BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS039C11

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004249277.1|  PREDICTED: extended synaptotagmin-1-like           217   2e-62   Solanum lycopersicum
ref|XP_006351337.1|  PREDICTED: multiple C2 and transmembrane dom...    215   9e-62   
ref|XP_009594768.1|  PREDICTED: multiple C2 and transmembrane dom...    214   2e-61   Nicotiana tomentosiformis
ref|XP_009799235.1|  PREDICTED: extended synaptotagmin-1-like           214   2e-61   Nicotiana sylvestris
ref|XP_009587222.1|  PREDICTED: multiple C2 and transmembrane dom...    214   2e-61   Nicotiana tomentosiformis
ref|XP_011078851.1|  PREDICTED: multiple C2 and transmembrane dom...    214   2e-61   Sesamum indicum [beniseed]
ref|XP_011020270.1|  PREDICTED: multiple C2 and transmembrane dom...    214   2e-61   Populus euphratica
ref|XP_006381053.1|  C2 domain-containing family protein                214   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_004249163.1|  PREDICTED: extended synaptotagmin-1-like           214   3e-61   Solanum lycopersicum
ref|XP_009614150.1|  PREDICTED: multiple C2 and transmembrane dom...    213   6e-61   Nicotiana tomentosiformis
gb|EYU20709.1|  hypothetical protein MIMGU_mgv1a001689mg                213   7e-61   Erythranthe guttata [common monkey flower]
ref|XP_004249278.1|  PREDICTED: multiple C2 and transmembrane dom...    213   7e-61   Solanum lycopersicum
emb|CBI30044.3|  unnamed protein product                                205   8e-61   Vitis vinifera
ref|XP_010463385.1|  PREDICTED: multiple C2 and transmembrane dom...    206   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006362239.1|  PREDICTED: multiple C2 and transmembrane dom...    211   2e-60   Solanum tuberosum [potatoes]
ref|XP_007162297.1|  hypothetical protein PHAVU_001G140200g             211   2e-60   Phaseolus vulgaris [French bean]
ref|XP_009785357.1|  PREDICTED: multiple C2 and transmembrane dom...    211   3e-60   Nicotiana sylvestris
ref|XP_006351338.1|  PREDICTED: multiple C2 and transmembrane dom...    211   4e-60   Solanum tuberosum [potatoes]
ref|XP_010057953.1|  PREDICTED: extended synaptotagmin-1-like           210   7e-60   Eucalyptus grandis [rose gum]
gb|KHN07409.1|  Multiple C2 and transmembrane domain-containing p...    210   8e-60   Glycine soja [wild soybean]
ref|XP_007201936.1|  hypothetical protein PRUPE_ppa001850mg             209   8e-60   
ref|XP_003554197.1|  PREDICTED: multiple C2 and transmembrane dom...    209   9e-60   Glycine max [soybeans]
ref|XP_008240960.1|  PREDICTED: multiple C2 and transmembrane dom...    209   1e-59   Prunus mume [ume]
ref|XP_009369854.1|  PREDICTED: multiple C2 and transmembrane dom...    208   2e-59   Pyrus x bretschneideri [bai li]
ref|XP_011033252.1|  PREDICTED: extended synaptotagmin-1                208   2e-59   Populus euphratica
ref|XP_003521201.1|  PREDICTED: multiple C2 and transmembrane dom...    208   3e-59   Glycine max [soybeans]
ref|XP_009376104.1|  PREDICTED: multiple C2 and transmembrane dom...    208   3e-59   Pyrus x bretschneideri [bai li]
ref|XP_008387239.1|  PREDICTED: multiple C2 and transmembrane dom...    208   3e-59   
ref|XP_008443079.1|  PREDICTED: extended synaptotagmin-1                208   4e-59   Cucumis melo [Oriental melon]
gb|EPS67145.1|  hypothetical protein M569_07629                         207   5e-59   Genlisea aurea
emb|CDY47660.1|  BnaC04g23970D                                          207   7e-59   Brassica napus [oilseed rape]
ref|XP_002322682.2|  hypothetical protein POPTR_0016s04960g             207   7e-59   
gb|KEH16148.1|  C2 calcium/lipid-binding and GRAM domain protein        207   9e-59   Medicago truncatula
ref|XP_006402831.1|  hypothetical protein EUTSA_v10005798mg             207   9e-59   Eutrema salsugineum [saltwater cress]
gb|KDP24596.1|  hypothetical protein JCGZ_25512                         206   1e-58   Jatropha curcas
ref|XP_004304385.1|  PREDICTED: multiple C2 and transmembrane dom...    206   1e-58   Fragaria vesca subsp. vesca
ref|XP_002894324.1|  C2 domain-containing protein                       206   1e-58   
emb|CDP10110.1|  unnamed protein product                                206   1e-58   Coffea canephora [robusta coffee]
ref|XP_008360635.1|  PREDICTED: multiple C2 and transmembrane dom...    206   1e-58   
ref|XP_010672701.1|  PREDICTED: multiple C2 and transmembrane dom...    206   2e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010516424.1|  PREDICTED: multiple C2 and transmembrane dom...    206   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_004136579.1|  PREDICTED: multiple C2 and transmembrane dom...    206   2e-58   Cucumis sativus [cucumbers]
ref|XP_010111396.1|  Multiple C2 and transmembrane domain-contain...    206   2e-58   Morus notabilis
ref|XP_006306818.1|  hypothetical protein CARUB_v10008360mg             205   3e-58   Capsella rubella
ref|XP_010554852.1|  PREDICTED: multiple C2 and transmembrane dom...    205   3e-58   
emb|CDX67712.1|  BnaA07g17520D                                          205   3e-58   
ref|XP_009104078.1|  PREDICTED: multiple C2 and transmembrane dom...    205   3e-58   Brassica rapa
gb|KDO57727.1|  hypothetical protein CISIN_1g004109mg                   205   3e-58   Citrus sinensis [apfelsine]
emb|CAN80955.1|  hypothetical protein VITISV_013781                     205   3e-58   Vitis vinifera
emb|CDX98254.1|  BnaC06g16150D                                          205   3e-58   
ref|XP_006437045.1|  hypothetical protein CICLE_v10030764mg             205   3e-58   Citrus clementina [clementine]
emb|CDY69710.1|  BnaAnng31280D                                          205   4e-58   Brassica napus [oilseed rape]
ref|XP_006290627.1|  hypothetical protein CARUB_v10016719mg             205   4e-58   Capsella rubella
ref|XP_009139005.1|  PREDICTED: extended synaptotagmin-1-like           205   4e-58   Brassica rapa
gb|AAK53020.1|AF375436_1  AT3g57880/T10K17_90                           205   4e-58   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01685.1|  anthranilate phosphoribosyltransferase-like protein    205   4e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191347.1|  C2 domain-containing plant phosphoribosyltransf...    205   4e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004497931.1|  PREDICTED: uncharacterized protein LOC101499...    205   4e-58   Cicer arietinum [garbanzo]
ref|XP_002278165.1|  PREDICTED: extended synaptotagmin-1                205   4e-58   Vitis vinifera
ref|XP_010500735.1|  PREDICTED: extended synaptotagmin-1-like           205   4e-58   Camelina sativa [gold-of-pleasure]
ref|XP_002878177.1|  C2 domain-containing protein                       205   5e-58   
ref|XP_009766493.1|  PREDICTED: multiple C2 and transmembrane dom...    205   5e-58   Nicotiana sylvestris
ref|XP_010504727.1|  PREDICTED: multiple C2 and transmembrane dom...    205   5e-58   Camelina sativa [gold-of-pleasure]
ref|XP_004493560.1|  PREDICTED: multiple C2 and transmembrane dom...    204   5e-58   Cicer arietinum [garbanzo]
ref|XP_010479644.1|  PREDICTED: extended synaptotagmin-1-like iso...    204   5e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006393033.1|  hypothetical protein EUTSA_v10011254mg             204   6e-58   Eutrema salsugineum [saltwater cress]
ref|NP_175568.1|  calcium-dependent lipid-binding (CaLB domain) p...    204   6e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008442250.1|  PREDICTED: multiple C2 and transmembrane dom...    204   7e-58   Cucumis melo [Oriental melon]
ref|XP_007145661.1|  hypothetical protein PHAVU_007G257800g             204   8e-58   Phaseolus vulgaris [French bean]
ref|XP_002532333.1|  synaptotagmin, putative                            203   9e-58   
ref|XP_010548191.1|  PREDICTED: multiple C2 and transmembrane dom...    203   2e-57   Tarenaya hassleriana [spider flower]
ref|XP_004144665.1|  PREDICTED: uncharacterized protein LOC101203...    202   5e-57   Cucumis sativus [cucumbers]
ref|XP_003625221.1|  Anthranilate phosphoribosyltransferase-like ...    201   8e-57   Medicago truncatula
ref|XP_003535846.1|  PREDICTED: multiple C2 and transmembrane dom...    200   2e-56   Glycine max [soybeans]
gb|KFK35840.1|  hypothetical protein AALP_AA4G043900                    199   3e-56   Arabis alpina [alpine rockcress]
ref|XP_010265829.1|  PREDICTED: multiple C2 and transmembrane dom...    199   5e-56   Nelumbo nucifera [Indian lotus]
ref|XP_009395864.1|  PREDICTED: extended synaptotagmin-1-like           198   9e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB36100.1|  hypothetical protein B456_006G141200                    195   1e-54   Gossypium raimondii
ref|XP_006386096.1|  hypothetical protein POPTR_0003s22060g             194   3e-54   
ref|XP_008787291.1|  PREDICTED: extended synaptotagmin-1-like           193   5e-54   Phoenix dactylifera
ref|XP_010928839.1|  PREDICTED: extended synaptotagmin-1-like           193   5e-54   Elaeis guineensis
ref|XP_010913922.1|  PREDICTED: multiple C2 and transmembrane dom...    193   6e-54   
ref|XP_008782885.1|  PREDICTED: multiple C2 and transmembrane dom...    193   8e-54   Phoenix dactylifera
ref|XP_008243596.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    192   9e-54   Prunus mume [ume]
ref|XP_007014901.1|  Calcium-dependent lipid-binding (CaLB domain...    192   1e-53   
ref|XP_007208351.1|  hypothetical protein PRUPE_ppa001743mg             192   1e-53   Prunus persica
ref|XP_008778691.1|  PREDICTED: multiple C2 and transmembrane dom...    192   2e-53   Phoenix dactylifera
ref|XP_011025253.1|  PREDICTED: multiple C2 and transmembrane dom...    191   5e-53   Populus euphratica
ref|XP_006445975.1|  hypothetical protein CICLE_v10014352mg             190   8e-53   Citrus clementina [clementine]
ref|XP_006494723.1|  PREDICTED: multiple C2 and transmembrane dom...    190   8e-53   Citrus sinensis [apfelsine]
gb|KJB83485.1|  hypothetical protein B456_013G250100                    189   1e-52   Gossypium raimondii
ref|XP_006850074.1|  hypothetical protein AMTR_s00022p00214560          189   2e-52   
gb|KHG04257.1|  Multiple C2 and transmembrane domain-containing 1       189   2e-52   Gossypium arboreum [tree cotton]
gb|KJB83481.1|  hypothetical protein B456_013G250100                    189   2e-52   Gossypium raimondii
gb|KDP20200.1|  hypothetical protein JCGZ_07920                         189   3e-52   Jatropha curcas
ref|XP_010519731.1|  PREDICTED: multiple C2 and transmembrane dom...    188   5e-52   Tarenaya hassleriana [spider flower]
ref|XP_002513446.1|  synaptotagmin, putative                            188   5e-52   Ricinus communis
ref|NP_001055351.1|  Os05g0370600                                       188   5e-52   
ref|XP_006654319.1|  PREDICTED: multiple C2 and transmembrane dom...    187   6e-52   Oryza brachyantha
ref|XP_002297795.1|  C2 domain-containing family protein                186   2e-51   Populus trichocarpa [western balsam poplar]
gb|KJB66120.1|  hypothetical protein B456_010G128400                    186   2e-51   Gossypium raimondii
gb|KHG19030.1|  Multiple C2 and transmembrane domain-containing 1       186   2e-51   Gossypium arboreum [tree cotton]
ref|XP_007028942.1|  Calcium-dependent lipid-binding (CaLB domain...    186   3e-51   Theobroma cacao [chocolate]
ref|XP_007028941.1|  Calcium-dependent lipid-binding (CaLB domain...    186   3e-51   
ref|XP_009364713.1|  PREDICTED: multiple C2 and transmembrane dom...    185   5e-51   Pyrus x bretschneideri [bai li]
ref|XP_008358865.1|  PREDICTED: multiple C2 and transmembrane dom...    185   5e-51   
ref|XP_004295231.1|  PREDICTED: multiple C2 and transmembrane dom...    185   5e-51   Fragaria vesca subsp. vesca
gb|EMT24491.1|  Multiple C2 and transmembrane domain-containing p...    184   6e-51   
gb|KEH30271.1|  C2 calcium/lipid-binding and GRAM domain protein        185   6e-51   Medicago truncatula
emb|CBI16433.3|  unnamed protein product                                184   6e-51   Vitis vinifera
gb|EMS45217.1|  Multiple C2 and transmembrane domain-containing p...    184   8e-51   Triticum urartu
ref|XP_010227498.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    184   9e-51   
ref|XP_002285588.1|  PREDICTED: multiple C2 and transmembrane dom...    184   2e-50   Vitis vinifera
ref|XP_009364728.1|  PREDICTED: multiple C2 and transmembrane dom...    183   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_002438680.1|  hypothetical protein SORBIDRAFT_10g024200          183   3e-50   Sorghum bicolor [broomcorn]
ref|XP_011037883.1|  PREDICTED: multiple C2 and transmembrane dom...    182   3e-50   Populus euphratica
ref|XP_010091994.1|  Multiple C2 and transmembrane domain-contain...    182   3e-50   Morus notabilis
ref|XP_009374817.1|  PREDICTED: multiple C2 and transmembrane dom...    182   6e-50   Pyrus x bretschneideri [bai li]
ref|XP_003537951.1|  PREDICTED: multiple C2 and transmembrane dom...    182   7e-50   Glycine max [soybeans]
ref|XP_007131979.1|  hypothetical protein PHAVU_011G056600g             182   7e-50   Phaseolus vulgaris [French bean]
ref|XP_009121819.1|  PREDICTED: extended synaptotagmin-1-like           181   1e-49   Brassica rapa
ref|XP_006399782.1|  hypothetical protein EUTSA_v10012747mg             181   1e-49   Eutrema salsugineum [saltwater cress]
emb|CDX97214.1|  BnaC09g44110D                                          181   2e-49   
ref|XP_010673580.1|  PREDICTED: multiple C2 and transmembrane dom...    180   3e-49   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX78498.1|  BnaA03g04100D                                          179   4e-49   
ref|XP_009131306.1|  PREDICTED: multiple C2 and transmembrane dom...    179   4e-49   Brassica rapa
emb|CDY68091.1|  BnaAnng26150D                                          179   5e-49   Brassica napus [oilseed rape]
ref|XP_008658284.1|  PREDICTED: uncharacterized protein LOC100273...    179   6e-49   
ref|NP_196801.1|  calcium-dependent lipid-binding domain-containi...    178   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871539.1|  C2 domain-containing protein                       176   6e-48   
ref|XP_010044995.1|  PREDICTED: multiple C2 and transmembrane dom...    176   6e-48   Eucalyptus grandis [rose gum]
ref|NP_001152102.1|  phosphoribosylanthranilate transferase             176   7e-48   
ref|XP_008647970.1|  PREDICTED: phosphoribosylanthranilate transf...    176   8e-48   
ref|XP_010492034.1|  PREDICTED: multiple C2 and transmembrane dom...    176   9e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010419857.1|  PREDICTED: multiple C2 and transmembrane dom...    176   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010419856.1|  PREDICTED: multiple C2 and transmembrane dom...    176   1e-47   
emb|CDX70485.1|  BnaC03g05690D                                          175   1e-47   
ref|XP_006289947.1|  hypothetical protein CARUB_v10003573mg             175   2e-47   Capsella rubella
ref|XP_004142139.1|  PREDICTED: multiple C2 and transmembrane dom...    174   3e-47   Cucumis sativus [cucumbers]
ref|XP_008449758.1|  PREDICTED: multiple C2 and transmembrane dom...    174   5e-47   Cucumis melo [Oriental melon]
gb|KHN33324.1|  Multiple C2 and transmembrane domain-containing p...    173   7e-47   Glycine soja [wild soybean]
ref|XP_003546988.1|  PREDICTED: multiple C2 and transmembrane dom...    171   4e-46   Glycine max [soybeans]
ref|XP_007150401.1|  hypothetical protein PHAVU_005G150300g             171   6e-46   Phaseolus vulgaris [French bean]
ref|XP_003543552.1|  PREDICTED: multiple C2 and transmembrane dom...    171   6e-46   Glycine max [soybeans]
ref|XP_010238001.1|  PREDICTED: LOW QUALITY PROTEIN: extended syn...    167   2e-44   
ref|XP_009417304.1|  PREDICTED: multiple C2 and transmembrane dom...    165   6e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006349900.1|  PREDICTED: multiple C2 and transmembrane dom...    164   1e-43   Solanum tuberosum [potatoes]
ref|XP_010255412.1|  PREDICTED: multiple C2 and transmembrane dom...    166   2e-43   Nelumbo nucifera [Indian lotus]
ref|XP_009383872.1|  PREDICTED: multiple C2 and transmembrane dom...    164   4e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010940465.1|  PREDICTED: multiple C2 and transmembrane dom...    164   7e-43   Elaeis guineensis
ref|XP_009386410.1|  PREDICTED: multiple C2 and transmembrane dom...    164   7e-43   
ref|XP_002511838.1|  synaptotagmin, putative                            164   8e-43   Ricinus communis
ref|XP_008806876.1|  PREDICTED: multiple C2 and transmembrane dom...    162   2e-42   Phoenix dactylifera
gb|KDP28646.1|  hypothetical protein JCGZ_14417                         162   2e-42   Jatropha curcas
emb|CBI40337.3|  unnamed protein product                                160   2e-42   Vitis vinifera
emb|CDP14088.1|  unnamed protein product                                160   4e-42   Coffea canephora [robusta coffee]
ref|XP_010105960.1|  Multiple C2 and transmembrane domain-contain...    161   5e-42   Morus notabilis
ref|XP_007052594.1|  C2 calcium/lipid-binding plant phosphoribosy...    161   5e-42   
ref|XP_011023361.1|  PREDICTED: multiple C2 and transmembrane dom...    161   6e-42   Populus euphratica
ref|XP_006850085.1|  hypothetical protein AMTR_s00022p00218970          161   7e-42   Amborella trichopoda
ref|XP_011015655.1|  PREDICTED: multiple C2 and transmembrane dom...    160   9e-42   Populus euphratica
ref|XP_007220279.1|  hypothetical protein PRUPE_ppa000771mg             160   1e-41   Prunus persica
ref|XP_008244912.1|  PREDICTED: uncharacterized protein LOC103343020    160   1e-41   Prunus mume [ume]
ref|XP_010660813.1|  PREDICTED: uncharacterized protein LOC100264973    160   2e-41   Vitis vinifera
ref|XP_002271590.1|  PREDICTED: uncharacterized protein LOC100253432    160   2e-41   Vitis vinifera
ref|XP_009393442.1|  PREDICTED: uncharacterized protein LOC103979123    160   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002301353.2|  hypothetical protein POPTR_0002s15950g             159   3e-41   Populus trichocarpa [western balsam poplar]
ref|XP_010053272.1|  PREDICTED: uncharacterized protein LOC104441758    159   3e-41   
gb|EMT30716.1|  hypothetical protein F775_31640                         159   4e-41   
dbj|BAK04937.1|  predicted protein                                      158   7e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010928529.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    158   8e-41   
emb|CAN79812.1|  hypothetical protein VITISV_018822                     158   9e-41   Vitis vinifera
gb|KDO57729.1|  hypothetical protein CISIN_1g003882mg                   156   1e-40   Citrus sinensis [apfelsine]
ref|XP_003580853.1|  PREDICTED: multiple C2 and transmembrane dom...    157   1e-40   
ref|XP_010934752.1|  PREDICTED: multiple C2 and transmembrane dom...    157   1e-40   Elaeis guineensis
ref|XP_006439068.1|  hypothetical protein CICLE_v10030600mg             157   2e-40   
ref|XP_006483676.1|  PREDICTED: multiple C2 and transmembrane dom...    157   2e-40   Citrus sinensis [apfelsine]
ref|XP_002509788.1|  synaptotagmin, putative                            157   2e-40   
ref|XP_006445078.1|  hypothetical protein CICLE_v10018672mg             157   2e-40   Citrus clementina [clementine]
gb|KDO86111.1|  hypothetical protein CISIN_1g001835mg                   157   2e-40   Citrus sinensis [apfelsine]
ref|XP_006342310.1|  PREDICTED: multiple C2 and transmembrane dom...    155   2e-40   Solanum tuberosum [potatoes]
emb|CDX81021.1|  BnaC03g02750D                                          149   2e-40   
ref|XP_007051845.1|  C2 calcium/lipid-binding plant phosphoribosy...    156   3e-40   
ref|XP_007204276.1|  hypothetical protein PRUPE_ppa001596mg             155   3e-40   Prunus persica
ref|XP_006437049.1|  hypothetical protein CICLE_v10033973mg             155   3e-40   Citrus clementina [clementine]
ref|XP_007051844.1|  C2 calcium/lipid-binding plant phosphoribosy...    156   4e-40   
gb|KDO83484.1|  hypothetical protein CISIN_1g001696mg                   155   5e-40   Citrus sinensis [apfelsine]
ref|XP_008240964.1|  PREDICTED: multiple C2 and transmembrane dom...    154   5e-40   Prunus mume [ume]
gb|KJB41306.1|  hypothetical protein B456_007G098200                    155   5e-40   Gossypium raimondii
emb|CDP08834.1|  unnamed protein product                                155   8e-40   Coffea canephora [robusta coffee]
ref|XP_007220593.1|  hypothetical protein PRUPE_ppa000616mg             155   8e-40   Prunus persica
ref|XP_008231338.1|  PREDICTED: multiple C2 and transmembrane dom...    155   8e-40   
ref|XP_009588959.1|  PREDICTED: multiple C2 and transmembrane dom...    154   8e-40   
gb|KCW51799.1|  hypothetical protein EUGRSUZ_J01251                     154   9e-40   Eucalyptus grandis [rose gum]
ref|XP_008231335.1|  PREDICTED: multiple C2 and transmembrane dom...    155   9e-40   
ref|XP_008231334.1|  PREDICTED: multiple C2 and transmembrane dom...    155   9e-40   Prunus mume [ume]
ref|XP_004235089.1|  PREDICTED: multiple C2 and transmembrane dom...    154   9e-40   Solanum lycopersicum
ref|XP_002513191.1|  synaptotagmin, putative                            155   9e-40   Ricinus communis
ref|XP_008231337.1|  PREDICTED: multiple C2 and transmembrane dom...    155   1e-39   Prunus mume [ume]
gb|KDP43429.1|  hypothetical protein JCGZ_16716                         155   1e-39   Jatropha curcas
ref|XP_010032396.1|  PREDICTED: multiple C2 and transmembrane dom...    154   1e-39   Eucalyptus grandis [rose gum]
gb|KDP24593.1|  hypothetical protein JCGZ_25509                         154   1e-39   Jatropha curcas
ref|XP_010241420.1|  PREDICTED: multiple C2 and transmembrane dom...    154   2e-39   Nelumbo nucifera [Indian lotus]
ref|XP_008795741.1|  PREDICTED: multiple C2 and transmembrane dom...    154   2e-39   
gb|AFN53655.1|  putative synaptotagmin protein                          153   2e-39   Linum usitatissimum
ref|XP_002265157.2|  PREDICTED: multiple C2 and transmembrane dom...    154   2e-39   Vitis vinifera
ref|XP_002320122.2|  hypothetical protein POPTR_0014s07750g             154   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_004309445.1|  PREDICTED: multiple C2 and transmembrane dom...    152   3e-39   Fragaria vesca subsp. vesca
ref|XP_006598248.1|  PREDICTED: multiple C2 and transmembrane dom...    153   3e-39   Glycine max [soybeans]
gb|KJB25055.1|  hypothetical protein B456_004G174500                    152   3e-39   Gossypium raimondii
gb|KHN49030.1|  Putative Ras GTPase-activating protein 4B               152   3e-39   Glycine soja [wild soybean]
ref|XP_009763246.1|  PREDICTED: uncharacterized protein LOC104215187    152   3e-39   Nicotiana sylvestris
ref|XP_004299880.1|  PREDICTED: multiple C2 and transmembrane dom...    153   4e-39   Fragaria vesca subsp. vesca
ref|XP_009611365.1|  PREDICTED: uncharacterized protein LOC104104885    152   4e-39   Nicotiana tomentosiformis
ref|XP_009391825.1|  PREDICTED: uncharacterized protein LOC103977897    153   4e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS48196.1|  Multiple C2 and transmembrane domain-containing p...    152   4e-39   Triticum urartu
ref|XP_010918556.1|  PREDICTED: uncharacterized protein LOC105042892    153   5e-39   Elaeis guineensis
gb|EMT11702.1|  hypothetical protein F775_07618                         152   6e-39   
emb|CBI24845.3|  unnamed protein product                                150   6e-39   Vitis vinifera
ref|XP_009419170.1|  PREDICTED: multiple C2 and transmembrane dom...    152   6e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010111400.1|  Multiple C2 and transmembrane domain-contain...    151   7e-39   Morus notabilis
ref|XP_002299538.2|  hypothetical protein POPTR_0001s09250g             152   7e-39   
ref|XP_011007360.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    152   7e-39   Populus euphratica
ref|XP_009354691.1|  PREDICTED: multiple C2 and transmembrane dom...    152   7e-39   Pyrus x bretschneideri [bai li]
ref|XP_011029251.1|  PREDICTED: multiple C2 and transmembrane dom...    152   9e-39   Populus euphratica
ref|XP_010534658.1|  PREDICTED: multiple C2 and transmembrane dom...    150   1e-38   Tarenaya hassleriana [spider flower]
ref|XP_011078852.1|  PREDICTED: multiple C2 and transmembrane dom...    151   1e-38   Sesamum indicum [beniseed]
ref|XP_004228622.1|  PREDICTED: multiple C2 and transmembrane dom...    151   1e-38   
emb|CDY70344.1|  BnaA03g55080D                                          149   1e-38   Brassica napus [oilseed rape]
