52640D [Brassica napus]
Length=722

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 73/104 (70%), Gaps = 2/104 (2%)
 Frame = +2

Query  230  MWKLR-SIFNLLLLCSAVTLVAAQG-STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFN  403
            M++LR S F LL +      ++ Q  +  S S WQTL+G+APL+IARGGFSG+FPDSS  
Sbjct  11   MFRLRASKFLLLYVLILSQFLSTQLLAQRSKSPWQTLTGEAPLIIARGGFSGMFPDSSVT  70

Query  404  AYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATL  535
            AYSF   TS+ + ++WCDVQLTKDGVGI FPD+ +   SNV  L
Sbjct  71   AYSFVSATSVPDAVLWCDVQLTKDGVGISFPDVTMYKDSNVKML  114



>emb|CDX86765.1| BnaA09g21550D [Brassica napus]
Length=166

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 8/98 (8%)
 Frame = +2

Query  230  MWKLRS----IFNLLLLCSAV-TLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDS  394
            M++LR+    + ++L+L   + T + AQ    S S WQTL+G+APL+IARGGFSGLFPDS
Sbjct  11   MFRLRASKFLLLSVLILSQFLSTQLLAQ---RSKSPWQTLTGEAPLIIARGGFSGLFPDS  67

Query  395  SFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKL  508
            S  AYSF   TS+ + ++WCDVQLTKDGVGI FPD+ +
Sbjct  68   SVTAYSFVSATSVPDAVLWCDVQLTKDGVGISFPDVTM  105



>ref|XP_011033465.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Populus euphratica]
Length=744

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 76/115 (66%), Gaps = 0/115 (0%)
 Frame = +2

Query  248  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  427
            +   LLL S V       S +++ KW TL+G+ P VIARGGFSGLFP+SS  A   A  T
Sbjct  1    MIKYLLLVSFVIHATLANSESASKKWLTLNGERPSVIARGGFSGLFPESSDFANQMALGT  60

Query  428  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            S+ +V++ C++QLTKDGVGIC  DI+LDN +N+A LF+    TY VNG   T WF
Sbjct  61   SVHDVVVLCNLQLTKDGVGICQGDIRLDNTTNIAMLFEKGSKTYKVNGQDLTGWF  115



>emb|CDY11831.1| BnaC03g12570D [Brassica napus]
Length=566

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 78/121 (64%), Gaps = 3/121 (2%)
 Frame = +2

Query  239  LRS--IFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  409
            LRS  IF+L L  C A     A  +     KW TL+G  P V+ARGGFSGLFP+SS +A 
Sbjct  2    LRSFIIFSLFLHSCVAAPKTPAAVAAVPAKKWLTLNGQEPGVVARGGFSGLFPESSASAN  61

Query  410  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  589
            +FA  TS   + M C++Q+TKDGVGIC PDI+LDN++ ++TLF   Q TY VNG     W
Sbjct  62   AFAISTSSPGLTMLCNLQMTKDGVGICLPDIRLDNSTTISTLFPKAQKTYKVNGQDLKGW  121

Query  590  F  592
            F
Sbjct  122  F  122



>ref|XP_002308389.2| hypothetical protein POPTR_0006s20170g [Populus trichocarpa]
 gb|EEE91912.2| hypothetical protein POPTR_0006s20170g [Populus trichocarpa]
Length=731

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 75/115 (65%), Gaps = 0/115 (0%)
 Frame = +2

Query  248  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  427
            +   LLL S V       S +++ KW TL+G  P VIARGGFSGLFP+SS  A   A  T
Sbjct  1    MIKYLLLVSLVIHATLANSESASKKWLTLNGQRPSVIARGGFSGLFPESSDFANQMALGT  60

Query  428  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            S+ +V++ C++QLTKDGVGIC  DI+LDN +N+A LF+    TY VNG   T WF
Sbjct  61   SVHDVVVLCNLQLTKDGVGICQGDIRLDNTTNIAMLFEKGSKTYKVNGQDLTGWF  115



>ref|XP_009145621.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=726

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +2

Query  305  TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVG  484
            T S+S WQTL G  P+V+ARGGFSGL PDSS NAY    LT+  +V +WCD+QLTKDG G
Sbjct  19   TASSSSWQTLHGKPPVVVARGGFSGLLPDSSENAYKMVKLTTSPDVTLWCDLQLTKDGAG  78

Query  485  ICFPDIKLDNASNVATLFKDKQS  553
            ICFP++ LDNASNV  ++ + + 
Sbjct  79   ICFPNLNLDNASNVKDVYPNHKE  101



>emb|CDY19634.1| BnaA05g20420D [Brassica napus]
Length=726

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +2

Query  305  TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVG  484
            T S+S WQTL G  P+V+ARGGFSGL PDSS NAY    LT+  +V +WCD+QLTKDG G
Sbjct  19   TASSSSWQTLHGKPPVVVARGGFSGLLPDSSENAYKMVKLTTSPDVTLWCDLQLTKDGAG  78

Query  485  ICFPDIKLDNASNVATLFKDKQS  553
            ICFP++ LDNASNV  ++ + + 
Sbjct  79   ICFPNLNLDNASNVKDVYPNHKE  101



>ref|XP_003575252.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
isoform X1 [Brachypodium distachyon]
Length=749

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 7/101 (7%)
 Frame = +2

Query  290  AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  469
            A +GST     W+TLSGD P +IA+GGFSGLFPDSS NAY FA ++  + V  WCDV+LT
Sbjct  26   AQKGST-----WKTLSGDPPAIIAKGGFSGLFPDSSENAYLFATISQDSAV--WCDVRLT  78

Query  470  KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            KDG GIC PDI++++ ++++  F   + TY VNGV  T WF
Sbjct  79   KDGSGICLPDIQMESCTSISNAFPKGKKTYNVNGVSVTGWF  119



>ref|XP_002883252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=731

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +2

Query  314  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  493
            +S WQTLSG  P VIARGGFSG+FPDSS  AY    +T+  +V++WCD+QLTKDGVGICF
Sbjct  22   SSSWQTLSGKPPAVIARGGFSGMFPDSSSQAYQLVNITTSPDVMLWCDLQLTKDGVGICF  81

Query  494  PDIKLDNASNVATLFKDKQSTYLVN  568
            P++ LDN S+V T++ + +  + V+
Sbjct  82   PNLNLDNGSDVMTIYPNYKERFSVD  106



>ref|XP_010109457.1| putative glycerophosphoryl diester phosphodiesterase 3 [Morus 
notabilis]
 gb|EXC22605.1| putative glycerophosphoryl diester phosphodiesterase 3 [Morus 
notabilis]
Length=749

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  472
            AQ +  ++ KW TLSG+ P+V+ARGGFSGLFP+SS  A   A  T +++V+++C++QLTK
Sbjct  17   AQKAPETSPKWLTLSGEQPIVVARGGFSGLFPESSSFANQIAVSTGMSDVVVFCNLQLTK  76

Query  473  DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DG+G+C PDI++DN++ +++++   Q +Y VNG     WF
Sbjct  77   DGIGVCLPDIRIDNSTTISSIYPKGQKSYNVNGQNLRGWF  116



>gb|AAO42211.1| unknown protein [Arabidopsis thaliana]
Length=729

 Score =   112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +2

Query  314  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  493
            +S WQTLSG  P VIARGGFSG+FPDSS  AY    +T+  +V++WCD+QLTKDGVGICF
Sbjct  22   SSSWQTLSGKPPAVIARGGFSGMFPDSSIQAYQLVNITTSPDVMLWCDLQLTKDGVGICF  81

Query  494  PDIKLDNASNV  526
            P++KLDN SNV
Sbjct  82   PNLKLDNGSNV  92



>emb|CDX86766.1| BnaA09g21560D [Brassica napus]
Length=633

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +2

Query  302  STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGV  481
            +  S S WQTL+G+APLVIARGGFSGLFPDSS  AYSF   TS+ + ++WCDVQLTKDGV
Sbjct  37   AQRSKSPWQTLTGEAPLVIARGGFSGLFPDSSVTAYSFVSATSVPDAVLWCDVQLTKDGV  96

Query  482  GICFPDIKL  508
            GICFPD+ +
Sbjct  97   GICFPDVTM  105



>ref|XP_008799657.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=760

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = +2

Query  323  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  502
            W+TLSG+APLVIARGG+SG+FP+SS  AY FA  TSL   ++ CD+QL+KDG GIC  ++
Sbjct  36   WKTLSGNAPLVIARGGYSGIFPESSQFAYQFALATSLKETVLLCDLQLSKDGAGICHSNL  95