ref|XP_009773349.1|  PREDICTED: multiple C2 and transmembrane dom...    151   1e-38   Nicotiana sylvestris
emb|CDP07723.1|  unnamed protein product                                152   1e-38   Coffea canephora [robusta coffee]
ref|XP_008392066.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    150   1e-38   
ref|XP_008350856.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    152   1e-38   
ref|XP_004497937.1|  PREDICTED: multiple C2 and transmembrane dom...    150   1e-38   Cicer arietinum [garbanzo]
emb|CDY01973.1|  BnaC02g27540D                                          151   1e-38   
ref|XP_008461778.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    152   1e-38   Cucumis melo [Oriental melon]
ref|XP_006379108.1|  C2 domain-containing family protein                152   1e-38   
gb|EYU20710.1|  hypothetical protein MIMGU_mgv1a023485mg                150   2e-38   Erythranthe guttata [common monkey flower]
ref|XP_008383982.1|  PREDICTED: multiple C2 and transmembrane dom...    151   2e-38   
ref|XP_009339918.1|  PREDICTED: multiple C2 and transmembrane dom...    151   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_004138509.1|  PREDICTED: uncharacterized protein LOC101203632    151   2e-38   
ref|XP_011025029.1|  PREDICTED: uncharacterized protein LOC105126...    151   2e-38   Populus euphratica
ref|XP_008458254.1|  PREDICTED: uncharacterized protein LOC103497726    151   2e-38   Cucumis melo [Oriental melon]
ref|XP_010104492.1|  Multiple C2 and transmembrane domain-contain...    151   2e-38   
ref|XP_004166328.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    151   2e-38   
ref|XP_008778754.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    151   2e-38   
ref|XP_002532394.1|  synaptotagmin, putative                            150   2e-38   Ricinus communis
ref|XP_011468807.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    151   2e-38   Fragaria vesca subsp. vesca
ref|XP_010659323.1|  PREDICTED: multiple C2 and transmembrane dom...    150   2e-38   Vitis vinifera
ref|XP_006348415.1|  PREDICTED: multiple C2 and transmembrane dom...    149   3e-38   Solanum tuberosum [potatoes]
ref|XP_010273065.1|  PREDICTED: uncharacterized protein LOC104608707    150   3e-38   Nelumbo nucifera [Indian lotus]
gb|EYU23487.1|  hypothetical protein MIMGU_mgv1a000757mg                150   3e-38   Erythranthe guttata [common monkey flower]
gb|KDP35107.1|  hypothetical protein JCGZ_10949                         150   3e-38   Jatropha curcas
ref|XP_007028936.1|  C2 calcium/lipid-binding plant phosphoribosy...    150   3e-38   
ref|XP_002298449.2|  C2 domain-containing family protein                150   4e-38   Populus trichocarpa [western balsam poplar]
ref|XP_010057923.1|  PREDICTED: multiple C2 and transmembrane dom...    149   4e-38   Eucalyptus grandis [rose gum]
ref|XP_011025028.1|  PREDICTED: multiple C2 and transmembrane dom...    150   4e-38   Populus euphratica
gb|EYU31344.1|  hypothetical protein MIMGU_mgv1a023675mg                149   4e-38   Erythranthe guttata [common monkey flower]
ref|XP_009130968.1|  PREDICTED: multiple C2 and transmembrane dom...    149   5e-38   Brassica rapa
ref|XP_009420494.1|  PREDICTED: uncharacterized protein LOC104000227    150   5e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008393597.1|  PREDICTED: uncharacterized protein LOC103455751    150   5e-38   
ref|XP_011093373.1|  PREDICTED: multiple C2 and transmembrane dom...    150   5e-38   Sesamum indicum [beniseed]
ref|XP_009128492.1|  PREDICTED: uncharacterized protein LOC103853319    150   5e-38   Brassica rapa
ref|XP_011093374.1|  PREDICTED: multiple C2 and transmembrane dom...    150   6e-38   
gb|KJB36093.1|  hypothetical protein B456_006G140900                    149   6e-38   Gossypium raimondii
gb|EPS70383.1|  hypothetical protein M569_04376                         149   6e-38   Genlisea aurea
ref|XP_008238857.1|  PREDICTED: multiple C2 and transmembrane dom...    150   6e-38   Prunus mume [ume]
ref|XP_007040201.1|  C2 calcium/lipid-binding plant phosphoribosy...    150   6e-38   
emb|CDP10108.1|  unnamed protein product                                149   6e-38   Coffea canephora [robusta coffee]
ref|XP_008460789.1|  PREDICTED: multiple C2 and transmembrane dom...    148   6e-38   Cucumis melo [Oriental melon]
ref|XP_006439066.1|  hypothetical protein CICLE_v10033918mg             149   7e-38   Citrus clementina [clementine]
gb|KDP25449.1|  hypothetical protein JCGZ_20605                         149   7e-38   Jatropha curcas
ref|XP_007210407.1|  hypothetical protein PRUPE_ppa000781mg             149   7e-38   Prunus persica
ref|XP_006483675.1|  PREDICTED: multiple C2 and transmembrane dom...    148   7e-38   Citrus sinensis [apfelsine]
gb|KDO83486.1|  hypothetical protein CISIN_1g004208mg                   148   8e-38   Citrus sinensis [apfelsine]
ref|XP_008387247.1|  PREDICTED: multiple C2 and transmembrane dom...    149   8e-38   
ref|XP_008375143.1|  PREDICTED: multiple C2 and transmembrane dom...    149   9e-38   
ref|XP_011033255.1|  PREDICTED: multiple C2 and transmembrane dom...    148   9e-38   Populus euphratica
ref|XP_004150160.1|  PREDICTED: multiple C2 and transmembrane dom...    148   1e-37   Cucumis sativus [cucumbers]
ref|XP_009379435.1|  PREDICTED: multiple C2 and transmembrane dom...    149   1e-37   
ref|XP_008460787.1|  PREDICTED: multiple C2 and transmembrane dom...    148   1e-37   
ref|XP_010244838.1|  PREDICTED: multiple C2 and transmembrane dom...    149   1e-37   
ref|NP_001054305.1|  Os04g0683800                                       149   1e-37   
ref|XP_006381052.1|  hypothetical protein POPTR_0006s05760g             148   1e-37   
gb|EEC78281.1|  hypothetical protein OsI_17979                          149   1e-37   
ref|XP_002277970.2|  PREDICTED: multiple C2 and transmembrane dom...    148   1e-37   
emb|CAN75086.1|  hypothetical protein VITISV_010815                     148   1e-37   
emb|CAJ86177.1|  H0306F12.8                                             149   1e-37   
emb|CDY54062.1|  BnaA02g36480D                                          149   1e-37   
gb|KJB24704.1|  hypothetical protein B456_004G157900                    148   1e-37   
ref|XP_007020084.1|  C2 calcium/lipid-binding plant phosphoribosy...    149   1e-37   
gb|EEE61934.1|  hypothetical protein OsJ_16678                          149   1e-37   
ref|XP_004161406.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    149   1e-37   
ref|XP_006289911.1|  hypothetical protein CARUB_v10003526mg             149   2e-37   
ref|XP_004149608.1|  PREDICTED: multiple C2 and transmembrane dom...    149   2e-37   
ref|XP_009350731.1|  PREDICTED: extended synaptotagmin-1-like           148   2e-37   
emb|CAB39932.1|  putative phosphoribosylanthranilate transferase        148   2e-37   
gb|KHG10339.1|  Multiple C2 and transmembrane domain-containing 1       149   2e-37   
ref|XP_010434689.1|  PREDICTED: multiple C2 and transmembrane dom...    148   2e-37   
ref|XP_007145658.1|  hypothetical protein PHAVU_007G257600g             147   2e-37   
ref|XP_010455572.1|  PREDICTED: multiple C2 and transmembrane dom...    148   2e-37   
gb|KEH16165.1|  calcium-dependent lipid-binding (CaLB domain) fam...    147   2e-37   
gb|KJB24703.1|  hypothetical protein B456_004G157900                    148   2e-37   
ref|XP_010943582.1|  PREDICTED: multiple C2 and transmembrane dom...    147   2e-37   
gb|KJB25820.1|  hypothetical protein B456_004G210900                    148   2e-37   
ref|NP_192898.2|  C2 calcium/lipid-binding plant phosphoribosyltr...    148   2e-37   
ref|XP_006653047.1|  PREDICTED: uncharacterized protein LOC102701166    148   2e-37   
ref|NP_001168012.1|  uncharacterized protein LOC100381735               148   2e-37   
ref|XP_003518076.1|  PREDICTED: multiple C2 and transmembrane dom...    147   2e-37   
ref|XP_008775338.1|  PREDICTED: uncharacterized protein LOC103695724    148   2e-37   
ref|XP_003537180.1|  PREDICTED: multiple C2 and transmembrane dom...    147   3e-37   
ref|XP_008800662.1|  PREDICTED: multiple C2 and transmembrane dom...    147   3e-37   
ref|XP_011020275.1|  PREDICTED: multiple C2 and transmembrane dom...    147   3e-37   
gb|KHG05718.1|  Multiple C2 and transmembrane domain-containing 1       147   3e-37   
emb|CBI18160.3|  unnamed protein product                                147   3e-37   
ref|XP_009362439.1|  PREDICTED: uncharacterized protein LOC103952559    148   3e-37   
ref|XP_002273003.1|  PREDICTED: multiple C2 and transmembrane dom...    147   3e-37   
ref|XP_006399161.1|  hypothetical protein EUTSA_v10012726mg             147   4e-37   
ref|XP_009386055.1|  PREDICTED: uncharacterized protein LOC103973268    147   4e-37   
ref|XP_008368132.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    147   4e-37   
ref|XP_009369878.1|  PREDICTED: multiple C2 and transmembrane dom...    147   4e-37   
gb|KHM98828.1|  Multiple C2 and transmembrane domain-containing p...    147   4e-37   
ref|XP_002323292.2|  hypothetical protein POPTR_0016s04980g             146   4e-37   
ref|XP_006585748.1|  PREDICTED: multiple C2 and transmembrane dom...    147   4e-37   
ref|XP_004306799.1|  PREDICTED: uncharacterized protein LOC101305880    147   5e-37   
ref|XP_008663748.1|  PREDICTED: uncharacterized protein LOC103642209    147   6e-37   
ref|XP_011080250.1|  PREDICTED: multiple C2 and transmembrane dom...    146   6e-37   
gb|ADT92187.1|  unknown                                                 147   6e-37   
ref|XP_002873282.1|  hypothetical protein ARALYDRAFT_908616             146   6e-37   
gb|KHN15528.1|  Multiple C2 and transmembrane domain-containing p...    146   7e-37   
ref|NP_568175.2|  FT-interacting protein 1                              146   7e-37   
ref|XP_010452629.1|  PREDICTED: multiple C2 and transmembrane dom...    146   7e-37   
ref|XP_006287093.1|  hypothetical protein CARUB_v10000256mg             146   7e-37   
ref|XP_010423287.1|  PREDICTED: multiple C2 and transmembrane dom...    146   7e-37   
ref|XP_011035993.1|  PREDICTED: multiple C2 and transmembrane dom...    146   9e-37   
ref|XP_002521817.1|  synaptotagmin, putative                            146   9e-37   
ref|XP_007158492.1|  hypothetical protein PHAVU_002G157000g             146   1e-36   
ref|XP_011022713.1|  PREDICTED: multiple C2 and transmembrane dom...    145   1e-36   
ref|XP_004506488.1|  PREDICTED: uncharacterized protein LOC101502479    146   1e-36   
gb|EYU46304.1|  hypothetical protein MIMGU_mgv1a001691mg                145   1e-36   
ref|XP_010491269.1|  PREDICTED: multiple C2 and transmembrane dom...    145   1e-36   
ref|XP_010928846.1|  PREDICTED: multiple C2 and transmembrane dom...    145   2e-36   
ref|XP_011022711.1|  PREDICTED: multiple C2 and transmembrane dom...    145   2e-36   
emb|CDY13273.1|  BnaC09g23830D                                          142   2e-36   
ref|XP_002874704.1|  NADPH-dependent thioredoxin reductase B            145   2e-36   
gb|KHN35016.1|  Multiple C2 and transmembrane domain-containing p...    145   2e-36   
ref|XP_010113221.1|  Multiple C2 and transmembrane domain-contain...    145   2e-36   
ref|XP_010682327.1|  PREDICTED: multiple C2 and transmembrane dom...    145   2e-36   
ref|XP_003538346.1|  PREDICTED: uncharacterized protein LOC100777...    145   2e-36   
ref|XP_010908865.1|  PREDICTED: uncharacterized protein LOC105035134    145   2e-36   
ref|XP_006585342.1|  PREDICTED: multiple C2 and transmembrane dom...    145   2e-36   
ref|XP_007225292.1|  hypothetical protein PRUPE_ppa001339mg             145   2e-36   
ref|XP_004298739.1|  PREDICTED: uncharacterized protein LOC101313...    145   2e-36   
ref|XP_008378754.1|  PREDICTED: uncharacterized protein LOC103441820    145   2e-36   
ref|XP_006586753.1|  PREDICTED: multiple C2 and transmembrane dom...    145   2e-36   
ref|XP_008649064.1|  PREDICTED: uncharacterized protein LOC103629...    144   3e-36   
ref|XP_004960016.1|  PREDICTED: uncharacterized protein LOC101781...    145   3e-36   
gb|KHN19431.1|  Multiple C2 and transmembrane domain-containing p...    145   3e-36   
gb|ABD33426.2|  C2                                                      145   3e-36   
gb|AES80126.2|  calcium-dependent lipid-binding (CaLB domain) fam...    145   3e-36   
ref|XP_008219001.1|  PREDICTED: multiple C2 and transmembrane dom...    145   3e-36   
gb|KFK44354.1|  hypothetical protein AALP_AA1G246600                    145   3e-36   
ref|XP_003623908.1|  Extended synaptotagmin-2                           145   3e-36   
ref|XP_006574306.1|  PREDICTED: uncharacterized protein LOC100817962    144   3e-36   
ref|XP_002303582.2|  C2 domain-containing family protein                145   4e-36   
ref|XP_004250430.1|  PREDICTED: multiple C2 and transmembrane dom...    144   4e-36   
emb|CAN71789.1|  hypothetical protein VITISV_004288                     144   4e-36   
ref|XP_009346959.1|  PREDICTED: uncharacterized protein LOC103938656    144   6e-36   
ref|XP_010324263.1|  PREDICTED: multiple C2 and transmembrane dom...    144   7e-36   
ref|XP_003635987.1|  Multiple C2 and transmembrane domain-contain...    144   7e-36   
ref|XP_006396881.1|  hypothetical protein EUTSA_v10028390mg             144   7e-36   
ref|XP_004511581.1|  PREDICTED: multiple C2 and transmembrane dom...    144   9e-36   
ref|XP_006304546.1|  hypothetical protein CARUB_v10011531mg             144   1e-35   
gb|KJB60077.1|  hypothetical protein B456_009G288400                    143   1e-35   
ref|XP_010672707.1|  PREDICTED: multiple C2 and transmembrane dom...    142   1e-35   
ref|XP_009418126.1|  PREDICTED: uncharacterized protein LOC103998104    142   1e-35   
ref|XP_009781014.1|  PREDICTED: uncharacterized protein LOC104229981    143   1e-35   
gb|KFK31919.1|  hypothetical protein AALP_AA6G176000                    143   2e-35   
gb|KFK31920.1|  hypothetical protein AALP_AA6G176000                    143   2e-35   
ref|XP_010529565.1|  PREDICTED: multiple C2 and transmembrane dom...    143   2e-35   
ref|XP_010529567.1|  PREDICTED: multiple C2 and transmembrane dom...    142   2e-35   
gb|EAZ37635.1|  hypothetical protein OsJ_21968                          142   2e-35   
gb|AAC25524.1|  Strong similarity to phosphoribosylanthranilate t...    142   2e-35   
gb|EAZ01666.1|  hypothetical protein OsI_23701                          142   2e-35   
ref|XP_008799189.1|  PREDICTED: uncharacterized protein LOC103713915    142   2e-35   
ref|XP_004514073.1|  PREDICTED: multiple C2 and transmembrane dom...    142   2e-35   
ref|XP_009108158.1|  PREDICTED: uncharacterized protein LOC103833855    142   3e-35   
emb|CDX86768.1|  BnaA09g21580D                                          142   3e-35   
ref|XP_007149059.1|  hypothetical protein PHAVU_005G037500g             141   3e-35   
ref|XP_010682530.1|  PREDICTED: uncharacterized protein LOC104897368    141   3e-35   
ref|NP_173675.1|  C2 calcium/lipid-binding plant phosphoribosyltr...    142   3e-35   
ref|XP_010544470.1|  PREDICTED: LOW QUALITY PROTEIN: extended syn...    142   3e-35   
ref|XP_009399655.1|  PREDICTED: multiple C2 and transmembrane dom...    141   3e-35   
ref|XP_009587334.1|  PREDICTED: uncharacterized protein LOC104085087    142   3e-35   
gb|EYU22793.1|  hypothetical protein MIMGU_mgv1a000783mg                142   4e-35   
ref|XP_008781559.1|  PREDICTED: multiple C2 and transmembrane dom...    142   4e-35   
ref|XP_003607066.1|  Anthranilate phosphoribosyltransferase-like ...    140   4e-35   
ref|XP_006592975.1|  PREDICTED: multiple C2 and transmembrane dom...    141   4e-35   
ref|XP_010477520.1|  PREDICTED: multiple C2 and transmembrane dom...    142   4e-35   
ref|XP_009115621.1|  PREDICTED: multiple C2 and transmembrane dom...    142   4e-35   
emb|CDY21373.1|  BnaA09g30540D                                          141   5e-35   
ref|XP_002890521.1|  C2 domain-containing protein                       141   5e-35   
ref|XP_010053690.1|  PREDICTED: multiple C2 and transmembrane dom...    141   5e-35   
emb|CDP09751.1|  unnamed protein product                                141   5e-35   
ref|XP_010498740.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    142   5e-35   
ref|XP_010672799.1|  PREDICTED: multiple C2 and transmembrane dom...    141   5e-35   
ref|XP_007131292.1|  hypothetical protein PHAVU_011G001600g             141   5e-35   
emb|CDP10669.1|  unnamed protein product                                141   5e-35   
ref|XP_003539651.1|  PREDICTED: multiple C2 and transmembrane dom...    142   5e-35   
ref|XP_006416181.1|  hypothetical protein EUTSA_v10006627mg             141   6e-35   
gb|KHN32471.1|  Multiple C2 and transmembrane domain-containing p...    141   8e-35   
ref|XP_003539945.1|  PREDICTED: multiple C2 and transmembrane dom...    141   8e-35   
gb|ACN88792.1|  putative C2 domain-containing protein                   132   9e-35   
ref|XP_004162856.1|  PREDICTED: uncharacterized protein LOC101229308    140   9e-35   
ref|XP_003611102.1|  Glutathione peroxidase                             140   9e-35   
ref|XP_010460017.1|  PREDICTED: multiple C2 and transmembrane dom...    140   9e-35   
ref|XP_008376022.1|  PREDICTED: uncharacterized protein LOC103439257    140   1e-34   
ref|XP_008356954.1|  PREDICTED: uncharacterized protein LOC103420681    140   1e-34   
ref|XP_006366499.1|  PREDICTED: multiple C2 and transmembrane dom...    140   1e-34   
ref|XP_010910862.1|  PREDICTED: uncharacterized protein LOC105036827    140   1e-34   
ref|XP_003580895.1|  PREDICTED: multiple C2 and transmembrane dom...    140   1e-34   
ref|XP_003605062.1|  Phosphoribosyltransferase                          140   1e-34   
gb|KDO38276.1|  hypothetical protein CISIN_1g045512mg                   140   1e-34   
ref|XP_004141565.1|  PREDICTED: uncharacterized protein LOC101209530    140   1e-34   
gb|AES87259.2|  calcium-dependent lipid-binding (CaLB domain) fam...    140   1e-34   
gb|KDO76164.1|  hypothetical protein CISIN_1g045058mg                   140   1e-34   
ref|XP_006439584.1|  hypothetical protein CICLE_v10023869mg             140   1e-34   
ref|XP_006476597.1|  PREDICTED: multiple C2 and transmembrane dom...    140   2e-34   
ref|XP_006473257.1|  PREDICTED: multiple C2 and transmembrane dom...    140   2e-34   
ref|XP_010695175.1|  PREDICTED: multiple C2 and transmembrane dom...    140   2e-34   
ref|XP_011001083.1|  PREDICTED: multiple C2 and transmembrane dom...    140   2e-34   
gb|KHN26368.1|  Multiple C2 and transmembrane domain-containing p...    139   2e-34   
gb|EMS62772.1|  Multiple C2 and transmembrane domain-containing p...    139   2e-34   
ref|XP_010557779.1|  PREDICTED: extended synaptotagmin-1                139   2e-34   
ref|XP_009623389.1|  PREDICTED: uncharacterized protein LOC104114611    139   3e-34   
ref|XP_008782890.1|  PREDICTED: multiple C2 and transmembrane dom...    139   3e-34   
ref|XP_006434685.1|  hypothetical protein CICLE_v10000346mg             138   3e-34   
ref|XP_008459677.1|  PREDICTED: multiple C2 and transmembrane dom...    139   3e-34   
dbj|BAJ93730.1|  predicted protein                                      138   4e-34   
gb|ABR16393.1|  unknown                                                 138   4e-34   
emb|CBI34680.3|  unnamed protein product                                139   4e-34   
ref|XP_004486232.1|  PREDICTED: uncharacterized protein LOC101498310    138   5e-34   
ref|XP_006434690.1|  hypothetical protein CICLE_v10000127mg             139   5e-34   
ref|XP_006350321.1|  PREDICTED: extended synaptotagmin-1-like           138   6e-34   
ref|XP_009399173.1|  PREDICTED: multiple C2 and transmembrane dom...    138   7e-34   
ref|XP_010063756.1|  PREDICTED: multiple C2 and transmembrane dom...    138   7e-34   
ref|XP_003599053.1|  Glutathione peroxidase                             137   7e-34   
gb|EPS58331.1|  hypothetical protein M569_16484                         138   8e-34   
ref|XP_006376235.1|  hypothetical protein POPTR_0013s11220g             138   9e-34   
gb|EPS65173.1|  hypothetical protein M569_09603                         138   1e-33   
emb|CDY04800.1|  BnaC05g17890D                                          137   1e-33   
ref|XP_011092017.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    137   2e-33   
gb|KEH29978.1|  anthranilate phosphoribosyltransferase-like protein     136   2e-33   
ref|XP_008783369.1|  PREDICTED: uncharacterized protein LOC103702639    137   2e-33   
emb|CDX74344.1|  BnaA03g27030D                                          137   2e-33   
ref|XP_010534142.1|  PREDICTED: multiple C2 and transmembrane dom...    137   2e-33   
ref|XP_011074957.1|  PREDICTED: multiple C2 and transmembrane dom...    137   2e-33   
gb|KHN29203.1|  Putative Ras GTPase-activating protein 4B               136   2e-33   
ref|XP_004965887.1|  PREDICTED: uncharacterized protein LOC101774861    136   2e-33   
ref|XP_009134537.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    137   2e-33   
ref|XP_008225796.1|  PREDICTED: uncharacterized protein LOC103325419    137   3e-33   
ref|XP_007133848.1|  hypothetical protein PHAVU_011G214100g             136   3e-33   
ref|XP_007052573.1|  Calcium-dependent lipid-binding (CaLB domain...    135   3e-33   
gb|EYU35083.1|  hypothetical protein MIMGU_mgv1a025230mg                136   3e-33   
ref|XP_010535240.1|  PREDICTED: multiple C2 and transmembrane dom...    136   4e-33   
emb|CDX91899.1|  BnaC03g32010D                                          136   4e-33   
ref|XP_011096361.1|  PREDICTED: multiple C2 and transmembrane dom...    136   4e-33   
dbj|BAJ91162.1|  predicted protein                                      136   4e-33   
ref|XP_007133849.1|  hypothetical protein PHAVU_011G214100g             136   5e-33   
gb|EPS65882.1|  hypothetical protein M569_08887                         135   6e-33   
gb|EMS45806.1|  Multiple C2 and transmembrane domain-containing p...    136   6e-33   
ref|XP_007214091.1|  hypothetical protein PRUPE_ppa015408mg             135   6e-33   
ref|XP_004506399.1|  PREDICTED: uncharacterized protein LOC101494825    136   7e-33   
ref|XP_010930774.1|  PREDICTED: multiple C2 and transmembrane dom...    135   8e-33   
dbj|BAK01357.1|  predicted protein                                      135   1e-32   
ref|XP_009795430.1|  PREDICTED: multiple C2 and transmembrane dom...    135   1e-32   
ref|XP_007217305.1|  hypothetical protein PRUPE_ppa015370mg             134   1e-32   
ref|XP_009798416.1|  PREDICTED: multiple C2 and transmembrane dom...    134   1e-32   
ref|XP_009596255.1|  PREDICTED: multiple C2 and transmembrane dom...    134   1e-32   
ref|XP_003563116.1|  PREDICTED: uncharacterized protein LOC100824776    134   2e-32   
ref|NP_191689.1|  C2 calcium/lipid-binding and phosphoribosyltran...    134   2e-32   
ref|XP_010672179.1|  PREDICTED: multiple C2 and transmembrane dom...    134   2e-32   
ref|XP_007033953.1|  Calcium-dependent lipid-binding (CaLB domain...    133   2e-32   
ref|XP_002875019.1|  C2 domain-containing protein                       134   2e-32   
ref|XP_006279938.1|  hypothetical protein CARUB_v10025796mg             133   3e-32   
ref|XP_003563626.1|  PREDICTED: uncharacterized protein LOC100829273    133   3e-32   
ref|XP_004229889.1|  PREDICTED: multiple C2 and transmembrane dom...    133   3e-32   
gb|EYU32100.1|  hypothetical protein MIMGU_mgv1a000762mg                133   4e-32   
ref|XP_009779007.1|  PREDICTED: multiple C2 and transmembrane dom...    133   4e-32   
ref|XP_006286981.1|  hypothetical protein CARUB_v10000130mg             133   4e-32   
ref|XP_010419620.1|  PREDICTED: uncharacterized protein LOC104705332    133   4e-32   
ref|XP_006339547.1|  PREDICTED: multiple C2 and transmembrane dom...    133   4e-32   
gb|KEH29293.1|  calcium-dependent lipid-binding (CaLB domain) fam...    133   4e-32   
ref|XP_010482053.1|  PREDICTED: uncharacterized protein LOC104760786    133   5e-32   
emb|CDP07720.1|  unnamed protein product                                132   5e-32   
ref|XP_006286982.1|  hypothetical protein CARUB_v10000130mg             133   5e-32   
ref|XP_002452787.1|  hypothetical protein SORBIDRAFT_04g032530          132   6e-32   
gb|EYU28228.1|  hypothetical protein MIMGU_mgv1a000659mg                132   6e-32   
ref|XP_010442223.1|  PREDICTED: uncharacterized protein LOC104725290    132   6e-32   
ref|XP_010062431.1|  PREDICTED: uncharacterized protein LOC104449847    132   6e-32   



>ref|XP_004249277.1| PREDICTED: extended synaptotagmin-1-like [Solanum lycopersicum]
Length=775

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNY+GTTRHFEKKSNPEWNQVFAFSKERIQAS+LEV VKDKDF KDD VGRV
Sbjct  61   DPYVEVRLGNYRGTTRHFEKKSNPEWNQVFAFSKERIQASVLEVNVKDKDFIKDDFVGRV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  MFDL  124



>ref|XP_006351337.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum tuberosum]
Length=774

 Score =   215 bits (547),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPPQEDF LKETKPHLGGGK+ GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVMGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSL  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNY+GTTRHFEKKSNPEWNQVFAFSKERIQAS+LEV VKDKDF KDD VGRV
Sbjct  61   DPYVEVRLGNYRGTTRHFEKKSNPEWNQVFAFSKERIQASVLEVNVKDKDFIKDDFVGRV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  MFDL  124



>ref|XP_009594768.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=774

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNY+GTTRHFEKKSNPEW+QVFAFSK+RIQAS+LEV VKDKD  KDD VGRV
Sbjct  61   DPYVEVRLGNYRGTTRHFEKKSNPEWSQVFAFSKDRIQASVLEVTVKDKDLVKDDFVGRV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  MFDL  124



>ref|XP_009799235.1| PREDICTED: extended synaptotagmin-1-like [Nicotiana sylvestris]
Length=776

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNY+GTTRHFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKD  KDD VGR 
Sbjct  61   DPYVEVRLGNYRGTTRHFEKKSNPEWNQVFAFSKDRIQASVLEVTVKDKDLVKDDFVGRY  120

Query  553  VFDL  564
            +FDL
Sbjct  121  MFDL  124



>ref|XP_009587222.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
 ref|XP_009587223.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=773

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPPQEDF LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKARDLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKARDLPGKDVTGSL  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNYKGTTRHFEKKSNPEW+QVFAFSK+RIQAS+LEV VKDKD  KDD VGRV
Sbjct  61   DPYVEVRLGNYKGTTRHFEKKSNPEWSQVFAFSKDRIQASVLEVTVKDKDVVKDDFVGRV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  LFDL  124



>ref|XP_011078851.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Sesamum indicum]
Length=772

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPPQEDF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPQEDFSLKETNPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQAS+LEV VKDKD  KDD +GRV
Sbjct  61   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASVLEVTVKDKDVVKDDFIGRV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  LFDL  124



>ref|XP_011020270.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
 ref|XP_011020271.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=775

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQ+PPQ+DF+LKET PHLGGGKITGDKLTSTYDLVEQM YLYVRVVKA+DLP KDVTGS 
Sbjct  2    MQKPPQDDFLLKETYPHLGGGKITGDKLTSTYDLVEQMHYLYVRVVKAKDLPAKDVTGSC  61

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV VKDKD  KDD +GRV
Sbjct  62   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVTVKDKDLVKDDFIGRV  121

Query  553  VFDL  564
            +FD+
Sbjct  122  LFDM  125



>ref|XP_006381053.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|ERP58850.1| C2 domain-containing family protein [Populus trichocarpa]
Length=775

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQ+PPQ+DF+LKET PHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  2    MQKPPQDDFLLKETNPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  61

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSKERIQASMLEV VKDKD  KDD +GRV
Sbjct  62   DPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKERIQASMLEVTVKDKDLVKDDFIGRV  121

Query  553  VFDL  564
            +FD+
Sbjct  122  LFDM  125



>ref|XP_004249163.1| PREDICTED: extended synaptotagmin-1-like [Solanum lycopersicum]
Length=772

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRP QEDF LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPHQEDFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSL  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEW+QVFAFSK+RIQAS+LEVIVKDKDF KDD VGRV
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKSNPEWSQVFAFSKDRIQASVLEVIVKDKDFVKDDFVGRV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  LFDL  124



>ref|XP_009614150.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=774

 Score =   213 bits (542),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNY+GTTRHFEKKSNPEW+QVFAFSK+RIQAS+LEV VKDKDF KDD VGRV
Sbjct  61   DPYVEVRLGNYRGTTRHFEKKSNPEWSQVFAFSKDRIQASVLEVNVKDKDFVKDDFVGRV  120

Query  553  VFDL  564
             FDL
Sbjct  121  TFDL  124



>gb|EYU20709.1| hypothetical protein MIMGU_mgv1a001689mg [Erythranthe guttata]
Length=772

 Score =   213 bits (541),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDV GS 
Sbjct  1    MQRPPHEDFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVAGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS+LEV +KDKDF KDD +GRV
Sbjct  61   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASVLEVNIKDKDFVKDDFIGRV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>ref|XP_004249278.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum lycopersicum]
Length=774

 Score =   213 bits (541),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPPQEDF+LKETKPHLGGGK+ GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFLLKETKPHLGGGKVMGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNY+GTTRHFEKKSNPEW+QVFAFSK+RIQAS+LEV VKDKDF KDD VGRV
Sbjct  61   DPYVEVRLGNYRGTTRHFEKKSNPEWSQVFAFSKDRIQASVLEVNVKDKDFIKDDFVGRV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  MFDL  124



>emb|CBI30044.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   205 bits (521),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            M RPP +DF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MHRPPPDDFSLKETSPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTT HFEKK+NPEWN+VFAFSK+R+QASMLEVIVKDKDF KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTPHFEKKTNPEWNRVFAFSKDRMQASMLEVIVKDKDFVKDDYIGRV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>ref|XP_010463385.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=431

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLY RVVKA+DLP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYARVVKAKDLPGKDLTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNY+GTTRHFEKKSNPEWNQVFAFSK+R+QAS LE  VKDKD  KDD +GRV
Sbjct  61   DPYVEVKLGNYRGTTRHFEKKSNPEWNQVFAFSKDRVQASYLEATVKDKDLVKDDLIGRV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>ref|XP_006362239.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Solanum tuberosum]
Length=773

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRP QEDF LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPHQEDFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSL  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEW+QVFAFSK+RIQAS+LEV VKDKDF KDD VGRV
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKSNPEWSQVFAFSKDRIQASVLEVTVKDKDFVKDDFVGRV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  LFDL  124



>ref|XP_007162297.1| hypothetical protein PHAVU_001G140200g [Phaseolus vulgaris]
 gb|ESW34291.1| hypothetical protein PHAVU_001G140200g [Phaseolus vulgaris]
Length=775

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPY EV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKD  +DD +GRV
Sbjct  61   DPYTEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASILEVTVKDKDVVRDDFIGRV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  LFDL  124



>ref|XP_009785357.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
 ref|XP_009785358.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
 ref|XP_009785359.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
Length=774

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNY+GTTRHFEKKSNPEW QVFAFSK+RIQAS+LEV VKDKD  KDD VG V
Sbjct  61   DPYVEVRLGNYRGTTRHFEKKSNPEWRQVFAFSKDRIQASVLEVTVKDKDLVKDDFVGCV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  MFDL  124



>ref|XP_006351338.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum tuberosum]
Length=773

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPPQEDF+LKETKPHLGGGK+ GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPQEDFLLKETKPHLGGGKVMGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNYKGTTRHFEKKSNPEW+QVFAFSK+RIQAS+LEV VKDKDF KDD VG V
Sbjct  61   DPYVEVRLGNYKGTTRHFEKKSNPEWSQVFAFSKDRIQASVLEVNVKDKDFIKDDFVGCV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  MFDL  124



>ref|XP_010057953.1| PREDICTED: extended synaptotagmin-1-like [Eucalyptus grandis]
 ref|XP_010057962.1| PREDICTED: extended synaptotagmin-1-like [Eucalyptus grandis]
 ref|XP_010057968.1| PREDICTED: extended synaptotagmin-1-like [Eucalyptus grandis]
 gb|KCW90293.1| hypothetical protein EUGRSUZ_A02437 [Eucalyptus grandis]
Length=777

 Score =   210 bits (534),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            M RPP  EDF LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS
Sbjct  2    MHRPPHLEDFALKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGS  61

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
            LDPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+R+QASMLE+IVKDKD  KDD VGR
Sbjct  62   LDPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRLQASMLEIIVKDKDLAKDDFVGR  121

Query  550  VVFDL  564
            VVFDL
Sbjct  122  VVFDL  126



>gb|KHN07409.1| Multiple C2 and transmembrane domain-containing protein 2 [Glycine 
soja]
Length=775

 Score =   210 bits (534),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPY EV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKD  KDD +GRV
Sbjct  61   DPYTEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASILEVTVKDKDVVKDDFIGRV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  LFDL  124



>ref|XP_007201936.1| hypothetical protein PRUPE_ppa001850mg [Prunus persica]
 gb|EMJ03135.1| hypothetical protein PRUPE_ppa001850mg [Prunus persica]
Length=756

 Score =   209 bits (533),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNYKG TRHFEKKSNPEWNQVFAFSK+RIQAS+LEVIVKDKD  KDD +GRV
Sbjct  61   DPYVEVRLGNYKGATRHFEKKSNPEWNQVFAFSKDRIQASVLEVIVKDKDVVKDDFMGRV  120

Query  553  VFDL  564
             FDL
Sbjct  121  SFDL  124



>ref|XP_003554197.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Glycine max]
Length=775

 Score =   209 bits (533),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPY EV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKD  KDD +GRV
Sbjct  61   DPYTEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASILEVTVKDKDVVKDDFIGRV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  LFDL  124



>ref|XP_008240960.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
Length=774

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNYKG TRHFEKKSNPEWNQVFAFSK+RIQAS+LEVIVKDKD  KDD +GRV
Sbjct  61   DPYVEVRLGNYKGATRHFEKKSNPEWNQVFAFSKDRIQASVLEVIVKDKDVVKDDFMGRV  120

Query  553  VFDL  564
             FDL
Sbjct  121  SFDL  124



>ref|XP_009369854.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=774

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKARDLP KD TGS 
Sbjct  1    MQRPPPEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKARDLPAKDATGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKG TRHFEKKSNPEWNQVFAFSK+RIQA++LEVIVKDKD  KDD +GRV
Sbjct  61   DPYVEVKLGNYKGATRHFEKKSNPEWNQVFAFSKDRIQATVLEVIVKDKDLMKDDFMGRV  120

Query  553  VFDL  564
             FDL
Sbjct  121  SFDL  124



>ref|XP_011033252.1| PREDICTED: extended synaptotagmin-1 [Populus euphratica]
 ref|XP_011033253.1| PREDICTED: extended synaptotagmin-1 [Populus euphratica]
 ref|XP_011033254.1| PREDICTED: extended synaptotagmin-1 [Populus euphratica]
Length=774