Query  503  KLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            KLDN++ ++T F  + +TY VNG     WF
Sbjct  96   KLDNSTTISTAFPKRDTTYSVNGQSLHGWF  125



>gb|EEE53168.1| hypothetical protein OsJ_36008 [Oryza sativa Japonica Group]
Length=1336

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +2

Query  311  STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  490
            +++ ++TL+G+APLVIARGGFSGLFPDSS  A+ FA   + T+  +WCDVQLTKDGVG C
Sbjct  25   ASTTFKTLTGNAPLVIARGGFSGLFPDSSQFAFGFALSATSTDTSLWCDVQLTKDGVGFC  84

Query  491  FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFP  595
              D+ + N + ++ ++   + TY +NGVP T WFP
Sbjct  85   LRDLLMQNGTTISQVYPGGKQTYRINGVPKTGWFP  119



>ref|NP_188688.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
 sp|F4JEQ1.1|GPDL5_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL5; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
5; Short=ATGDPDL5; AltName: Full=Glycerophosphodiesterase-like 
4; AltName: Full=Protein SHV3-LIKE 3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE76390.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
Length=729

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +2

Query  314  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  493
            +S WQTLSG  P VIARGGFSG+FPDSS  AY    +T+  +V++WCD+QLTKDGVGICF
Sbjct  22   SSSWQTLSGKPPAVIARGGFSGMFPDSSIQAYQLVNITTSPDVMLWCDLQLTKDGVGICF  81

Query  494  PDIKLDNASNV  526
            P++KLDN SNV
Sbjct  82   PNLKLDNGSNV  92



>ref|XP_002866252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=754

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 74/122 (61%), Gaps = 1/122 (1%)
 Frame = +2

Query  230  MWKLRSIFNLLL-LCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  406
            M +    F+L + LC A     A  +   T KW TL+G  P V+ARGGFSGLFP+SS  A
Sbjct  1    MLRFIIFFSLFIHLCVAAPKTPASAAAVPTKKWLTLNGQEPAVVARGGFSGLFPESSAPA  60

Query  407  YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  586
               A  TS   + M C++Q+TKDGVG+C  DI+LDNA+ +++LF   Q TY VNG     
Sbjct  61   NDMAISTSSPGLTMLCNLQMTKDGVGLCLSDIRLDNATTISSLFPKAQKTYKVNGQDLKG  120

Query  587  WF  592
            WF
Sbjct  121  WF  122



>gb|KEH28442.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=659

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S W TL+G  PLVI+ GGFSG+FPDSS +AY  A  TS  N  +WCDVQLTKD VGIC P
Sbjct  27   SVWNTLTGSPPLVISHGGFSGIFPDSSDSAYILAAATSTPNAALWCDVQLTKDAVGICLP  86

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            ++ L N++N+  +F +K ++YLVNG  T  +F
Sbjct  87   NLNLLNSTNIFGVFPNKTTSYLVNGESTAGYF  118



>ref|XP_003617676.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
 gb|AET00635.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=754

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            S W TL+G  PLVI+ GGFSG+FPDSS +AY  A  TS  N  +WCDVQLTKD VGIC P
Sbjct  27   SVWNTLTGSPPLVISHGGFSGIFPDSSDSAYILAAATSTPNAALWCDVQLTKDAVGICLP  86

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            ++ L N++N+  +F +K ++YLVNG  T  +F
Sbjct  87   NLNLLNSTNIFGVFPNKTTSYLVNGESTAGYF  118



>ref|XP_009399679.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=772

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = +2

Query  284  LVAAQGSTNS----TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMW  451
            +V++Q   NS    TS W TLSG  PLVIA+GGFSGLFPDSS  +Y F+ +    + I W
Sbjct  32   VVSSQSLKNSNLTATSPWLTLSGGTPLVIAKGGFSGLFPDSSSFSYKFSYVAGSPDTISW  91

Query  452  CDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            CDV+LTKDG G+C PDI LDN +N+  ++ + +  Y+VNGVPT+ WF
Sbjct  92   CDVRLTKDGNGVCLPDIVLDNCTNIKLVYPEGKMNYIVNGVPTSGWF  138