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRP  EDF+LKET PHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPLHEDFLLKETNPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQASMLEV VKDKDF KDD +GR+
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASMLEVTVKDKDFVKDDFMGRI  120

Query  553  VFDL  564
            +FDL
Sbjct  121  LFDL  124



>ref|XP_003521201.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoformX1 [Glycine max]
 ref|XP_003521202.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoformX2 [Glycine max]
 ref|XP_006576848.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X3 [Glycine max]
 ref|XP_006576849.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X4 [Glycine max]
Length=775

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPY EV+LGNYKGTTRHF+KKSNPEWNQVFAFSK+RIQAS+LEV VKDKD  KDD +GRV
Sbjct  61   DPYTEVKLGNYKGTTRHFDKKSNPEWNQVFAFSKDRIQASILEVTVKDKDVVKDDFIGRV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  LFDL  124



>ref|XP_009376104.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=771

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPSEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNY+G TRHFEKK+NPEWNQVFAFSK+RIQA++LEVIVKDKD  KDD +GRV
Sbjct  61   DPYVEVRLGNYRGATRHFEKKTNPEWNQVFAFSKDRIQATVLEVIVKDKDVVKDDLIGRV  120

Query  553  VFDL  564
             FDL
Sbjct  121  SFDL  124



>ref|XP_008387239.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
 ref|XP_008387240.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
 ref|XP_008387241.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
 ref|XP_008387242.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
Length=774

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPXKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKG TRHFEKKSNPEWNQVFAFSK+RIQA++LEVIVKDKD  KDD +GRV
Sbjct  61   DPYVEVKLGNYKGATRHFEKKSNPEWNQVFAFSKDRIQATVLEVIVKDKDLMKDDFMGRV  120

Query  553  VFDL  564
             FDL
Sbjct  121  SFDL  124



>ref|XP_008443079.1| PREDICTED: extended synaptotagmin-1 [Cucumis melo]
Length=774

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF+LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETNPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQ+S+LEV VKDKDF KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQSSVLEVTVKDKDFVKDDFMGRV  120

Query  553  VFDL  564
            +FD+
Sbjct  121  LFDM  124



>gb|EPS67145.1| hypothetical protein M569_07629 [Genlisea aurea]
Length=772

 Score =   207 bits (528),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKET P LGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1    MQRPPPEDFALKETNPRLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNYKGTTRHFEKK NPEWNQVFAFSK+RIQAS+LEV VKDKD  KDD VGRV
Sbjct  61   DPYVEVRLGNYKGTTRHFEKKLNPEWNQVFAFSKDRIQASVLEVTVKDKDLVKDDFVGRV  120

Query  553  VFDL  564
             FDL
Sbjct  121  FFDL  124



>emb|CDY47660.1| BnaC04g23970D [Brassica napus]
Length=828

 Score =   207 bits (527),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 124/153 (81%), Gaps = 6/153 (4%)
 Frame = +1

Query  124  FNSD*GLQGCLVF---VVLWKK---NNHKMQRPPQEDFMLKETKPHLGGGKITGDKLTST  285
             NS   LQ C  F   V+ W       + MQRPP EDF LKET+PHLGGGKITGDKLTST
Sbjct  25   LNSLILLQWCSCFRSSVLKWSNVFLEANMMQRPPPEDFSLKETRPHLGGGKITGDKLTST  84

Query  286  YDLVEQMQYLYVRVVKARDLPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFA  465
            YDLVEQMQYLYVRVVKA++LP KD+TGS DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFA
Sbjct  85   YDLVEQMQYLYVRVVKAKELPGKDLTGSCDPYVEVKLGNYKGTTRHFEKKSNPEWNQVFA  144

Query  466  FSKERIQASMLEVIVkdkdfdkddSVGRVVFDL  564
            FSK+RIQAS LE  VKDKD  KDD +GRVVFDL
Sbjct  145  FSKDRIQASFLEATVKDKDVVKDDLIGRVVFDL  177



>ref|XP_002322682.2| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 ref|XP_006373765.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 ref|XP_006373766.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 ref|XP_006373767.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEF04443.2| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 gb|ERP51562.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 gb|ERP51563.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 gb|ERP51564.1| C2 domain-containing family protein [Populus trichocarpa]
Length=774

 Score =   207 bits (527),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRP  EDF+LKET PHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPLHEDFLLKETNPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+R+QASMLEV VKDKDF KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRMQASMLEVTVKDKDFVKDDFMGRV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  LFDL  124



>gb|KEH16148.1| C2 calcium/lipid-binding and GRAM domain protein [Medicago truncatula]
Length=774

 Score =   207 bits (526),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF+LKETKPHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPY EV+LGNYKGTTRHFEKK+NPEWNQVFAFSK+R+QAS+LEV VKDKD  KDD +GRV
Sbjct  61   DPYAEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKDRLQASVLEVTVKDKDVVKDDFIGRV  120

Query  553  VFDL  564
             FDL
Sbjct  121  WFDL  124



>ref|XP_006402831.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
 ref|XP_006402832.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
 gb|ESQ44284.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
 gb|ESQ44285.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
Length=774

 Score =   207 bits (526),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKET+PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LEV VKDKDF KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEVTVKDKDFVKDDLIGRV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>gb|KDP24596.1| hypothetical protein JCGZ_25512 [Jatropha curcas]
Length=776

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  190  KMQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            +MQRPP E+++LKET PHLGGGK+TGDKLT+TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  2    QMQRPPPEEYVLKETNPHLGGGKVTGDKLTTTYDLVEQMQYLYVRVVKAKDLPAKDVTGS  61

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEVRLGNYKGTTRHFEKK+NPEWNQVFAFSK+RIQAS+LEV VKDKD  KDD +GR
Sbjct  62   CDPYVEVRLGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQASVLEVTVKDKDVVKDDFIGR  121

Query  550  VVFDL  564
            V+FDL
Sbjct  122  VLFDL  126



>ref|XP_004304385.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
 ref|XP_011468070.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
Length=774

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKETKPHLGGG+I+GDK TSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFALKETKPHLGGGRISGDKHTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKG TRHFEKKSNPEWNQVFAFSK+RIQAS LEVIVKDKD  KDD +G V
Sbjct  61   DPYVEVKLGNYKGATRHFEKKSNPEWNQVFAFSKDRIQASALEVIVKDKDLMKDDLIGYV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  IFDL  124



>ref|XP_002894324.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70583.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=776

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLYVRVVKA+DLP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYVRVVKAKDLPGKDLTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNY+GTTRHFEKKSNPEWNQVFAFSK+R+QAS LE  VKDKD  KDD +GRV
Sbjct  61   DPYVEVKLGNYRGTTRHFEKKSNPEWNQVFAFSKDRVQASYLEATVKDKDLVKDDLIGRV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>emb|CDP10110.1| unnamed protein product [Coffea canephora]
Length=775

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPPQEDF LKETKPHLGG KITGDKLTST+DLVEQMQYLYVRVVKARDLP KDVTGS 
Sbjct  1    MQRPPQEDFQLKETKPHLGGVKITGDKLTSTHDLVEQMQYLYVRVVKARDLPAKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNY+GTTRHFEKK+NPEWNQVFAFSK+R+Q+S LEV VKDKDF KDD +GRV
Sbjct  61   DPYVEVKLGNYRGTTRHFEKKTNPEWNQVFAFSKDRLQSSNLEVTVKDKDFVKDDFIGRV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  MFDL  124



>ref|XP_008360635.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
Length=774

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPSEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNYKG TRHFEKKSNPEWNQVFAFSK+RIQA++LEV+VKDKD  KDD +GRV
Sbjct  61   DPYVEVRLGNYKGATRHFEKKSNPEWNQVFAFSKDRIQATVLEVVVKDKDVVKDDLIGRV  120

Query  553  VFDL  564
             FDL
Sbjct  121  SFDL  124



>ref|XP_010672701.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Beta vulgaris subsp. vulgaris]
Length=775

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQ+PP EDF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP  DVTG  
Sbjct  1    MQKPPHEDFSLKETNPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPSMDVTGGC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNYKGTTRHFEKKSNPEW+QVFAFSKERIQAS+LEV VKDKD  KDD +GRV
Sbjct  61   DPYVEVRLGNYKGTTRHFEKKSNPEWSQVFAFSKERIQASVLEVNVKDKDAIKDDFIGRV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  LFDL  124



>ref|XP_010516424.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Camelina sativa]
 ref|XP_010516425.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X2 [Camelina sativa]
 ref|XP_010516426.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Camelina sativa]
 ref|XP_010427678.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010427679.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010427680.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010427681.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=773

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKET+PHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LEV VKDKD  KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEVTVKDKDVVKDDLIGRV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  IFDL  124



>ref|XP_004136579.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 ref|XP_004161488.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 gb|KGN59322.1| hypothetical protein Csa_3G809980 [Cucumis sativus]
Length=774

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF+LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETNPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEW+QVFAFSK+RIQ+S+LEV VKDKDF KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKSNPEWSQVFAFSKDRIQSSVLEVTVKDKDFVKDDFMGRV  120

Query  553  VFDL  564
            +FD+
Sbjct  121  LFDM  124



>ref|XP_010111396.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
 gb|EXC30874.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
Length=774

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKET PHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPPPEDFSLKETNPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTT HFEKKSNPEWN+VFAFSKERIQAS+LEV VKDKD  KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTPHFEKKSNPEWNRVFAFSKERIQASVLEVTVKDKDLVKDDFIGRV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  LFDL  124



>ref|XP_006306818.1| hypothetical protein CARUB_v10008360mg [Capsella rubella]
 gb|EOA39716.1| hypothetical protein CARUB_v10008360mg [Capsella rubella]
Length=774

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLY RVVKA+DLP KD+TGS 
Sbjct  1    MQRPPHEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYARVVKAKDLPGKDLTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNY+GTTRHFEKKSNPEWNQVFAFSK+R+QAS LE  VKDKD  KDD +GRV
Sbjct  61   DPYVEVKLGNYRGTTRHFEKKSNPEWNQVFAFSKDRVQASYLEATVKDKDLVKDDLIGRV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>ref|XP_010554852.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
 ref|XP_010554853.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
 ref|XP_010554854.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
 ref|XP_010554855.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
Length=773

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LEV VKDKD  KDD +G V
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEVTVKDKDVVKDDFIGHV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>emb|CDX67712.1| BnaA07g17520D [Brassica napus]
Length=774

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2    MQRPPPEDFSLKETRPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKD  KDD +GRV
Sbjct  62   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDVVKDDLIGRV  121

Query  553  VFDL  564
            VFDL
Sbjct  122  VFDL  125



>ref|XP_009104078.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Brassica rapa]
 ref|XP_009104079.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Brassica rapa]
Length=774

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2    MQRPPPEDFSLKETRPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKD  KDD +GRV
Sbjct  62   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEAAVKDKDVVKDDLIGRV  121

Query  553  VFDL  564
            VFDL
Sbjct  122  VFDL  125



>gb|KDO57727.1| hypothetical protein CISIN_1g004109mg [Citrus sinensis]
Length=763

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +1

Query  199  RPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDP  378
            RPP E+F LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLPPKDVTGS DP
Sbjct  2    RPPLEEFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDP  61

Query  379  YVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVVF  558
            YVEV++GNYKGTTRHFEKK+NPEWNQVFAFSK+RIQ+S+LEV VKDKDF KDD +GRV+F
Sbjct  62   YVEVKMGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQSSVLEVTVKDKDFVKDDFMGRVLF  121

Query  559  DL  564
            DL
Sbjct  122  DL  123



>emb|CAN80955.1| hypothetical protein VITISV_013781 [Vitis vinifera]
Length=752

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            M RPP +DF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MHRPPPDDFSLKETSPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTT HFEKK+NPEWN+VFAFSK+R+QASMLEVIVKDKDF KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTPHFEKKTNPEWNRVFAFSKDRMQASMLEVIVKDKDFVKDDYIGRV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>emb|CDX98254.1| BnaC06g16150D [Brassica napus]
Length=774

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2    MQRPPPEDFSLKETRPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKD  KDD +GRV
Sbjct  62   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDVVKDDLIGRV  121

Query  553  VFDL  564
            VFDL
Sbjct  122  VFDL  125



>ref|XP_006437045.1| hypothetical protein CICLE_v10030764mg [Citrus clementina]
 ref|XP_006485025.1| PREDICTED: extended synaptotagmin-1-like isoform X1 [Citrus sinensis]
 ref|XP_006485026.1| PREDICTED: extended synaptotagmin-1-like isoform X2 [Citrus sinensis]
 gb|ESR50285.1| hypothetical protein CICLE_v10030764mg [Citrus clementina]
 gb|KDO57725.1| hypothetical protein CISIN_1g004109mg [Citrus sinensis]
 gb|KDO57726.1| hypothetical protein CISIN_1g004109mg [Citrus sinensis]
Length=773

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +1

Query  199  RPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDP  378
            RPP E+F LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLPPKDVTGS DP
Sbjct  2    RPPLEEFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDP  61

Query  379  YVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVVF  558
            YVEV++GNYKGTTRHFEKK+NPEWNQVFAFSK+RIQ+S+LEV VKDKDF KDD +GRV+F
Sbjct  62   YVEVKMGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQSSVLEVTVKDKDFVKDDFMGRVLF  121

Query  559  DL  564
            DL
Sbjct  122  DL  123



>emb|CDY69710.1| BnaAnng31280D [Brassica napus]
Length=779

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2    MQRPPPEDFSLKETRPHLGGGKLTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKD  KDD +GRV
Sbjct  62   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDVVKDDLIGRV  121

Query  553  VFDL  564
            VFDL
Sbjct  122  VFDL  125



>ref|XP_006290627.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
 ref|XP_006290628.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
 gb|EOA23525.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
 gb|EOA23526.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
Length=773

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKET+PHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKD  KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDVVKDDMIGRV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>ref|XP_009139005.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
 ref|XP_009139006.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
Length=778

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2    MQRPPPEDFSLKETRPHLGGGKLTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKD  KDD +GRV
Sbjct  62   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDVVKDDLIGRV  121

Query  553  VFDL  564
            VFDL
Sbjct  122  VFDL  125



>gb|AAK53020.1|AF375436_1 AT3g57880/T10K17_90 [Arabidopsis thaliana]
 gb|AAM52232.1| AT3g57880/T10K17_90 [Arabidopsis thaliana]
Length=773

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKET+PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKLSGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKDF KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDFVKDDLIGRV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>dbj|BAF01685.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis 
thaliana]
Length=773

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKET+PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKLSGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKDF KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDFVKDDLIGRV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>ref|NP_191347.1| C2 domain-containing plant phosphoribosyltransferase-like protein 
[Arabidopsis thaliana]
 emb|CAB67616.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AEE79712.1| C2 domain-containing plant phosphoribosyltransferase-like protein 
[Arabidopsis thaliana]
Length=773

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKET+PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKLSGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKDF KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDFVKDDLIGRV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>ref|XP_004497931.1| PREDICTED: uncharacterized protein LOC101499168 isoform X1 [Cicer 
arietinum]
 ref|XP_004497932.1| PREDICTED: uncharacterized protein LOC101499168 isoform X2 [Cicer 
arietinum]
 ref|XP_004497933.1| PREDICTED: uncharacterized protein LOC101499168 isoform X3 [Cicer 
arietinum]
 ref|XP_004497934.1| PREDICTED: uncharacterized protein LOC101499168 isoform X4 [Cicer 
arietinum]
Length=774

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP +DF+LKETKPHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPPPDDFLLKETKPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPSKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPY EV+LGNYKGTTRHFEKK+NPEWNQ+FAFSK+R+QAS+LEV VKDKD  KDD +GRV
Sbjct  61   DPYAEVKLGNYKGTTRHFEKKTNPEWNQIFAFSKDRLQASVLEVTVKDKDMVKDDFIGRV  120

Query  553  VFDL  564
             FDL
Sbjct  121  WFDL  124



>ref|XP_002278165.1| PREDICTED: extended synaptotagmin-1 [Vitis vinifera]
 ref|XP_010653909.1| PREDICTED: extended synaptotagmin-1 [Vitis vinifera]
 ref|XP_010653910.1| PREDICTED: extended synaptotagmin-1 [Vitis vinifera]
Length=777

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            M RPP +DF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MHRPPPDDFSLKETSPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTT HFEKK+NPEWN+VFAFSK+R+QASMLEVIVKDKDF KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTPHFEKKTNPEWNRVFAFSKDRMQASMLEVIVKDKDFVKDDYIGRV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>ref|XP_010500735.1| PREDICTED: extended synaptotagmin-1-like [Camelina sativa]
Length=776

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLY RVVKA+DLP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYARVVKAKDLPGKDLTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNY+GTTRHFEKKSNPEWNQVFAFSK+R+QAS LE  VKDKD  KDD +GRV
Sbjct  61   DPYVEVKLGNYRGTTRHFEKKSNPEWNQVFAFSKDRVQASYLEATVKDKDLVKDDLIGRV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>ref|XP_002878177.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54436.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=773

 Score =   205 bits (521),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKET+PHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKD  KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDVVKDDLIGRV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>ref|XP_009766493.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
Length=774

 Score =   205 bits (521),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPP-QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQRPP QEDF LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKARDLP KDVTGS
Sbjct  1    MQRPPPQEDFSLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKARDLPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
            LDPYVEV+LGNYKGTTR FEKKSNPEW+QVFAFSK+RIQAS+LEV VKDKD  KDD VGR
Sbjct  61   LDPYVEVKLGNYKGTTRRFEKKSNPEWSQVFAFSKDRIQASVLEVTVKDKDVVKDDFVGR  120

Query  550  VVFDL  564
            V+FDL
Sbjct  121  VLFDL  125



>ref|XP_010504727.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=773

 Score =   205 bits (521),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKET+PHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETRPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKD  KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDVVKDDLIGRV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>ref|XP_004493560.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cicer arietinum]
Length=776

 Score =   204 bits (520),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKELPSKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKK+NPEW+QVFAFSK+RIQAS+LEV VKDKD  KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKTNPEWSQVFAFSKDRIQASVLEVTVKDKDVVKDDFIGRV  120

Query  553  VFDL  564
             FDL
Sbjct  121  WFDL  124



>ref|XP_010479644.1| PREDICTED: extended synaptotagmin-1-like isoform X1 [Camelina 
sativa]
 ref|XP_010479645.1| PREDICTED: extended synaptotagmin-1-like isoform X2 [Camelina 
sativa]
Length=776

 Score =   204 bits (520),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLY RVVKA+DLP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYARVVKAKDLPGKDLTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNY+GTTRHFEKKSNPEWNQVFAFSK+R+QAS LE  VKDKD  KDD +GRV
Sbjct  61   DPYVEVKLGNYRGTTRHFEKKSNPEWNQVFAFSKDRVQASYLEATVKDKDLVKDDLIGRV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>ref|XP_006393033.1| hypothetical protein EUTSA_v10011254mg [Eutrema salsugineum]
 gb|ESQ30319.1| hypothetical protein EUTSA_v10011254mg [Eutrema salsugineum]
Length=778

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+R+QAS+LE  VKDKDF KDD +G V
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRLQASVLEATVKDKDFVKDDLIGHV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>ref|NP_175568.1| calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein [Arabidopsis thaliana]
 gb|AAG50882.1|AC025294_20 unknown protein [Arabidopsis thaliana]
 gb|AEE32684.1| calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein [Arabidopsis thaliana]
Length=776

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNY+GTTRHFEKKSNPEWNQVFAFSK+R+QAS LE  VKDKD  KDD +GRV
Sbjct  61   DPYVEVKLGNYRGTTRHFEKKSNPEWNQVFAFSKDRVQASYLEATVKDKDLVKDDLIGRV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>ref|XP_008442250.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
 ref|XP_008442251.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
 ref|XP_008442253.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
Length=776

 Score =   204 bits (520),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQ+PP EDF+LKET PHLGGGK+TGDKL STYDLVEQM YLYVRVVKA+DLP KDVTGS 
Sbjct  2    MQKPPPEDFLLKETNPHLGGGKVTGDKLASTYDLVEQMYYLYVRVVKAKDLPGKDVTGSC  61

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKDF KDD +GRV
Sbjct  62   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASVLEVTVKDKDFVKDDFMGRV  121

Query  553  VFDL  564
            +FDL
Sbjct  122  LFDL  125



>ref|XP_007145661.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
 ref|XP_007145662.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
 gb|ESW17655.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
 gb|ESW17656.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
Length=774

 Score =   204 bits (519),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPY EV+LGNYKGTTRHFEKK+NPEWNQVFAFSK+R+QAS+LEV VKDKD  KDD +GRV
Sbjct  61   DPYAEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKDRLQASVLEVTVKDKDVVKDDFIGRV  120

Query  553  VFDL  564
             FDL
Sbjct  121  WFDL  124



>ref|XP_002532333.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF30035.1| synaptotagmin, putative [Ricinus communis]
Length=681

 Score =   203 bits (516),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP E+F+LKET PHLGGGK+TGDKLT+TYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MQRPPPEEFVLKETNPHLGGGKVTGDKLTTTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEW+QVFAFSK+RIQAS+LEV VKDKD  KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKSNPEWSQVFAFSKDRIQASVLEVTVKDKDVVKDDFMGRV  120

Query  553  VFDL  564
            +FDL
Sbjct  121  LFDL  124



>ref|XP_010548191.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
 ref|XP_010548275.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
Length=774

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            M RPP EDF LKETKP LGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTG  
Sbjct  2    MHRPPPEDFSLKETKPQLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDVTGGC  61

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+R+QAS LEV+VKDKDF KDD +GRV
Sbjct  62   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRVQASFLEVVVKDKDFVKDDFMGRV  121

Query  553  VFDL  564
            VFDL
Sbjct  122  VFDL  125



>ref|XP_004144665.1| PREDICTED: uncharacterized protein LOC101203090 isoform 1 [Cucumis 
sativus]
 ref|XP_004144666.1| PREDICTED: uncharacterized protein LOC101203090 isoform 2 [Cucumis 
sativus]
 ref|XP_004168423.1| PREDICTED: uncharacterized LOC101203090 [Cucumis sativus]
 gb|KGN54869.1| hypothetical protein Csa_4G567200 [Cucumis sativus]
Length=776

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQ+PP EDF+LKET PHLGGGK+ GDKL STYDLVEQM YLYVRVVKA+DLP KDVTGS 
Sbjct  2    MQKPPPEDFLLKETNPHLGGGKVAGDKLASTYDLVEQMYYLYVRVVKAKDLPGKDVTGSC  61

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKDF KDD +GRV
Sbjct  62   DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASVLEVSVKDKDFVKDDFMGRV  121

Query  553  VFDL  564
            +FDL
Sbjct  122  LFDL  125



>ref|XP_003625221.1| Anthranilate phosphoribosyltransferase-like protein [Medicago 
truncatula]
 gb|ABN08649.1| C2 [Medicago truncatula]
 gb|AES81439.1| C2 calcium/lipid-binding and GRAM domain protein [Medicago truncatula]
Length=775

 Score =   201 bits (512),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 116/124 (94%), Gaps = 1/124 (1%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF+LKETKPHLGG K++GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGG-KVSGDKLTSTYDLVEQMQYLYVRVVKAKELPSKDVTGSC  59

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSK+RIQAS+LEV VKDKDF KDD +GRV
Sbjct  60   DPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQASVLEVFVKDKDFVKDDFIGRV  119

Query  553  VFDL  564
             FDL
Sbjct  120  WFDL  123



>ref|XP_003535846.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Glycine max]
 ref|XP_006588908.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X2 [Glycine max]
 ref|XP_006588909.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X3 [Glycine max]
Length=773

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF+LKETKPHLGGGK++GD+LTSTYDLVEQMQYLYVRVVKA+DLP KD+TGS 
Sbjct  1    MQRPPPEDFLLKETKPHLGGGKVSGDRLTSTYDLVEQMQYLYVRVVKAKDLPAKDITGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTR+F K ++PEWNQVFAFSK+R+QASMLEV V DKD  KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTRNFAKNTHPEWNQVFAFSKDRLQASMLEVNVIDKDVLKDDLIGRV  120

Query  553  VFDL  564
             FDL
Sbjct  121  WFDL  124



>gb|KFK35840.1| hypothetical protein AALP_AA4G043900 [Arabis alpina]
Length=775

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPP EDF LKETKP LGGGKI+GDKLT+TYDLVEQMQYLYVRVVKA+DLP KD+TGS 
Sbjct  1    MQRPPPEDFSLKETKPFLGGGKISGDKLTTTYDLVEQMQYLYVRVVKAKDLPGKDLTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAF+K+R+QAS LE  VKDKD  KDD +GRV
Sbjct  61   DPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFAKDRLQASFLEATVKDKDVVKDDLIGRV  120

Query  553  VFDL  564
            VFDL
Sbjct  121  VFDL  124



>ref|XP_010265829.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nelumbo nucifera]
 ref|XP_010265830.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nelumbo nucifera]
Length=776

 Score =   199 bits (506),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRP-PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQRP P E++ LKET PHLGGG +TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTG+
Sbjct  1    MQRPLPPEEYSLKETSPHLGGGGVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGT  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LEV+VKDKDF KDD +GR
Sbjct  61   CDPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASALEVVVKDKDFVKDDFMGR  120

Query  550  VVFDL  564
            V+FDL
Sbjct  121  VIFDL  125



>ref|XP_009395864.1| PREDICTED: extended synaptotagmin-1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395871.1| PREDICTED: extended synaptotagmin-1-like [Musa acuminata subsp. 
malaccensis]
Length=776

 Score =   198 bits (504),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQRP + E++ LKET PHLGGG ++GDKLT+TYDLVEQMQYLYVRVVKA+DLPPKDVTGS
Sbjct  2    MQRPLRPEEYSLKETSPHLGGGGVSGDKLTTTYDLVEQMQYLYVRVVKAKDLPPKDVTGS  61

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSK+RIQAS+LEVIVKDKDF KDD +GR
Sbjct  62   CDPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQASVLEVIVKDKDFIKDDFIGR  121

Query  550  VVFDL  564
            V+FDL
Sbjct  122  VLFDL  126



>gb|KJB36100.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
 gb|KJB36101.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
 gb|KJB36102.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
 gb|KJB36103.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
Length=775

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            M RPP EDF LKET PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  2    MPRPPPEDFALKETNPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  61

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGNY G TR FEKKSNPEWNQVFAFSK+R+QAS+LEV VKDKDF KDD +G+V
Sbjct  62   DPYVEVKLGNYLGKTRFFEKKSNPEWNQVFAFSKDRLQASLLEVTVKDKDFVKDDFIGKV  121

Query  553  VFDL  564
             FDL
Sbjct  122  FFDL  125



>ref|XP_006386096.1| hypothetical protein POPTR_0003s22060g [Populus trichocarpa]
 gb|ERP63893.1| hypothetical protein POPTR_0003s22060g [Populus trichocarpa]
Length=772

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PPQ  DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLPPKD+TGS
Sbjct  1    MQKPPQSVDFALKETSPNIGAGSVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPPKDITGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG T+HFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGVTKHFEKKSNPEWNQVFAFSKDRIQASVLEVFVKDKDVVLDDLIGR  120

Query  550  VVFDL  564
            ++FDL
Sbjct  121  MMFDL  125



>ref|XP_008787291.1| PREDICTED: extended synaptotagmin-1-like [Phoenix dactylifera]
Length=776

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 113/125 (90%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRP-PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQRP P +++ LKET PHLGGG + GDKLT+TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  2    MQRPLPPQEYSLKETSPHLGGGGVAGDKLTTTYDLVEQMQYLYVRVVKAKDLPVKDVTGS  61

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKGTTR+FEKK+NPEWNQVFAFSKERIQAS +EVIVKDKD  KDD +GR
Sbjct  62   CDPYVEVKLGNYKGTTRYFEKKTNPEWNQVFAFSKERIQASSMEVIVKDKDSVKDDFIGR  121

Query  550  VVFDL  564
            V+FDL
Sbjct  122  VLFDL  126



>ref|XP_010928839.1| PREDICTED: extended synaptotagmin-1-like [Elaeis guineensis]
 ref|XP_010928840.1| PREDICTED: extended synaptotagmin-1-like [Elaeis guineensis]
Length=774

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQRP Q +++ LKET PHLGGG + GDKLT+TYDLVEQMQYLYVRVVKARDLP KDVTGS
Sbjct  1    MQRPLQPQEYSLKETSPHLGGGGVAGDKLTTTYDLVEQMQYLYVRVVKARDLPTKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKGTTRHFEK +NPEWNQVFAFSKERIQAS +EVIVKDKDF KDD +GR
Sbjct  61   CDPYVEVKLGNYKGTTRHFEKTTNPEWNQVFAFSKERIQASSVEVIVKDKDFVKDDFIGR  120

Query  550  VVFDL  564
            V FDL
Sbjct  121  VSFDL  125



>ref|XP_010913922.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
Length=776

 Score =   193 bits (491),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 113/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  193  MQRP--PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  366
            MQRP  PQE + LKET PHLGGG + GDKLT+TYDLVEQMQYLYVRVVKA+DLP KDVTG
Sbjct  2    MQRPLHPQE-YSLKETSPHLGGGGVAGDKLTTTYDLVEQMQYLYVRVVKAKDLPTKDVTG  60

Query  367  SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVG  546
            S DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSKERIQAS +EVIVKDKDF KDD +G
Sbjct  61   SCDPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKERIQASSVEVIVKDKDFVKDDFIG  120

Query  547  RVVFDL  564
            RV FDL
Sbjct  121  RVSFDL  126



>ref|XP_008782885.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
 ref|XP_008782886.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
 ref|XP_008782888.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
Length=775

 Score =   193 bits (490),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  193  MQRP--PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  366
            MQRP  PQE + LKET PHLGGG + GDKLT+TYDLVEQMQYLYVRVVKARDLP KDVTG
Sbjct  1    MQRPLHPQE-YSLKETSPHLGGGGVAGDKLTTTYDLVEQMQYLYVRVVKARDLPAKDVTG  59

Query  367  SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVG  546
            S DPYVEV+LGNYKGTTR+FEKK+NPEWNQVFAFSKERIQAS +EVIVKDKD  KDD +G
Sbjct  60   SCDPYVEVKLGNYKGTTRYFEKKTNPEWNQVFAFSKERIQASSVEVIVKDKDSVKDDIIG  119

Query  547  RVVFDL  564
            RV FDL
Sbjct  120  RVSFDL  125



>ref|XP_008243596.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2 [Prunus mume]
Length=755

 Score =   192 bits (489),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PPQ +DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQPQDFALKETSPNIGAGSVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPAKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG TRHFEKKSNPEWNQVFAFSK+R+QAS LE +VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGVTRHFEKKSNPEWNQVFAFSKDRLQASFLEAVVKDKDVVLDDFMGR  120

Query  550  VVFDL  564
            V+FDL
Sbjct  121  VIFDL  125



>ref|XP_007014901.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 ref|XP_007014902.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 ref|XP_007014903.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 ref|XP_007014904.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32520.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32521.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32522.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32523.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
Length=771

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PPQ  DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQSVDFALKETSPNIGAGAVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG T+HFEKK+NPEWNQVFAFSKERIQAS+LEV+VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGVTKHFEKKTNPEWNQVFAFSKERIQASVLEVLVKDKDVVIDDLIGR  120

Query  550  VVFDL  564
            V+FDL
Sbjct  121  VMFDL  125



>ref|XP_007208351.1| hypothetical protein PRUPE_ppa001743mg [Prunus persica]
 gb|EMJ09550.1| hypothetical protein PRUPE_ppa001743mg [Prunus persica]
Length=772

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PPQ +DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQPQDFALKETSPNIGAGSVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPAKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG TRHFEKKSNPEWNQVFAFSK+R+QAS LE +VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGVTRHFEKKSNPEWNQVFAFSKDRLQASFLEAVVKDKDVVLDDFMGR  120

Query  550  VVFDL  564
            V+FDL
Sbjct  121  VIFDL  125



>ref|XP_008778691.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778692.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778693.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778694.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778695.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
Length=773

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRP-PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQRP  QED+ LK T PHLGGG I GDKLTSTYDLVEQMQYLYVRVVKA+DLPPKDVTGS
Sbjct  1    MQRPLSQEDYSLKATSPHLGGGGIAGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKGTTR+FE+K+NPEWNQVFAFSK+RIQAS +E+ VKDKD  KDD +G 
Sbjct  61   CDPYVEVKLGNYKGTTRYFERKTNPEWNQVFAFSKDRIQASTVEIAVKDKDAVKDDYMGM  120

Query  550  VVFDL  564
            V+FDL
Sbjct  121  VMFDL  125



>ref|XP_011025253.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=772

 Score =   191 bits (484),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PPQ  DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KD+TGS
Sbjct  1    MQKPPQSVDFALKETSPNIGAGSVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPSKDITGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG T+HFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGVTKHFEKKSNPEWNQVFAFSKDRIQASVLEVFVKDKDVVLDDLIGR  120

Query  550  VVFDL  564
            ++FDL
Sbjct  121  MMFDL  125



>ref|XP_006445975.1| hypothetical protein CICLE_v10014352mg [Citrus clementina]
 gb|ESR59215.1| hypothetical protein CICLE_v10014352mg [Citrus clementina]
Length=772

 Score =   190 bits (482),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+ PQ  DF LKET P +G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKSPQAIDFALKETSPKIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKGTT+HFEKKSNPEWNQ FAFSK+RIQAS+LEV+VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGTTKHFEKKSNPEWNQCFAFSKDRIQASVLEVLVKDKDVVLDDLIGR  120

Query  550  VVFDL  564
            V+FDL
Sbjct  121  VMFDL  125



>ref|XP_006494723.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Citrus sinensis]
 gb|KDO64911.1| hypothetical protein CISIN_1g004127mg [Citrus sinensis]
Length=772

 Score =   190 bits (482),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+ PQ  DF LKET P +G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKSPQAIDFALKETSPKIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKGTT+HFEKKSNPEWNQ FAFSK+RIQAS+LEV+VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGTTKHFEKKSNPEWNQCFAFSKDRIQASVLEVLVKDKDVVLDDLIGR  120

Query  550  VVFDL  564
            V+FDL
Sbjct  121  VMFDL  125



>gb|KJB83485.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
Length=737

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PPQ  DF LKET P +G G +TGDKL+STYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1    MQKPPQSIDFALKETSPKIGAGAVTGDKLSSTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG T+HFEKK+NPEWNQVFAFSKERIQAS+LEV VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGVTKHFEKKNNPEWNQVFAFSKERIQASVLEVYVKDKDVVADDLIGR  120

Query  550  VVFDL  564
             +FDL
Sbjct  121  ALFDL  125



>ref|XP_006850074.1| hypothetical protein AMTR_s00022p00214560 [Amborella trichopoda]
 gb|ERN11655.1| hypothetical protein AMTR_s00022p00214560 [Amborella trichopoda]
Length=772

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 2/125 (2%)
 Frame = +1

Query  193  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQRP Q ED+ LKET PHLGGG + GDKLTSTYDLVEQMQYLYVRVVKA+DLP  DVTGS
Sbjct  1    MQRPLQSEDYSLKETSPHLGGGGVHGDKLTSTYDLVEQMQYLYVRVVKAKDLP-TDVTGS  59

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSKERIQ S++EV VKDKD  KDD +GR
Sbjct  60   CDPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKERIQFSVIEVTVKDKDLVKDDFIGR  119

Query  550  VVFDL  564
            V FDL
Sbjct  120  VTFDL  124



>gb|KHG04257.1| Multiple C2 and transmembrane domain-containing 1 [Gossypium 
arboreum]
Length=771

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PPQ  DF LKET P +G G +TGDKL+STYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1    MQKPPQSIDFALKETSPKIGAGAVTGDKLSSTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG T+HFEKK+NPEWNQVFAFSKERIQAS+LEV VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGVTKHFEKKNNPEWNQVFAFSKERIQASVLEVYVKDKDVVADDLIGR  120

Query  550  VVFDL  564
             +FDL
Sbjct  121  ALFDL  125



>gb|KJB83481.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83482.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83483.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83484.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83486.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83487.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83488.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
Length=771

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PPQ  DF LKET P +G G +TGDKL+STYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1    MQKPPQSIDFALKETSPKIGAGAVTGDKLSSTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG T+HFEKK+NPEWNQVFAFSKERIQAS+LEV VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGVTKHFEKKNNPEWNQVFAFSKERIQASVLEVYVKDKDVVADDLIGR  120

Query  550  VVFDL  564
             +FDL
Sbjct  121  ALFDL  125



>gb|KDP20200.1| hypothetical protein JCGZ_07920 [Jatropha curcas]
Length=773

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PPQ  DF LKET P++G G +T DKL  TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQAIDFALKETSPNIGAGAVTADKLACTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKGTT+HFEKK+NPEWNQVFAFSKERIQAS LEV VKDK    DD +GR
Sbjct  61   CDPYVEVKLGNYKGTTKHFEKKTNPEWNQVFAFSKERIQASFLEVSVKDKAVVLDDLIGR  120

Query  550  VVFDL  564
            V+F+L
Sbjct  121  VMFEL  125



>ref|XP_010519731.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
 ref|XP_010519732.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
Length=768

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PPQ  DF LKET P +G G + GDKL+ TYDLVEQM YLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQNIDFALKETSPKIGAGAVAGDKLSCTYDLVEQMHYLYVRVVKAKDLPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG T+HFEKKSNPEWNQVFAFSK+RIQAS+LEVIVKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGMTKHFEKKSNPEWNQVFAFSKDRIQASILEVIVKDKDVVLDDLIGR  120

Query  550  VVFDL  564
             +FDL
Sbjct  121  ALFDL  125



>ref|XP_002513446.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF48849.1| synaptotagmin, putative [Ricinus communis]
Length=772

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PPQ  DF LKET P++G   +TGDKL+ TYDLVEQMQYLYVRVVKARDLP KDVTGS
Sbjct  1    MQKPPQAVDFALKETSPNIGAAAVTGDKLSCTYDLVEQMQYLYVRVVKARDLPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPY+EV++GNYKG T+HFEKK+NPEWNQVFAFSKERIQAS+LEV VKDKD   DD +GR
Sbjct  61   CDPYIEVKMGNYKGVTKHFEKKTNPEWNQVFAFSKERIQASILEVSVKDKDVVLDDLIGR  120

Query  550  VVFDL  564
            ++F+L
Sbjct  121  IIFEL  125



>ref|NP_001055351.1| Os05g0370600 [Oryza sativa Japonica Group]
 gb|AAV31232.1| putative anthranilate phosphoribosyltransferase [Oryza sativa 
Japonica Group]
 dbj|BAF17265.1| Os05g0370600 [Oryza sativa Japonica Group]
 gb|EAY97780.1| hypothetical protein OsI_19693 [Oryza sativa Indica Group]
 gb|EEE63479.1| hypothetical protein OsJ_18293 [Oryza sativa Japonica Group]
Length=774

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 114/125 (91%), Gaps = 2/125 (2%)
 Frame = +1

Query  193  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQRP + E++ LKET PHLGGG   GDKLT+TYDLVEQMQYLYVRVVKA+DLP KD+TGS
Sbjct  2    MQRPFRPEEYSLKETSPHLGGGA-AGDKLTTTYDLVEQMQYLYVRVVKAKDLPSKDITGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSKERIQ+S++E+IVKDKDF KDD +GR
Sbjct  61   CDPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKERIQSSVVEIIVKDKDFVKDDFIGR  120

Query  550  VVFDL  564
            V+FDL
Sbjct  121  VLFDL  125



>ref|XP_006654319.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Oryza brachyantha]
Length=774

 Score =   187 bits (476),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 113/125 (90%), Gaps = 2/125 (2%)
 Frame = +1

Query  193  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQRP + E++ LKET PHLGGG   GDKLT+TYDLVEQMQYLYVRVVKA+DLP KD+TGS
Sbjct  2    MQRPFRPEEYSLKETSPHLGGGA-AGDKLTTTYDLVEQMQYLYVRVVKAKDLPSKDITGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSKERIQ+S++E+IVKDKDF KDD +GR
Sbjct  61   CDPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKERIQSSVVEIIVKDKDFVKDDFIGR  120

Query  550  VVFDL  564
            V FDL
Sbjct  121  VCFDL  125



>ref|XP_002297795.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE82600.1| C2 domain-containing family protein [Populus trichocarpa]
Length=772

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+ PQ  DF LKET P++G G +TG+KL+ TYDLVEQMQYLYVRVVKARDLPPKDVTGS
Sbjct  1    MQKLPQSVDFALKETSPNIGAGSVTGNKLSCTYDLVEQMQYLYVRVVKARDLPPKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG T+HFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKD   DD +G 
Sbjct  61   CDPYVEVKLGNYKGVTKHFEKKSNPEWNQVFAFSKDRIQASVLEVFVKDKDVVLDDLIGW  120

Query  550  VVFDL  564
            ++FDL
Sbjct  121  MMFDL  125



>gb|KJB66120.1| hypothetical protein B456_010G128400 [Gossypium raimondii]
 gb|KJB66121.1| hypothetical protein B456_010G128400 [Gossypium raimondii]
 gb|KJB66122.1| hypothetical protein B456_010G128400 [Gossypium raimondii]
Length=772

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 109/126 (87%), Gaps = 2/126 (2%)
 Frame = +1

Query  193  MQRPPQE--DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  366
            MQ+PP +  DF LK+T P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG
Sbjct  1    MQKPPPQSVDFALKQTSPNIGAGAVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTG  60

Query  367  SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVG  546
            S DPYVEV+LGNYKG T+HFEKKSNPEWNQVF FSKERIQAS+LEV VKDKD   DD +G
Sbjct  61   SCDPYVEVKLGNYKGVTKHFEKKSNPEWNQVFGFSKERIQASILEVFVKDKDVVVDDLIG  120

Query  547  RVVFDL  564
            RVVFD+
Sbjct  121  RVVFDV  126



>gb|KHG19030.1| Multiple C2 and transmembrane domain-containing 1 [Gossypium 
arboreum]
Length=772

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 109/126 (87%), Gaps = 2/126 (2%)
 Frame = +1

Query  193  MQRPPQE--DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  366
            MQ+PP +  DF LK+T P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG
Sbjct  1    MQKPPPQSVDFALKQTSPNIGAGAVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTG  60

Query  367  SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVG  546
            S DPYVEV+LGNYKG T+HFEKKSNPEWNQVF FSKERIQAS+LEV VKDKD   DD +G
Sbjct  61   SCDPYVEVKLGNYKGVTKHFEKKSNPEWNQVFGFSKERIQASILEVFVKDKDVVVDDLIG  120