>ref|XP_004293798.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=751

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +2

Query  278  VTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCD  457
            V LV+A   + +TS+WQTL G  PLVIARGGFSGLFP SS  AY F   TS+ +V++WCD
Sbjct  22   VALVSADKDS-TTSQWQTLKGKPPLVIARGGFSGLFPGSSSVAYDFTLSTSVPDVLLWCD  80

Query  458  VQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVN  568
            VQLTK+G GICFPD+ L N+S+V  ++     TY ++
Sbjct  81   VQLTKEGAGICFPDLLLSNSSDVDIIYPKTVKTYTID  117



>ref|XP_010241663.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
 ref|XP_010241664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
Length=749

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = +2

Query  242  RSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  421
            R  F + L   +          +   KW TL+GD PLVIARGGFSG+FP+SS  AY FA 
Sbjct  3    RCFFFIFLFIHSALAQKHVEDPSQNQKWLTLNGDRPLVIARGGFSGVFPESSQFAYQFAL  62

Query  422  LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
             TS+++V+++CD+QLTKDG GIC  +++LDN++ ++  + + + TY VNG   + WF
Sbjct  63   STSISDVVLFCDLQLTKDGNGICQTELRLDNSTTISAYYPEGEKTYNVNGKNISGWF  119



>ref|XP_009132086.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=752

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 77/121 (64%), Gaps = 3/121 (2%)
 Frame = +2

Query  239  LRS--IFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  409
            LRS  IF+L L  C A        +     KW TL+G  P V+ARGGFSGLFP+SS +A 
Sbjct  2    LRSFIIFSLFLHSCVAAPQTPTAAAAVPAKKWLTLNGQEPGVVARGGFSGLFPESSASAN  61

Query  410  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  589
            +FA  TS   + M C++Q+TKDGVGIC PDI+LDN++ ++TLF   Q TY VNG     W
Sbjct  62   AFAISTSSPGLTMLCNLQMTKDGVGICLPDIRLDNSTTISTLFPKAQKTYKVNGQDLKGW  121

Query  590  F  592
            F
Sbjct  122  F  122



>ref|NP_001062173.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAD09276.1| putative glycerophosphoryl diester phosphodiesterase 2 precursor 
[Oryza sativa Japonica Group]
 dbj|BAF24087.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAG89421.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89557.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83836.1| hypothetical protein OsI_29787 [Oryza sativa Indica Group]
 gb|EEE68959.1| hypothetical protein OsJ_27854 [Oryza sativa Japonica Group]
Length=778

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +2

Query  323  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  502
            ++TLSG+AP+VIA GGFSG+FPDSS NAY FA  ++  + ++WC+VQLTKDGVGIC  D+
Sbjct  46   YKTLSGNAPIVIAEGGFSGVFPDSSKNAYVFALSSTSGDTVLWCNVQLTKDGVGICLRDL  105

Query  503  KLDNASNVATLFKDKQSTYLVNGVPTTAWFP  595
             +DN ++++  ++  +  YLVNG     WFP
Sbjct  106  LMDNCTSISQAYRAGKKAYLVNGEEKKGWFP  136



>emb|CDX88656.1| BnaA03g09930D [Brassica napus]
Length=775

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 77/121 (64%), Gaps = 3/121 (2%)
 Frame = +2

Query  239  LRS--IFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  409
            LRS  IF+L L  C A        +     KW TL+G  P V+ARGGFSGLFP+SS +A 
Sbjct  2    LRSFIIFSLFLHSCVAAPQTPTAAAAVPAKKWLTLNGQEPGVVARGGFSGLFPESSASAN  61

Query  410  SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  589
            +FA  TS   + M C++Q+TKDGVGIC PDI+LDN++ ++TLF   Q TY VNG     W
Sbjct  62   AFAISTSSPGLTMLCNLQMTKDGVGICLPDIRLDNSTTISTLFPKAQKTYKVNGQDLKGW  121

Query  590  F  592
            F
Sbjct  122  F  122



>ref|XP_002862842.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH39100.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=719

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +2

Query  314  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  493
            +S W+TLSG  P VIARGGFSG+FPDSS  AY    +T+   V++WCD+QLTKDGVGICF
Sbjct  22   SSSWKTLSGKPPAVIARGGFSGMFPDSSIQAYQLVNITTSPEVMLWCDLQLTKDGVGICF  81