Query  547  RVVFDL  564
            RVVFD+
Sbjct  121  RVVFDV  126



>ref|XP_007028942.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 ref|XP_007028943.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 ref|XP_007028944.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 gb|EOY09444.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 gb|EOY09445.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 gb|EOY09446.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
Length=776

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +1

Query  202  PPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPY  381
            PP +DF LKET PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS DPY
Sbjct  6    PPPDDFALKETNPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSCDPY  65

Query  382  VEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVVFD  561
            VEV+LGNY G TR FEKK+NPEWNQVFAFSK+R+QAS+LEV VKDKD  KDD +G+V FD
Sbjct  66   VEVKLGNYLGKTRVFEKKTNPEWNQVFAFSKDRLQASVLEVTVKDKDVVKDDFIGKVFFD  125

Query  562  L  564
            L
Sbjct  126  L  126



>ref|XP_007028941.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY09443.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
Length=877

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +1

Query  202  PPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPY  381
            PP +DF LKET PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS DPY
Sbjct  6    PPPDDFALKETNPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSCDPY  65

Query  382  VEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVVFD  561
            VEV+LGNY G TR FEKK+NPEWNQVFAFSK+R+QAS+LEV VKDKD  KDD +G+V FD
Sbjct  66   VEVKLGNYLGKTRVFEKKTNPEWNQVFAFSKDRLQASVLEVTVKDKDVVKDDFIGKVFFD  125

Query  562  L  564
            L
Sbjct  126  L  126



>ref|XP_009364713.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=772

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PPQ +DF LKET P++G G ITGDKL+ TYDLVEQM YLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQSQDFALKETSPNIGAGSITGDKLSCTYDLVEQMHYLYVRVVKAKDLPAKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG TRHFEKKSNPEWNQVFAFSK+R+QAS LEV+VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGVTRHFEKKSNPEWNQVFAFSKDRLQASFLEVVVKDKDVVIDDFMGR  120

Query  550  VVFDL  564
            ++F+L
Sbjct  121  IMFEL  125



>ref|XP_008358865.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Malus domestica]
Length=772

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PPQ +DF LKET P++G G ITGDKL+ TYDLVEQM YLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQSQDFALKETSPNIGAGSITGDKLSCTYDLVEQMHYLYVRVVKAKDLPAKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG TRHFEKKSNPEWNQVFAFSK+R+QAS LEV+VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGVTRHFEKKSNPEWNQVFAFSKDRLQASFLEVVVKDKDVVLDDFMGR  120

Query  550  VVFDL  564
            ++F+L
Sbjct  121  IMFEL  125



>ref|XP_004295231.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
 ref|XP_011461911.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
Length=772

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PPQ  DF LKET P++G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDV+GS
Sbjct  1    MQKPPQSTDFALKETSPNIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVSGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG TRHFEKKSNP WNQVFAFSK+RIQAS+LE +VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGVTRHFEKKSNPVWNQVFAFSKDRIQASILEAVVKDKDVVVDDFMGR  120

Query  550  VVFDL  564
            V+F+L
Sbjct  121  VIFEL  125



>gb|EMT24491.1| Multiple C2 and transmembrane domain-containing protein 1 [Aegilops 
tauschii]
Length=703

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 113/125 (90%), Gaps = 2/125 (2%)
 Frame = +1

Query  193  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQRP + E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TGS
Sbjct  2    MQRPFRPEEYSLKETTPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPAKDLTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSKERIQAS++E+IVKDKDF KDD +GR
Sbjct  61   CDPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKERIQASVVEIIVKDKDFVKDDYIGR  120

Query  550  VVFDL  564
            V+FDL
Sbjct  121  VMFDL  125



>gb|KEH30271.1| C2 calcium/lipid-binding and GRAM domain protein [Medicago truncatula]
Length=770

 Score =   185 bits (469),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PP   +F LKET P++G G +T DKL+ TYDLVEQMQYLYVRVVKA++LP KDVTGS
Sbjct  1    MQKPPNSHEFALKETTPNIGAGAVTRDKLSCTYDLVEQMQYLYVRVVKAKELPTKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
            LDPYVEV+LGNYKG T+HFEKKSNP+WNQVFAFSK+RIQAS+LEVIVKDKD   DD VGR
Sbjct  61   LDPYVEVKLGNYKGITKHFEKKSNPQWNQVFAFSKDRIQASVLEVIVKDKDVIADDFVGR  120

Query  550  VVFDL  564
            V FDL
Sbjct  121  VWFDL  125



>emb|CBI16433.3| unnamed protein product [Vitis vinifera]
Length=605

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PP   +F LKETKP LGGG + GDKLT  YDLVEQM YLYVRVVKA+DLPPKDVTGS
Sbjct  1    MQKPPPSVEFALKETKPQLGGGSVIGDKLTCAYDLVEQMHYLYVRVVKAKDLPPKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPY+EV+LGNYKG T+HFEKK+NP WNQVFAFSK+R+QAS+LEV+VKDKDF KDD +G+
Sbjct  61   CDPYIEVKLGNYKGVTKHFEKKTNPVWNQVFAFSKDRLQASVLEVVVKDKDFVKDDFMGK  120

Query  550  VVFDL  564
            V FDL
Sbjct  121  VSFDL  125



>gb|EMS45217.1| Multiple C2 and transmembrane domain-containing protein 1 [Triticum 
urartu]
Length=774

 Score =   184 bits (468),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 113/125 (90%), Gaps = 2/125 (2%)
 Frame = +1

Query  193  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQRP + E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TGS
Sbjct  2    MQRPFRPEEYSLKETTPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPAKDLTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSKERIQAS++E+IVKDKDF KDD +GR
Sbjct  61   CDPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKERIQASVVEIIVKDKDFVKDDYIGR  120

Query  550  VVFDL  564
            V+FDL
Sbjct  121  VMFDL  125



>ref|XP_010227498.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2-like [Brachypodium distachyon]
Length=774

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 2/125 (2%)
 Frame = +1

Query  193  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQRP + E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD++GS
Sbjct  2    MQRPFRPEEYSLKETSPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPSKDISGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSKERIQAS++E+IVKDKDF KDD +GR
Sbjct  61   CDPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKERIQASVVEIIVKDKDFVKDDYIGR  120

Query  550  VVFDL  564
            V+FDL
Sbjct  121  VLFDL  125



>ref|XP_002285588.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Vitis vinifera]
 ref|XP_010651282.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Vitis vinifera]
Length=774

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PP   +F LKETKP LGGG + GDKLT  YDLVEQM YLYVRVVKA+DLPPKDVTGS
Sbjct  1    MQKPPPSVEFALKETKPQLGGGSVIGDKLTCAYDLVEQMHYLYVRVVKAKDLPPKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPY+EV+LGNYKG T+HFEKK+NP WNQVFAFSK+R+QAS+LEV+VKDKDF KDD +G+
Sbjct  61   CDPYIEVKLGNYKGVTKHFEKKTNPVWNQVFAFSKDRLQASVLEVVVKDKDFVKDDFMGK  120

Query  550  VVFDL  564
            V FDL
Sbjct  121  VSFDL  125



>ref|XP_009364728.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=772

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PPQ +DF LKET P++G G ITGDKL+ TYDLVEQM YLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPQSQDFALKETSPNIGAGSITGDKLSCTYDLVEQMHYLYVRVVKAKDLPAKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG TRHFEKKSNPEWNQVFAFSK+++QAS LEV+VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGVTRHFEKKSNPEWNQVFAFSKDQLQASFLEVVVKDKDVVIDDFMGR  120

Query  550  VVFDL  564
            ++F+L
Sbjct  121  IMFEL  125



>ref|XP_002438680.1| hypothetical protein SORBIDRAFT_10g024200 [Sorghum bicolor]
 gb|EER90047.1| hypothetical protein SORBIDRAFT_10g024200 [Sorghum bicolor]
Length=775

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  193  MQRPP--QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  366
            MQRPP   E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TG
Sbjct  2    MQRPPLRPEEYSLKETSPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPNKDITG  60

Query  367  SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVG  546
            S DPYVEV+LGNYKG TRHFEKK+NPEWNQVFAFSKERIQ+S++E++VKDKD  KDD +G
Sbjct  61   SCDPYVEVKLGNYKGQTRHFEKKNNPEWNQVFAFSKERIQSSVVEIVVKDKDLVKDDFIG  120

Query  547  RVVFDL  564
            RV+FDL
Sbjct  121  RVMFDL  126



>ref|XP_011037883.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Populus euphratica]
 ref|XP_011037884.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X2 [Populus euphratica]
Length=772

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+ PQ  DF LKET P++G G +TG+KL+ TYDLVEQMQYLYVRVVKARDLP KDVTGS
Sbjct  1    MQKLPQSVDFALKETSPNIGAGSVTGNKLSCTYDLVEQMQYLYVRVVKARDLPLKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG T+HFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKD   DD +G 
Sbjct  61   CDPYVEVKLGNYKGVTKHFEKKSNPEWNQVFAFSKDRIQASVLEVFVKDKDVVLDDLIGW  120

Query  550  VVFDL  564
            ++FDL
Sbjct  121  MMFDL  125



>ref|XP_010091994.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
 gb|EXB48400.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
Length=772

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +1

Query  202  PPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPY  381
            P Q DF LKET P++G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS DPY
Sbjct  5    PQQVDFALKETSPNIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPAKDVTGSCDPY  64

Query  382  VEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVVFD  561
            VEV+LGNYKG T+HFEKKSNP WNQ FAFSK+RIQAS LEV++KDKD   DD +GRV+F+
Sbjct  65   VEVKLGNYKGVTKHFEKKSNPHWNQCFAFSKDRIQASTLEVLLKDKDIVIDDLIGRVLFE  124

Query  562  L  564
            L
Sbjct  125  L  125



>ref|XP_009374817.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=774

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPP-QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+PP  +DF LKET P++G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1    MQKPPPSQDFALKETSPNIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPAKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG T+HFEKKSNPEWNQVFAFSK+R+QAS+LEV+VKDKD   DD +GR
Sbjct  61   SDPYVEVKLGNYKGVTKHFEKKSNPEWNQVFAFSKDRLQASVLEVVVKDKDVVLDDFMGR  120

Query  550  VVFDL  564
            V+ DL
Sbjct  121  VMMDL  125



>ref|XP_003537951.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Glycine max]
 ref|XP_006590953.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X2 [Glycine max]
 gb|KHN21877.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine 
soja]
Length=777

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 107/127 (84%), Gaps = 3/127 (2%)
 Frame = +1

Query  193  MQRPP---QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVT  363
            MQ+ P     +F LKET P +G G +T DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVT
Sbjct  1    MQKAPLAHSNEFALKETSPKIGAGAVTRDKLSCTYDLVEQMQYLYVRVVKAKDLPSKDVT  60

Query  364  GSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSV  543
            GSLDPYVEV+LGNYKG T+HFEKKSNPEWNQVFAFSK+RIQAS+LEVIVKDKD   DD V
Sbjct  61   GSLDPYVEVKLGNYKGLTKHFEKKSNPEWNQVFAFSKDRIQASVLEVIVKDKDVISDDFV  120

Query  544  GRVVFDL  564
            GR+ FDL
Sbjct  121  GRMWFDL  127



>ref|XP_007131979.1| hypothetical protein PHAVU_011G056600g [Phaseolus vulgaris]
 gb|ESW03973.1| hypothetical protein PHAVU_011G056600g [Phaseolus vulgaris]
Length=775

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 107/127 (84%), Gaps = 3/127 (2%)
 Frame = +1

Query  193  MQRPP---QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVT  363
            MQR P     +F LKET P++G G +T DKL+ TYDLVEQMQYLYVRVVKA DLP KDVT
Sbjct  1    MQRAPLAHSHEFALKETSPNIGAGAVTRDKLSCTYDLVEQMQYLYVRVVKAMDLPAKDVT  60

Query  364  GSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSV  543
            GSLDPYVEV+LGN+KG T+HFEKKSNPEWNQVFAFSK+RIQAS+LEVIVKDKD   DD V
Sbjct  61   GSLDPYVEVKLGNFKGLTKHFEKKSNPEWNQVFAFSKDRIQASVLEVIVKDKDVISDDFV  120

Query  544  GRVVFDL  564
            GR+ FDL
Sbjct  121  GRLWFDL  127



>ref|XP_009121819.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
 ref|XP_009121820.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
Length=769

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYV+VVKA++LP KDVTGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVQVVKAKELPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG T+HFEKKSNPEW QVFAFSKERIQAS+LEV+VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGMTKHFEKKSNPEWKQVFAFSKERIQASILEVVVKDKDVMMDDLIGR  120

Query  550  VVFDL  564
            ++FDL
Sbjct  121  IMFDL  125



>ref|XP_006399782.1| hypothetical protein EUTSA_v10012747mg [Eutrema salsugineum]
 gb|ESQ41235.1| hypothetical protein EUTSA_v10012747mg [Eutrema salsugineum]
Length=769

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYVRV+KA++LP KD+TGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVMKAKELPGKDMTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG T+HFEKKSNPEW QVFAFSKERIQAS+LEV+VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGVTKHFEKKSNPEWKQVFAFSKERIQASILEVVVKDKDLMVDDLIGR  120

Query  550  VVFDL  564
            ++FDL
Sbjct  121  IMFDL  125



>emb|CDX97214.1| BnaC09g44110D [Brassica napus]
Length=769

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYV+VVKA++LP KDVTGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGALTGDKLSCTYDLVEQMHYLYVQVVKAKELPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG T+HFEKKSNPEW QVFAFSKERIQAS+LEV+VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGMTKHFEKKSNPEWKQVFAFSKERIQASILEVVVKDKDVMMDDLIGR  120

Query  550  VVFDL  564
            ++FDL
Sbjct  121  IMFDL  125



>ref|XP_010673580.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673581.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673582.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Beta vulgaris subsp. vulgaris]
Length=770

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +1

Query  202  PPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPY  381
            PP+E+F L+ET P +G   I GDKL STYDLVEQMQYLYVRVVKA++LP KDVTGS DPY
Sbjct  5    PPREEFALRETSPAIGVAGIAGDKLNSTYDLVEQMQYLYVRVVKAKELPGKDVTGSCDPY  64

Query  382  VEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVVFD  561
            VEV+LGNYKGTTRHFEK + PEWNQVFAFSKERIQAS++E+ VKDKD  KDD +GRV+FD
Sbjct  65   VEVKLGNYKGTTRHFEKNTKPEWNQVFAFSKERIQASIVEIFVKDKDVLKDDFIGRVIFD  124

Query  562  L  564
            L
Sbjct  125  L  125



>emb|CDX78498.1| BnaA03g04100D [Brassica napus]
Length=769

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYVRVVKA++LP KDVTGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVVKAKELPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNY+G T+HFEKKSNPEW QVFAFSKERIQAS+LEVIVKDKD   DD +G 
Sbjct  61   CDPYVEVKLGNYRGMTKHFEKKSNPEWRQVFAFSKERIQASILEVIVKDKDVMLDDFIGG  120

Query  550  VVFDL  564
            ++FDL
Sbjct  121  IMFDL  125



>ref|XP_009131306.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Brassica rapa]
 ref|XP_009131307.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Brassica rapa]
 ref|XP_009131308.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Brassica rapa]
Length=769

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYVRVVKA++LP KDVTGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVVKAKELPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNY+G T+HFEKKSNPEW QVFAFSKERIQAS+LEVIVKDKD   DD +G 
Sbjct  61   CDPYVEVKLGNYRGMTKHFEKKSNPEWRQVFAFSKERIQASILEVIVKDKDVMLDDFIGG  120

Query  550  VVFDL  564
            ++FDL
Sbjct  121  IMFDL  125



>emb|CDY68091.1| BnaAnng26150D [Brassica napus]
Length=769

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYV+VVKA++LP KDVTGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVQVVKAKELPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             +PYVEV+LGNYKG T+HFEKKSNPEW QVFAFSKERIQAS+LEV+VKDKD   DD +GR
Sbjct  61   CNPYVEVKLGNYKGMTKHFEKKSNPEWKQVFAFSKERIQASILEVVVKDKDVMMDDLIGR  120

Query  550  VVFDL  564
            ++FDL
Sbjct  121  IMFDL  125



>ref|XP_008658284.1| PREDICTED: uncharacterized protein LOC100273873 isoform X1 [Zea 
mays]
 ref|XP_008658285.1| PREDICTED: uncharacterized protein LOC100273873 isoform X1 [Zea 
mays]
 ref|XP_008658286.1| PREDICTED: uncharacterized protein LOC100273873 isoform X1 [Zea 
mays]
 gb|AFW87459.1| hypothetical protein ZEAMMB73_550028 [Zea mays]
 gb|AFW87460.1| hypothetical protein ZEAMMB73_550028 [Zea mays]
Length=775

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 110/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  193  MQRPP--QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  366
            MQRPP   E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TG
Sbjct  2    MQRPPLRPEEYSLKETTPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPNKDITG  60

Query  367  SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVG  546
            S DPYVEV+LGNYKG T HFEKK+NPEWNQVFAF+KERIQ+S++E++VKDKD  KDD +G
Sbjct  61   SCDPYVEVKLGNYKGQTGHFEKKNNPEWNQVFAFAKERIQSSVVEILVKDKDLVKDDFIG  120

Query  547  RVVFDL  564
            RV+FDL
Sbjct  121  RVIFDL  126



>ref|NP_196801.1| calcium-dependent lipid-binding domain-containing plant phosphoribosyltransferase-like 
protein [Arabidopsis thaliana]
 emb|CAB88261.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AED91836.1| calcium-dependent lipid-binding domain-containing plant phosphoribosyltransferase-like 
protein [Arabidopsis thaliana]
Length=769

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+P Q  DF LKET P +G G +TGDKL STYDLVEQM YLYVRVVKA++LP KDVTGS
Sbjct  1    MQKPGQNIDFALKETSPKIGAGSVTGDKLCSTYDLVEQMHYLYVRVVKAKELPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNY+G T+HFEK+SNPEW QVFAFSKERIQAS+LEV+VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYRGMTKHFEKRSNPEWKQVFAFSKERIQASILEVVVKDKDVVLDDLIGR  120

Query  550  VVFDL  564
            ++FDL
Sbjct  121  IMFDL  125



>ref|XP_002871539.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47798.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=769

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+P Q  +F LKET P +G G +TGDKL+ TYDLVEQM YLYVRVVKA++LP KDVTGS
Sbjct  1    MQKPGQNIEFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVVKAKELPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNY+G T+HFEKKSNPEW QVFAFSKERIQAS+LEV+VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYRGMTKHFEKKSNPEWKQVFAFSKERIQASILEVVVKDKDVVLDDLIGR  120

Query  550  VVFDL  564
            ++FDL
Sbjct  121  IMFDL  125



>ref|XP_010044995.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Eucalyptus grandis]
 gb|KCW87135.1| hypothetical protein EUGRSUZ_B03663 [Eucalyptus grandis]
Length=775

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 109/126 (87%), Gaps = 2/126 (2%)
 Frame = +1

Query  193  MQRPPQ-EDFMLKETKPHLGGGKIT-GDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  366
            MQ+PPQ +DF L+ET P++G G++T  DKL  TYDLVEQMQYLYVRVVKA++LP KDVTG
Sbjct  1    MQKPPQPQDFALRETSPNIGAGQVTPADKLACTYDLVEQMQYLYVRVVKAKELPGKDVTG  60

Query  367  SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVG  546
            + DPYVEV+LGNYKG TRHFEKKSNPEWNQVFAFSKERIQAS LEV+VKDKD   DD +G
Sbjct  61   TCDPYVEVKLGNYKGVTRHFEKKSNPEWNQVFAFSKERIQASSLEVVVKDKDVVLDDFMG  120

Query  547  RVVFDL  564
            R +FD+
Sbjct  121  RSMFDI  126



>ref|NP_001152102.1| phosphoribosylanthranilate transferase [Zea mays]
 gb|ACG45776.1| phosphoribosylanthranilate transferase [Zea mays]
Length=774

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  193  MQRP--PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  366
            MQRP    E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP  D+TG
Sbjct  2    MQRPLLRPEEYSLKETSPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPNMDITG  60

Query  367  SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVG  546
            S DPYVEV+LGNYKG T+HFEKK+NPEWNQVFAFSKERIQ+S++E++VKDKD  KDD +G
Sbjct  61   SCDPYVEVKLGNYKGQTQHFEKKNNPEWNQVFAFSKERIQSSVVEIVVKDKDLVKDDFIG  120

Query  547  RVVFDL  564
            RV+FDL
Sbjct  121  RVIFDL  126



>ref|XP_008647970.1| PREDICTED: phosphoribosylanthranilate transferase isoform X1 
[Zea mays]
 ref|XP_008647971.1| PREDICTED: phosphoribosylanthranilate transferase isoform X1 
[Zea mays]
 gb|AFW76297.1| phosphoribosylanthranilate transferase isoform 1 [Zea mays]
 gb|AFW76298.1| phosphoribosylanthranilate transferase isoform 2 [Zea mays]
 gb|AFW76299.1| phosphoribosylanthranilate transferase isoform 3 [Zea mays]
Length=774

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  193  MQRP--PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  366
            MQRP    E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP  D+TG
Sbjct  2    MQRPLLRPEEYSLKETSPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPNMDITG  60

Query  367  SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVG  546
            S DPYVEV+LGNYKG T+HFEKK+NPEWNQVFAFSKERIQ+S++E++VKDKD  KDD +G
Sbjct  61   SCDPYVEVKLGNYKGQTQHFEKKNNPEWNQVFAFSKERIQSSVVEIVVKDKDLVKDDFIG  120

Query  547  RVVFDL  564
            RV+FDL
Sbjct  121  RVIFDL  126



>ref|XP_010492034.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010492035.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010492036.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010492037.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=769

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+P Q  +F LKET P +G G +TGDKL+ TYDLVEQM YLYVRV+KA++LP KDVTGS
Sbjct  1    MQKPGQNIEFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVMKAKELPAKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG T+HFEKKSNPEW QVFAFSKERIQAS+LEV+VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYKGMTKHFEKKSNPEWKQVFAFSKERIQASILEVVVKDKDVVLDDFIGR  120

Query  550  VVFDL  564
            ++FDL
Sbjct  121  IMFDL  125



>ref|XP_010419857.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X2 [Camelina sativa]
Length=769

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+P Q  +F LKET P +G G +TGDKL+ TYDLVEQM YLYVRV+KA++LP KDVTGS
Sbjct  1    MQKPGQNIEFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVMKAKELPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG T+HFEKKSNPEW QVFAFSKERIQAS+LEV+VKDKD   DD VGR
Sbjct  61   CDPYVEVKLGNYKGMTKHFEKKSNPEWKQVFAFSKERIQASILEVVVKDKDVVLDDFVGR  120

Query  550  VVFDL  564
            ++FDL
Sbjct  121  IMFDL  125



>ref|XP_010419856.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Camelina sativa]
 ref|XP_010419858.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Camelina sativa]
Length=769

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+P Q  +F LKET P +G G +TGDKL+ TYDLVEQM YLYVRV+KA++LP KDVTGS
Sbjct  1    MQKPGQNIEFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVMKAKELPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKG T+HFEKKSNPEW QVFAFSKERIQAS+LEV+VKDKD   DD VGR
Sbjct  61   CDPYVEVKLGNYKGMTKHFEKKSNPEWKQVFAFSKERIQASILEVVVKDKDVVLDDFVGR  120

Query  550  VVFDL  564
            ++FDL
Sbjct  121  IMFDL  125



>emb|CDX70485.1| BnaC03g05690D [Brassica napus]
Length=769

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 105/125 (84%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            M++P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYVRVVKA++L  KDVTGS
Sbjct  1    MEKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVVKAKELSGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNY+G T+HFEKKSNPEW QVFAFSKERIQAS+LEVIVKDK+   DD +G 
Sbjct  61   CDPYVEVKLGNYRGMTKHFEKKSNPEWRQVFAFSKERIQASILEVIVKDKNVMLDDFIGG  120

Query  550  VVFDL  564
            ++FDL
Sbjct  121  IMFDL  125



>ref|XP_006289947.1| hypothetical protein CARUB_v10003573mg [Capsella rubella]
 gb|EOA22845.1| hypothetical protein CARUB_v10003573mg [Capsella rubella]
Length=769

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+P Q  +F LKET P +G G +TGDKL++TYDLVEQM YLYVRV+KA++LP KDVTGS
Sbjct  1    MQKPGQNIEFALKETSPKIGAGAVTGDKLSNTYDLVEQMHYLYVRVMKAKELPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNY+G T+HFEKKSNPEW QVFAFSKERIQAS+LEV+VKDKD   DD +GR
Sbjct  61   CDPYVEVKLGNYRGMTKHFEKKSNPEWKQVFAFSKERIQASILEVVVKDKDVVLDDLIGR  120

Query  550  VVFDL  564
            ++FDL
Sbjct  121  IMFDL  125



>ref|XP_004142139.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 ref|XP_004162018.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 gb|KGN54116.1| hypothetical protein Csa_4G286400 [Cucumis sativus]
Length=771

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+  Q  DF LKET P +G   ITGDKL+STYDLVEQMQYLYV VVKA+DLP KDVTGS
Sbjct  1    MQKILQPHDFALKETYPKIGAVSITGDKLSSTYDLVEQMQYLYVYVVKAKDLPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKGTT+HFEKKSNPEW QVFAFS+ERIQAS+LEV+VKDKDF  DD +GR
Sbjct  61   CDPYVEVKLGNYKGTTKHFEKKSNPEWKQVFAFSRERIQASLLEVVVKDKDFVVDDFMGR  120

Query  550  VVFDL  564
             +FDL
Sbjct  121  AIFDL  125



>ref|XP_008449758.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
Length=771

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 106/125 (85%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            MQ+  Q  DF LKET P +G   ITGDKL+ TYDLVEQMQYLYV VVKA+DLP KDVTGS
Sbjct  1    MQKTLQPHDFALKETYPKIGAVSITGDKLSCTYDLVEQMQYLYVYVVKAKDLPGKDVTGS  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DPYVEV+LGNYKGTT+HFEKKSNPEW QVFAFS+ERIQAS+LEV+VKDKDF  DD +GR
Sbjct  61   CDPYVEVKLGNYKGTTKHFEKKSNPEWKQVFAFSRERIQASLLEVVVKDKDFVVDDFMGR  120

Query  550  VVFDL  564
             +FDL
Sbjct  121  AIFDL  125



>gb|KHN33324.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine 
soja]
Length=774

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            M +P +  DF L+ET P++G G +  DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1    MHKPAEALDFALRETSPNIGAGAVMRDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
            +DPYVEV+LGNYKG T+HFEKKSNP+WNQVFAFSKERIQAS+LE+++KDKD   DD VGR
Sbjct  61   VDPYVEVKLGNYKGLTKHFEKKSNPQWNQVFAFSKERIQASVLELVIKDKDVVVDDFVGR  120

Query  550  VVFDL  564
            V+FD+
Sbjct  121  VMFDI  125



>ref|XP_003546988.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Glycine max]
Length=774

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            M +P +  DF L+ET P++G G +  DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1    MHKPAEALDFALRETSPNIGAGAVMRDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
            +DPYVEV+LGNYKG T+HFEKKSNP+WNQVFAFSKERIQAS+LEV++KDKD   DD VGR
Sbjct  61   VDPYVEVKLGNYKGLTKHFEKKSNPQWNQVFAFSKERIQASVLEVVIKDKDVVVDDFVGR  120

Query  550  VVFDL  564
            V+FD+
Sbjct  121  VMFDI  125



>ref|XP_007150401.1| hypothetical protein PHAVU_005G150300g [Phaseolus vulgaris]
 ref|XP_007150402.1| hypothetical protein PHAVU_005G150300g [Phaseolus vulgaris]
 gb|ESW22395.1| hypothetical protein PHAVU_005G150300g [Phaseolus vulgaris]
 gb|ESW22396.1| hypothetical protein PHAVU_005G150300g [Phaseolus vulgaris]
Length=774

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 106/126 (84%), Gaps = 2/126 (2%)
 Frame = +1

Query  187  HKMQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  366
            HK + PP+  F LKET P++G G +  DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG
Sbjct  2    HKPEGPPE--FALKETSPNIGAGAVMRDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTG  59

Query  367  SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVG  546
             +DPYVEV+LGNYKG T+HFEKKSNP+WN VFAFSKE IQAS+LEV++KDKD   D+ VG
Sbjct  60   GVDPYVEVKLGNYKGLTKHFEKKSNPQWNHVFAFSKESIQASVLEVVLKDKDVVVDEFVG  119

Query  547  RVVFDL  564
            RV+FDL
Sbjct  120  RVMFDL  125



>ref|XP_003543552.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X1 [Glycine max]
 ref|XP_006595053.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X2 [Glycine max]
 gb|KHN30112.1| Multiple C2 and transmembrane domain-containing protein 2 [Glycine 
soja]
Length=775

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            M +P +  DF LKET P++G G +  DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1    MHKPAEALDFALKETSPNIGAGAVMRDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
            +DPYVEV+LGNYKG T+HFEK SNP+WNQVFAFSKERIQAS+LEV++KDKD   DD VGR
Sbjct  61   VDPYVEVKLGNYKGLTKHFEKNSNPQWNQVFAFSKERIQASVLEVVIKDKDVVVDDFVGR  120

Query  550  VVFDL  564
            V+FD+
Sbjct  121  VMFDI  125



>ref|XP_010238001.1| PREDICTED: LOW QUALITY PROTEIN: extended synaptotagmin-1-like 
[Brachypodium distachyon]
Length=771

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRP  E+++LK+T PHLGG    GDKLT TYDLVEQMQYLYV VVKA+DLP KD+TGS 
Sbjct  1    MQRPRSEEYLLKDTSPHLGGFMAAGDKLTRTYDLVEQMQYLYVHVVKAKDLPFKDLTGSC  60

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddS-VGR  549
            DPYVE++LGNYKG T H EK ++PEWNQVFAF KE IQ+  +EV+VKDKD    D  +GR
Sbjct  61   DPYVEIKLGNYKGITHHMEKNTSPEWNQVFAFPKEHIQSPYVEVVVKDKDLFIQDDFIGR  120

Query  550  VVFDL  564
             VFDL
Sbjct  121  AVFDL  125



>ref|XP_009417304.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Musa acuminata subsp. malaccensis]
Length=777

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 114/128 (89%), Gaps = 4/128 (3%)
 Frame = +1

Query  193  MQRP---PQEDFMLKETKPHLGGGKITG-DKLTSTYDLVEQMQYLYVRVVKARDLPPKDV  360
            MQRP   PQEDF LKET P LGGG + G DKLT+TYDLVEQMQYLYVRVVKA+DLP KDV
Sbjct  1    MQRPFPLPQEDFSLKETAPRLGGGGLGGGDKLTNTYDLVEQMQYLYVRVVKAKDLPAKDV  60

Query  361  TGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddS  540
            TGS DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSK+RIQAS++EV+VKDKDF KDD 
Sbjct  61   TGSCDPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQASVVEVVVKDKDFVKDDF  120

Query  541  VGRVVFDL  564
            +G V+FDL
Sbjct  121  MGMVLFDL  128



>ref|XP_006349900.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Solanum tuberosum]
Length=771

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 98/124 (79%), Gaps = 13/124 (10%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
            MQRPPQEDF       HL GGK+TGD  T TYDLVEQMQYLYVRVVKA+DLP KD    L
Sbjct  1    MQRPPQEDF-----SAHLDGGKVTGDMFTRTYDLVEQMQYLYVRVVKAKDLPGKD----L  51

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEVRLGNY GTTRHF KK+NPEWNQVFAFS ++IQ S+LEV V     DKDDSVGRV
Sbjct  52   DPYVEVRLGNYSGTTRHFVKKTNPEWNQVFAFSMDQIQVSVLEVNV----KDKDDSVGRV  107

Query  553  VFDL  564
            +FDL
Sbjct  108  MFDL  111



>ref|XP_010255412.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Nelumbo nucifera]
 ref|XP_010255414.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Nelumbo nucifera]
 ref|XP_010255415.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Nelumbo nucifera]
Length=1011

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 104/123 (85%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G      DK  STYDLVEQMQ+L+VRVVKAR+LPP D+TGSLD
Sbjct  235  DYALKETSPFLGGGQIVGGRVIRADKPASTYDLVEQMQFLFVRVVKARELPPMDITGSLD  294

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEV++GNYKG TRHFEKK NPEWN+VFAF+++R+Q+S+LEV+VKDKD  KDD VG ++
Sbjct  295  PYVEVKVGNYKGVTRHFEKKQNPEWNEVFAFARDRMQSSVLEVVVKDKDLVKDDFVGIIM  354

Query  556  FDL  564
            FDL
Sbjct  355  FDL  357



>ref|XP_009383872.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Musa acuminata subsp. malaccensis]
Length=1012

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 102/123 (83%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G      +K  STYDLVEQMQYL+VRVVKARDLP  DVTGSLD
Sbjct  241  DYALKETSPFLGGGQIVGGRVIRAEKPASTYDLVEQMQYLFVRVVKARDLPAMDVTGSLD  300

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEV++GNYKGTT+HFEKK NPEWN+VFAFS+E +QAS+LEV++KDKD  KDD VG + 
Sbjct  301  PYVEVKVGNYKGTTKHFEKKQNPEWNEVFAFSREHMQASILEVVIKDKDLLKDDFVGIIR  360

Query  556  FDL  564
            FDL
Sbjct  361  FDL  363



>ref|XP_010940465.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
 ref|XP_010940466.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
 ref|XP_010940467.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
Length=1004

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 104/123 (85%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G      +K TSTYDLVEQMQYL+VRVVKARDLP  DV+GSLD
Sbjct  232  DYALKETSPFLGGGQIVGGRVIRAEKPTSTYDLVEQMQYLFVRVVKARDLPAMDVSGSLD  291

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEVR+GNY+G+T+HFEKK NPEWN+VFAFS++R+Q+S+LEV+VKD+D  KDD VG + 
Sbjct  292  PYVEVRVGNYRGSTKHFEKKQNPEWNEVFAFSRDRMQSSVLEVVVKDRDLIKDDFVGLIR  351

Query  556  FDL  564
            FDL
Sbjct  352  FDL  354



>ref|XP_009386410.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386411.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386412.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386413.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386414.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386415.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
Length=1004

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 103/123 (84%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G      DK  STYDLVEQMQYL+VRVVKA+DLP  DVTGSLD
Sbjct  232  DYALKETSPFLGGGQIVGGRVIRADKPASTYDLVEQMQYLFVRVVKAKDLPAMDVTGSLD  291

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            P+VEVR+GNYKGTT+HFEKK NPEWN+VFAFS++++QAS++EV+VKDKD  KDD VG V 
Sbjct  292  PFVEVRVGNYKGTTKHFEKKQNPEWNEVFAFSRDQLQASIVEVVVKDKDLVKDDFVGLVR  351

Query  556  FDL  564
            FDL
Sbjct  352  FDL  354



>ref|XP_002511838.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF50507.1| synaptotagmin, putative [Ricinus communis]
Length=1017

 Score =   164 bits (414),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 104/123 (85%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G      D++ STYDLVEQM+YL+VRVVKAR+LP KDVTGSLD
Sbjct  244  DYALKETSPFLGGGQIVGGRVIRRDRIASTYDLVEQMKYLFVRVVKARELPSKDVTGSLD  303

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEVR+GNYKG T+HFEKK NPEWN+VFAF+++R+Q+S+LEV+VKDKD  KDD VG V 
Sbjct  304  PYVEVRVGNYKGITKHFEKKQNPEWNEVFAFARDRMQSSVLEVVVKDKDLVKDDFVGIVR  363

Query  556  FDL  564
            FD+
Sbjct  364  FDM  366



>ref|XP_008806876.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008806877.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
Length=1002

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 102/123 (83%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G      +K  STYDLVEQMQYL+VRVVKARDLP  DVTGSLD
Sbjct  230  DYALKETSPFLGGGQIVGGRVIRAEKPASTYDLVEQMQYLFVRVVKARDLPAMDVTGSLD  289

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEVR+GNY+G T+HFEKK NPEWN+VFAFS++R+Q+S+LEV+VKDKD  KDD VG + 
Sbjct  290  PYVEVRVGNYRGITKHFEKKQNPEWNEVFAFSRDRMQSSILEVVVKDKDLVKDDFVGFIR  349

Query  556  FDL  564
            FDL
Sbjct  350  FDL  352



>gb|KDP28646.1| hypothetical protein JCGZ_14417 [Jatropha curcas]
Length=1025

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 104/123 (85%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G      D++TSTYDLVEQM+YL+VRVVKARDLP  DVTGSLD
Sbjct  250  DYALKETSPFLGGGQIVGGRVIRGDRMTSTYDLVEQMRYLFVRVVKARDLPTMDVTGSLD  309

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEVR+GNYKG T++FEK+ NPEWN+VFAF++ER+Q+S+LEV+VKDKD  KDD VG V 
Sbjct  310  PYVEVRVGNYKGITKYFEKQQNPEWNEVFAFARERMQSSVLEVVVKDKDLVKDDFVGIVR  369

Query  556  FDL  564
            FD+
Sbjct  370  FDM  372



>emb|CBI40337.3| unnamed protein product [Vitis vinifera]
Length=640

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 100/123 (81%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G      DK  STYDLVEQM YL+VRVVKARDLP KDVTGSLD
Sbjct  164  DYQLKETSPILGGGQIVGGRVIRADKPASTYDLVEQMHYLFVRVVKARDLPTKDVTGSLD  223

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            P+VEVR+GNYKG T+HFEK  NPEWN+VFAF+ +R+Q+S+LEV+VKDKD  KDD VG V 
Sbjct  224  PFVEVRVGNYKGITKHFEKNKNPEWNEVFAFAGDRMQSSVLEVVVKDKDMLKDDIVGFVR  283

Query  556  FDL  564
            FDL
Sbjct  284  FDL  286



>emb|CDP14088.1| unnamed protein product [Coffea canephora]
Length=762

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 101/126 (80%), Gaps = 2/126 (2%)
 Frame = +1

Query  193  MQRPPQEDFMLKETKPHLGGGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  366
            M+ P  E+F LKET P + G    I GDKLT TYDLVEQMQYLYVRVVKARDLP KDVTG
Sbjct  1    MKLPQPEEFALKETAPKIAGSGAIIDGDKLTCTYDLVEQMQYLYVRVVKARDLPGKDVTG  60

Query  367  SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVG  546
            S DPY EV++GNYKG T+HFEKKSNPEWN VFAFS++++QAS +EV+VKDKD   DD +G
Sbjct  61   SCDPYAEVKVGNYKGVTKHFEKKSNPEWNYVFAFSQDKLQASFVEVVVKDKDVVLDDFIG  120

Query  547  RVVFDL  564
            R+ FD 
Sbjct  121  RITFDF  126



>ref|XP_010105960.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus 
notabilis]
 gb|EXC06842.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus 
notabilis]
Length=1006

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 102/123 (83%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G ++      TSTYDLVE+MQYL++RVVKARDLP KDVTGSLD
Sbjct  232  DYSLKETSPFLGGGQIIGGRVIPGNRPTSTYDLVEKMQYLFIRVVKARDLPAKDVTGSLD  291

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEV++GNYKG T+HFEKK NPEWN+VFAF+K+ +Q+S+LEV+VKDKD   DD VG V 
Sbjct  292  PYVEVKMGNYKGKTKHFEKKQNPEWNEVFAFAKDNLQSSVLEVLVKDKDVLIDDFVGLVR  351

Query  556  FDL  564
            FDL
Sbjct  352  FDL  354



>ref|XP_007052594.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein [Theobroma cacao]
 gb|EOX96751.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein [Theobroma cacao]
Length=1050

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 106/139 (76%), Gaps = 12/139 (9%)
 Frame = +1

Query  184  NHKMQRPPQEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVV  330
            N + Q   QED+ LK+T P LG         GG+  I+G++ TSTYDLVEQM YLYVRVV
Sbjct  257  NAQAQPGYQEDYNLKDTNPQLGERWPNGGAYGGRGWISGERFTSTYDLVEQMFYLYVRVV  316

Query  331  KARDLPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIV  510
            KA+DLPP  VTGS DPYVEV+LGNYKG T+HFE+K NPEWNQVFAFSK+R+Q+S+LEV V
Sbjct  317  KAKDLPPSSVTGSCDPYVEVKLGNYKGRTKHFERKMNPEWNQVFAFSKDRVQSSVLEVFV  376

Query  511  kdkdfdkddS-VGRVVFDL  564
            KDK+    D  +GRVVFDL
Sbjct  377  KDKEMVGRDDYLGRVVFDL  395



>ref|XP_011023361.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=1007

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 103/123 (84%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+  KET P LGGG+I G      D+ +S+YDLVEQM+YLYVRVVKARDLP  DVTGSLD
Sbjct  235  DYTPKETSPFLGGGQIVGGRVIRGDRPSSSYDLVEQMKYLYVRVVKARDLPTMDVTGSLD  294

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEV++GNYKGTT+HFEKK NPEWN+VFAF+++RIQ+S+LEV+VKDKD  KDD VG V 
Sbjct  295  PYVEVKVGNYKGTTKHFEKKQNPEWNEVFAFARDRIQSSVLEVVVKDKDLIKDDFVGIVR  354

Query  556  FDL  564
            FDL
Sbjct  355  FDL  357



>ref|XP_006850085.1| hypothetical protein AMTR_s00022p00218970 [Amborella trichopoda]
 gb|ERN11666.1| hypothetical protein AMTR_s00022p00218970 [Amborella trichopoda]
Length=1036

 Score =   161 bits (407),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 100/135 (74%), Gaps = 8/135 (6%)
 Frame = +1

Query  181  NNHKMQRPP------QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARD  342
            NN++   PP        DF LK T PHLG G  +  +  STYDLVEQM YLYVRVVKA+D
Sbjct  253  NNYQNIVPPPPGTHHHGDFGLKNTSPHLGTG-WSNREFASTYDLVEQMHYLYVRVVKAKD  311

Query  343  LPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkd  522
            LP   VTGS DPY EV+LGNYKGTT+HFEKK NPEWNQVFAFSKERIQ+SMLEV VKDK+
Sbjct  312  LPASSVTGSCDPYAEVKLGNYKGTTKHFEKKLNPEWNQVFAFSKERIQSSMLEVFVKDKE  371

Query  523  fdkddS-VGRVVFDL  564
                D  +GRVVFDL
Sbjct  372  MVGRDDYLGRVVFDL  386