Query  494  PDIKLDNASNVATLFKDKQSTYLVN  568
            P++ L N SNV +++ + +  + V+
Sbjct  82   PNLNLHNGSNVISIYPNYKERFSVD  106



>ref|XP_010050300.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Eucalyptus grandis]
Length=792

 Score =   109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  335  SGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDN  514
            +GD P+VIARGGFSG+FPDSS  A   A  +S+ +V+++CD+QLTKDG+GIC PDIKLDN
Sbjct  25   AGDKPVVIARGGFSGIFPDSSEFAVDMATTSSMGDVVLYCDLQLTKDGIGICQPDIKLDN  84

Query  515  ASNVATLFKDKQSTYLVNGVPTTAWF  592
             +++A +F   + TY VNG     WF
Sbjct  85   TTDIAMVFPKGEKTYTVNGQDLKGWF  110



>ref|XP_010488033.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL5-like 
[Camelina sativa]
Length=266

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +2

Query  314  TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  493
            +S W+TLSG  P VIARGGFSG+FPDSS  AY    +T+  ++ +WC++QLTKDGVGICF
Sbjct  22   SSSWRTLSGKPPAVIARGGFSGIFPDSSIQAYELVNITTSPDITLWCELQLTKDGVGICF  81

Query  494  PDIKLDNASNVATLFKDKQSTYLVN  568
            P++ L N S V   + + + T+ V+
Sbjct  82   PNLNLQNGSTVKKFYPNYKETFSVD  106



>ref|XP_011017989.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Populus euphratica]
Length=749

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 76/115 (66%), Gaps = 1/115 (1%)
 Frame = +2

Query  248  IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  427
            I N+LL+   +    A  S +++ KW TL+G  P VIARGGFSGLFP+SS  A   A  T
Sbjct  2    IKNVLLVFLVIHATLA-NSESASKKWLTLNGRRPCVIARGGFSGLFPESSDFANQMALAT  60

Query  428  SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            SL++V++ C +QLTKDGVGIC  D++LDN  N+A +F+    TY VNG   T WF
Sbjct  61   SLSDVVVLCHLQLTKDGVGICQGDVRLDNTKNIAMVFEKGSRTYKVNGQDLTGWF  115



>ref|XP_010483370.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Camelina 
sativa]
Length=753

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 71/122 (58%), Gaps = 1/122 (1%)
 Frame = +2

Query  230  MWKLRSIFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  406
            M +   IF+L +  C       A        KW TLSG  P V+ARGGFSGLFP+SS  A
Sbjct  1    MLRFIIIFSLFIHSCVGAPRTPAAAVAVPGKKWLTLSGQEPAVVARGGFSGLFPESSAPA  60

Query  407  YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  586
               A  TS   + M C++Q+TKDGVG+C  DI+LDNA+ ++TLF   Q TY VNG     
Sbjct  61   NDMAVSTSSPGLTMLCNLQMTKDGVGLCLSDIRLDNATTISTLFPKAQKTYKVNGQDLKG  120

Query  587  WF  592
            WF
Sbjct  121  WF  122



>ref|XP_008679540.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Zea mays]
 gb|AFW65195.1| hypothetical protein ZEAMMB73_432164 [Zea mays]
Length=790

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 75/116 (65%), Gaps = 1/116 (1%)
 Frame = +2

Query  245  SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  424
            S F  LLL  AV   AAQG     S ++TLSG APLV+A GGFSGLFPDSS  AY+FA  
Sbjct  21   SSFAALLLGCAVVSAAAQGP-RLPSDYKTLSGAAPLVVAEGGFSGLFPDSSEGAYAFAVA  79

Query  425  TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
             S     MWCDVQLTKDGVG+C  DI + N + V   F  ++ T++++GV  T WF
Sbjct  80   ASAPGTAMWCDVQLTKDGVGVCLRDINMKNCTTVDQAFPARRRTHVIDGVRKTGWF  135



>emb|CDX71386.1| BnaC04g16210D [Brassica napus]
Length=189

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +2

Query  317  SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  496
            +KW TL+G  P V+ARGGFSGLFP+SS +A   A  TS   + M C++Q+TKDGVG+C  
Sbjct  28   TKWLTLNGQEPAVVARGGFSGLFPESSASANDLAISTSSPGLTMLCNLQMTKDGVGLCLS  87

Query  497  DIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            DI+LDNA+ ++TLF   Q TY V G     WF
Sbjct  88   DIRLDNATTISTLFPKAQKTYKVYGQDLKGWF  119



>ref|XP_010913957.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Elaeis guineensis]
Length=728

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +2

Query  332  LSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLD  511
            + G+AP+VIA+GGFSG+FPDSS  AY    L   ++ I+WCDV+LTKDGVG+C P++ ++
Sbjct  10   IEGNAPVVIAKGGFSGIFPDSSDLAYKLTYLAGSSDTILWCDVRLTKDGVGVCLPELTIN  69

Query  512  NASNVATLFKDKQSTYLVNGVPTTAWF  592
            N +N+  ++   +  Y VNGVPT+ WF
Sbjct  70   NGTNIDVVYPQGKKNYPVNGVPTSGWF  96



>ref|XP_006660255.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Oryza brachyantha]
Length=785

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +2

Query  323  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  502
            ++TLSG+ PLVIA+GGFSG+FPDSS NA++FA  ++ +   +WCDVQLTKDGVGIC  D+
Sbjct  50   YKTLSGNPPLVIAKGGFSGVFPDSSSNAFTFALTSTSSATTLWCDVQLTKDGVGICLRDL  109

Query  503  KLDNASNVATLFKDKQSTYLVNGVPTTAWFP  595
             ++N +++   +   + TY+VNG     WFP
Sbjct  110  LMNNCTSIDQTYPQGKKTYIVNGKKQDGWFP  140



>ref|XP_004506009.1| PREDICTED: uncharacterized protein LOC101491157 [Cicer arietinum]
Length=391

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 67/102 (66%), Gaps = 2/102 (2%)
 Frame = +2

Query  287  VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  466
            V+AQ  TN    W TL G+ PLVIA GGFSG+FPDSS  AY  A  TSL NV +WCDVQL
Sbjct  23   VSAQ--TNKRYDWNTLIGNPPLVIAHGGFSGIFPDSSGAAYGLALETSLPNVALWCDVQL  80

Query  467  TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            TKD  GIC  ++ L N++ ++    +K + Y VNGV T  +F
Sbjct  81   TKDAAGICLSNVNLLNSNYISFAIPNKTTNYSVNGVSTRGYF  122


 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 69/109 (63%), Gaps = 8/109 (7%)
 Frame = +2

Query  284  LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGL------FPDSSFNAYSFAGLTSLTNVI  445
            LV+AQ  TN    W TL+G+ PLVIA GGFSG+      FPDSS  AY  A  TSL +V 
Sbjct  218  LVSAQ--TNKRYDWNTLAGNPPLVIAHGGFSGIGGFSGIFPDSSGAAYGLALETSLPDVA  275

Query  446  MWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            +WCDVQLTKD  GI  P++ L N++ ++    +K + Y VNGV T  +F
Sbjct  276  LWCDVQLTKDAAGIFLPNVNLLNSNYISFAIPNKTTNYSVNGVSTRGYF  324



>ref|XP_007011972.1| SHV3-like 5 [Theobroma cacao]
 gb|EOY29591.1| SHV3-like 5 [Theobroma cacao]
Length=754

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = +2

Query  320  KWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPD  499
            KWQTLSG  PLVIARGGFSGLFP+SS  A   A     T+V ++C++QLTKDG+GIC  D
Sbjct  33   KWQTLSGQPPLVIARGGFSGLFPESSSFANDMANQLKSTDVALFCNLQLTKDGIGICLSD  92

Query  500  IKLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            I+LDN++ +  +F     TY +NG     WF
Sbjct  93   IRLDNSTTIGMIFPKDSKTYNINGQQVKGWF  123



>dbj|BAJ92515.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=225

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +2

Query  323  WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  502
            W TLSG  P+V+ARGGFSGL P+S   AY+FA  +S+ +V+++CD+QL+ DGVG C   +
Sbjct  78   WLTLSGRRPVVVARGGFSGLLPESGQLAYNFAMHSSVCDVVLFCDLQLSSDGVGFCHSSL  137

Query  503  KLDNASNVATLFKDKQSTYLVNGVPTTAWF  592
            +LDN+S++A  F ++ STY VNG     WF
Sbjct  138  RLDNSSDIAQSFPNRGSTYQVNGQDVQGWF  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520