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +1

Query  313  LYVRVVKARDLPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFS  471
            L V V++A DL PKD  GS  P+VEV   N +  T+  EK  NP WN+   F+
Sbjct  3    LVVEVIEAHDLMPKDGEGSATPFVEVDFENQRIRTKSLEKTLNPHWNEQLIFN  55



>ref|XP_011015655.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=1007

 Score =   160 bits (406),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 102/123 (83%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+  KET P LGGG+I G      D+  STYDLVEQM+YL+VRVVKARDLP  DVTGSLD
Sbjct  235  DYTPKETSPFLGGGQIVGGRVIRGDRPASTYDLVEQMKYLFVRVVKARDLPTMDVTGSLD  294

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEV++GNYKGTT+HFEKK NPEWN+VFAF+++RIQ+S+LEV+VKDKD  KDD VG V 
Sbjct  295  PYVEVKVGNYKGTTKHFEKKQNPEWNEVFAFARDRIQSSVLEVVVKDKDLIKDDFVGIVR  354

Query  556  FDL  564
            FDL
Sbjct  355  FDL  357



>ref|XP_007220279.1| hypothetical protein PRUPE_ppa000771mg [Prunus persica]
 gb|EMJ21478.1| hypothetical protein PRUPE_ppa000771mg [Prunus persica]
Length=1009

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 102/123 (83%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P+LGGG+I G      D+ + TYDLV++MQYL+VRVVKARDLP  DVTGSLD
Sbjct  233  DYSLKETSPYLGGGQIVGGRVIRADRPSGTYDLVQKMQYLFVRVVKARDLPHMDVTGSLD  292

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEVR+GNYKGTTRHFEKK NPEWN+VFAF+KE  Q+S+L+V+VKDKD  KDD VG V 
Sbjct  293  PYVEVRIGNYKGTTRHFEKKQNPEWNEVFAFAKENEQSSVLDVVVKDKDLLKDDFVGLVR  352

Query  556  FDL  564
            FDL
Sbjct  353  FDL  355



>ref|XP_008244912.1| PREDICTED: uncharacterized protein LOC103343020 [Prunus mume]
Length=1009

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 102/123 (83%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P+LGGG+I G      D+ + TYDLV++MQYL+VRVVKARDLP  DVTGSLD
Sbjct  233  DYSLKETSPYLGGGQIVGGRVIRADRPSGTYDLVQKMQYLFVRVVKARDLPHMDVTGSLD  292

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEVR+GNYKGTTRHFEKK NPEWN+VFAF+KE  Q+S+L+V+VKDKD  KDD VG V 
Sbjct  293  PYVEVRIGNYKGTTRHFEKKQNPEWNEVFAFAKENEQSSVLDVVVKDKDLLKDDFVGLVR  352

Query  556  FDL  564
            FDL
Sbjct  353  FDL  355



>ref|XP_010660813.1| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera]
 ref|XP_010660820.1| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera]
 ref|XP_010660822.1| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera]
Length=1002

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 99/123 (80%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            DF LKET P LGGG+      I  DK  STYDLVEQMQ+L+VRVVKAR+LP  DVTGSLD
Sbjct  229  DFALKETSPFLGGGQVVRGRVIRSDKTASTYDLVEQMQFLFVRVVKARELPAMDVTGSLD  288

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEV++GNYKG T+H EKK NPEWN VFAFS++R+QAS+LEV+VKDKD  KDD VGR  
Sbjct  289  PYVEVKIGNYKGVTKHMEKKQNPEWNVVFAFSRDRMQASVLEVVVKDKDLVKDDFVGRAR  348

Query  556  FDL  564
            FDL
Sbjct  349  FDL  351



>ref|XP_002271590.1| PREDICTED: uncharacterized protein LOC100253432 [Vitis vinifera]
Length=1018

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 100/123 (81%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G      DK  STYDLVEQM YL+VRVVKARDLP KDVTGSLD
Sbjct  238  DYQLKETSPILGGGQIVGGRVIRADKPASTYDLVEQMHYLFVRVVKARDLPTKDVTGSLD  297

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            P+VEVR+GNYKG T+HFEK  NPEWN+VFAF+ +R+Q+S+LEV+VKDKD  KDD VG V 
Sbjct  298  PFVEVRVGNYKGITKHFEKNKNPEWNEVFAFAGDRMQSSVLEVVVKDKDMLKDDIVGFVR  357

Query  556  FDL  564
            FDL
Sbjct  358  FDL  360



>ref|XP_009393442.1| PREDICTED: uncharacterized protein LOC103979123 [Musa acuminata 
subsp. malaccensis]
Length=1041

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 99/122 (81%), Gaps = 2/122 (2%)
 Frame = +1

Query  205  PQEDFMLKETKPHLGG--GKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDP  378
            P  DF + ET P L G  G  +GDK+ STYDLVEQM+YLYV VVKARDLP  D+TGSLDP
Sbjct  269  PGPDFGIVETAPPLAGRLGYRSGDKIASTYDLVEQMRYLYVNVVKARDLPTMDLTGSLDP  328

Query  379  YVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVVF  558
            YVEV+LGNYKGTT+H EK SNP W QVFAFSK+RIQ+S LEV+VKDKD  KDD VGR+VF
Sbjct  329  YVEVKLGNYKGTTKHLEKNSNPVWQQVFAFSKDRIQSSQLEVVVKDKDLVKDDFVGRLVF  388

Query  559  DL  564
            DL
Sbjct  389  DL  390



>ref|XP_002301353.2| hypothetical protein POPTR_0002s15950g [Populus trichocarpa]
 gb|EEE80626.2| hypothetical protein POPTR_0002s15950g [Populus trichocarpa]
Length=1008

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 102/123 (83%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+  KET P LGGG+I G      D+  STYDLVEQM+YL+VRVVKARDLP  DVTGSLD
Sbjct  236  DYTPKETSPFLGGGQIVGGRVIRGDRPASTYDLVEQMKYLFVRVVKARDLPTMDVTGSLD  295

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEV++GNYKGTT+HFEKK NPEWN+VFAF+++R+Q+S+LEV+VKDKD  KDD VG V 
Sbjct  296  PYVEVKVGNYKGTTKHFEKKQNPEWNEVFAFARDRMQSSVLEVVVKDKDLIKDDFVGIVR  355

Query  556  FDL  564
            FDL
Sbjct  356  FDL  358



>ref|XP_010053272.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053273.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053274.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053275.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053276.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053277.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053278.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 gb|KCW77541.1| hypothetical protein EUGRSUZ_D01859 [Eucalyptus grandis]
Length=1009

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 102/123 (83%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            ++ LKET P+LGGG+      I GDK  STYDLVEQM +LYVRVVKAR+LP  D++GS+D
Sbjct  236  EYALKETSPYLGGGRVVAGRVIRGDKTASTYDLVEQMHFLYVRVVKARELPAMDISGSID  295

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEVR+GNYKG TRH+E+K NPEWNQVFAFS+ER+QAS+L+V++KDKD  KDD VG V 
Sbjct  296  PYVEVRVGNYKGITRHYEQKQNPEWNQVFAFSRERMQASVLDVVIKDKDLVKDDFVGIVR  355

Query  556  FDL  564
            FD+
Sbjct  356  FDV  358



>gb|EMT30716.1| hypothetical protein F775_31640 [Aegilops tauschii]
Length=983

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 101/123 (82%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G      +K  STYDLVE+MQYL+VRVVKARDLP  D+TGSLD
Sbjct  242  DYALKETSPFLGGGQIVGGRVIGGEKHASTYDLVERMQYLFVRVVKARDLPNMDITGSLD  301

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            P+VEVR+GNY+G T+HFEK+ NPEWN VFAFS+ER+QAS++EV+VKDKD  +DD VG V 
Sbjct  302  PFVEVRVGNYRGITKHFEKQRNPEWNAVFAFSRERMQASVIEVLVKDKDLVRDDFVGMVR  361

Query  556  FDL  564
            FDL
Sbjct  362  FDL  364



>dbj|BAK04937.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1016

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 101/123 (82%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G      +K  STYDLVE+MQYL+VRVVKARDLP  D+TGSLD
Sbjct  242  DYALKETSPFLGGGQIVGGRVIGGEKHASTYDLVERMQYLFVRVVKARDLPNMDITGSLD  301

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            P+VEVR+GNY+G T+HFEK+ NPEWN VFAFS+ER+QAS++EV+VKDKD  +DD VG V 
Sbjct  302  PFVEVRVGNYRGITKHFEKQRNPEWNAVFAFSRERMQASVVEVLVKDKDLVRDDFVGMVR  361

Query  556  FDL  564
            FDL
Sbjct  362  FDL  364



>ref|XP_010928529.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 1 [Elaeis guineensis]
Length=1012

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 8/126 (6%)
 Frame = +1

Query  211  EDFMLKETKPHLG-------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            E++ LK+T P LG        GK  GDK TSTYDLVEQM YLYVRVVKA+DLP   +TGS
Sbjct  234  EEYKLKDTSPQLGERWPAGAHGKGDGDKFTSTYDLVEQMYYLYVRVVKAKDLPTNAITGS  293

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddS-VG  546
             DPY EV+LGNY+GTT+HFEK++NPEWNQVFAFSKERIQ+++LEV VKD++    D  VG
Sbjct  294  CDPYAEVKLGNYRGTTKHFEKRTNPEWNQVFAFSKERIQSTILEVFVKDREMVARDDYVG  353

Query  547  RVVFDL  564
            +VVFDL
Sbjct  354  KVVFDL  359


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 35/69 (51%), Gaps = 8/69 (12%)
 Frame = +1

Query  313  LYVRVVKARDLPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAF--------  468
            L V VV A DL PKD  GS   +VEV  GN    TR   K  NP WNQ  +F        
Sbjct  3    LVVEVVDAHDLMPKDGEGSASAFVEVDFGNQLTRTRTIPKDLNPVWNQRLSFYLDDPESL  62

Query  469  SKERIQASM  495
            SK+ I+ S+
Sbjct  63   SKQSIEVSI  71



>emb|CAN79812.1| hypothetical protein VITISV_018822 [Vitis vinifera]
Length=1020

 Score =   158 bits (399),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 99/123 (80%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G      DK  STYDLVEQM YL+VRVVKARDLP KDVTGSLD
Sbjct  240  DYQLKETSPILGGGQIVGGRVIRADKPASTYDLVEQMHYLFVRVVKARDLPTKDVTGSLD  299

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            P+VEVR+GNYKG T+HFEK  NPEWN+VFAF+ +R+Q+S+LEV+VKDKD  KDD VG   
Sbjct  300  PFVEVRVGNYKGITKHFEKNKNPEWNEVFAFAGDRMQSSVLEVVVKDKDMLKDDIVGFXR  359

Query  556  FDL  564
            FDL
Sbjct  360  FDL  362



>gb|KDO57729.1| hypothetical protein CISIN_1g003882mg [Citrus sinensis]
Length=789

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 100/131 (76%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            QED+ LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRV KARDLP  
Sbjct  10   QEDYKLKDTKPQLGERWPHGGIRGAGGWISSERATSTYDLVEQMFYLYVRVEKARDLPTN  69

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             V+GS DPYVEV+LGNYKG TRHFEKKSNPEW QVFAFSKE+IQ+S+LEV V+D++    
Sbjct  70   PVSGSCDPYVEVKLGNYKGKTRHFEKKSNPEWKQVFAFSKEKIQSSVLEVFVRDREIVGR  129

Query  535  dS-VGRVVFDL  564
            D  +G+VVFD+
Sbjct  130  DDYIGKVVFDM  140



>ref|XP_003580853.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Brachypodium distachyon]
Length=1009

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 101/123 (82%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G      +K  STYDLVE+MQYL+VRVVKARDLP  D+TGSLD
Sbjct  235  DYALKETSPFLGGGQIVGGRVIRGEKHASTYDLVERMQYLFVRVVKARDLPDMDITGSLD  294

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            P+VEVR+GNY+G T+HFEK+ NPEWN VFAF+++R+QAS+LEV+VKDKD  KDD VG V 
Sbjct  295  PFVEVRVGNYRGITKHFEKQRNPEWNAVFAFARDRMQASVLEVLVKDKDLVKDDFVGMVR  354

Query  556  FDL  564
            FDL
Sbjct  355  FDL  357



>ref|XP_010934752.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
 ref|XP_010934753.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
 ref|XP_010934755.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
Length=1004

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 101/123 (82%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G      +K  STYDLVEQMQYL+VRVVKARDLP  DVTGSLD
Sbjct  232  DYALKETSPFLGGGQIVGGRVIRAEKPASTYDLVEQMQYLFVRVVKARDLPAMDVTGSLD  291

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            P+VEVR+GNY+G T+HFEKK NPEW +VFAFS++R+Q+S+L+V+VKDK+  KDD VG + 
Sbjct  292  PFVEVRVGNYRGNTKHFEKKQNPEWKEVFAFSRDRMQSSVLDVVVKDKNLVKDDFVGFIR  351

Query  556  FDL  564
            FDL
Sbjct  352  FDL  354



>ref|XP_006439068.1| hypothetical protein CICLE_v10030600mg [Citrus clementina]
 gb|ESR52308.1| hypothetical protein CICLE_v10030600mg [Citrus clementina]
Length=1026

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 100/131 (76%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            QE++ LK+T P LG            G ++G++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  241  QEEYNLKDTNPQLGERWPNGGGYGGRGWMSGERFTSTYDLVEQMSYLYVRVVKAKDLPPS  300

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             +TGS DPYVEV++GNYKG T+HFEK+ NPEWNQVFAFSKERIQ+SMLEV VKDK+    
Sbjct  301  SITGSCDPYVEVKMGNYKGRTKHFEKRMNPEWNQVFAFSKERIQSSMLEVFVKDKEMLGR  360

Query  535  dS-VGRVVFDL  564
            D  +GRV FDL
Sbjct  361  DDYLGRVAFDL  371



>ref|XP_006483676.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Citrus sinensis]
Length=1035

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 100/131 (76%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            QE++ LK+T P LG            G ++G++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  250  QEEYNLKDTNPQLGERWLNGGGYGGRGWMSGERFTSTYDLVEQMSYLYVRVVKAKDLPPS  309

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             +TGS DPYVEV++GNYKG T+HFEK+ NPEWNQVFAFSKERIQ+SMLEV VKDK+    
Sbjct  310  SITGSCDPYVEVKMGNYKGRTKHFEKRMNPEWNQVFAFSKERIQSSMLEVFVKDKEMLGR  369

Query  535  dS-VGRVVFDL  564
            D  +GRV FDL
Sbjct  370  DDYLGRVAFDL  380



>ref|XP_002509788.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF51175.1| synaptotagmin, putative [Ricinus communis]
Length=980

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 88/105 (84%), Gaps = 6/105 (6%)
 Frame = +1

Query  214  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+      I GDK  STYDLVE+M +LYVRVVKARDLP  DVTGS+D
Sbjct  235  DYALKETSPLLGGGRVVHGRVIHGDKTASTYDLVERMFFLYVRVVKARDLPAMDVTGSID  294

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIV  510
            P+VEV++GNYKG T+HFEKK NPEWNQVFAFS+ER+QAS+LEV++
Sbjct  295  PFVEVKIGNYKGITKHFEKKQNPEWNQVFAFSRERMQASILEVVI  339



>ref|XP_006445078.1| hypothetical protein CICLE_v10018672mg [Citrus clementina]
 ref|XP_006491075.1| PREDICTED: uncharacterized protein LOC102617920 [Citrus sinensis]
 gb|ESR58318.1| hypothetical protein CICLE_v10018672mg [Citrus clementina]
Length=1008

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 102/123 (83%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG++ G ++       STYDLVEQM+YL+VRVVKARDLP KDVTGSLD
Sbjct  235  DYALKETSPFLGGGQVIGGRVVRGDLRASTYDLVEQMRYLFVRVVKARDLPSKDVTGSLD  294

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            P+VEV++GNYKG T+++EKK NPEWN+VFAFS+ERIQ+S+LEV VKDKD  KDD VG V 
Sbjct  295  PFVEVKVGNYKGITKYYEKKQNPEWNEVFAFSRERIQSSVLEVAVKDKDVVKDDYVGLVR  354

Query  556  FDL  564
            FDL
Sbjct  355  FDL  357



>gb|KDO86111.1| hypothetical protein CISIN_1g001835mg [Citrus sinensis]
 gb|KDO86112.1| hypothetical protein CISIN_1g001835mg [Citrus sinensis]
Length=1008

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 102/123 (83%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG++ G ++       STYDLVEQM+YL+VRVVKARDLP KDVTGSLD
Sbjct  235  DYALKETSPFLGGGQVIGGRVVRGDLRASTYDLVEQMRYLFVRVVKARDLPSKDVTGSLD  294

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            P+VEV++GNYKG T+++EKK NPEWN+VFAFS+ERIQ+S+LEV VKDKD  KDD VG V 
Sbjct  295  PFVEVKVGNYKGITKYYEKKQNPEWNEVFAFSRERIQSSVLEVAVKDKDVVKDDYVGLVR  354

Query  556  FDL  564
            FDL
Sbjct  355  FDL  357



>ref|XP_006342310.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum tuberosum]
Length=791

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 103/132 (78%), Gaps = 12/132 (9%)
 Frame = +1

Query  205  PQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  351
            PQ+D+  KETKP LG           GG I+ D++TSTYDLVEQM +LYVRVVKARDLPP
Sbjct  9    PQDDYKAKETKPQLGERWPHGGFRGGGGWISSDRVTSTYDLVEQMHFLYVRVVKARDLPP  68

Query  352  KDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdk  531
              VTGS DPYVEV+LGNYKG T+HF+KK NPEW QVFAFSKE+IQ+S++EV V+DK+  +
Sbjct  69   NPVTGSCDPYVEVKLGNYKGKTKHFDKKVNPEWKQVFAFSKEKIQSSIIEVFVRDKEMVQ  128

Query  532  ddS-VGRVVFDL  564
             D  +G+VVFD+
Sbjct  129  RDDYLGKVVFDM  140



>emb|CDX81021.1| BnaC03g02750D [Brassica napus]
Length=287

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 99/131 (76%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            QED+ LK+ KP LG            G I+ +++ STYDLVEQM YLYVRVVKA+DLPP 
Sbjct  9    QEDYKLKDMKPDLGEKWPHGGQRGGSGWISSERVASTYDLVEQMFYLYVRVVKAKDLPPN  68

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             VT + DPYVEV++GNYKG T+HFEK++NPEWNQVFAFSK++IQ+S +EV V+DK+    
Sbjct  69   PVTSNCDPYVEVKIGNYKGKTKHFEKRTNPEWNQVFAFSKDKIQSSTVEVFVRDKEMVTR  128

Query  535  dS-VGRVVFDL  564
            D  +G+VVFD+
Sbjct  129  DDYIGKVVFDM  139



>ref|XP_007051845.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein isoform 2 [Theobroma cacao]
 gb|EOX96002.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein isoform 2 [Theobroma cacao]
Length=949

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 100/123 (81%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G      D+  STYDLVEQM+YL+VRVVKA+DLP KDV GSLD
Sbjct  230  DYALKETSPFLGGGQIVGGRVIRGDRPASTYDLVEQMRYLFVRVVKAQDLPSKDVAGSLD  289

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEV++GNYKG T+H+EKK NPEWNQVFAF+++ +Q S+LEVI+KDKD  KDD VG V 
Sbjct  290  PYVEVKVGNYKGITKHYEKKQNPEWNQVFAFARDTVQTSVLEVILKDKDLVKDDFVGIVR  349

Query  556  FDL  564
            FDL
Sbjct  350  FDL  352



>ref|XP_007204276.1| hypothetical protein PRUPE_ppa001596mg [Prunus persica]
 gb|EMJ05475.1| hypothetical protein PRUPE_ppa001596mg [Prunus persica]
Length=795

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 101/133 (76%), Gaps = 12/133 (9%)
 Frame = +1

Query  202  PPQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLP  348
            P QED+ LK+TKPHLG           GG I+ ++ TSTYDLVEQM YLYVRVVKA+DLP
Sbjct  7    PNQEDYKLKDTKPHLGERWPHGGIRGGGGWISSERATSTYDLVEQMFYLYVRVVKAKDLP  66

Query  349  PKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfd  528
               VTG  DPYV V+LGNYKG T+HFEKK+NPEWNQVFAFSKE+IQAS+LEV VKDK   
Sbjct  67   TNPVTGICDPYVGVKLGNYKGKTQHFEKKTNPEWNQVFAFSKEKIQASILEVYVKDKAMV  126

Query  529  kddS-VGRVVFDL  564
              D  VG+VVFD+
Sbjct  127  ARDDYVGKVVFDM  139



>ref|XP_006437049.1| hypothetical protein CICLE_v10033973mg [Citrus clementina]
 ref|XP_006485020.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Citrus sinensis]
 gb|ESR50289.1| hypothetical protein CICLE_v10033973mg [Citrus clementina]
Length=789

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 100/131 (76%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            QED+ LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRV KARDLP  
Sbjct  10   QEDYKLKDTKPQLGERWPHGGIRGAGGWISSERATSTYDLVEQMFYLYVRVEKARDLPTN  69

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             ++GS DPYVEV+LGNYKG TRHFEKKSNPEW QVFAFSKE+IQ+S+LEV V+D++    
Sbjct  70   PMSGSCDPYVEVKLGNYKGKTRHFEKKSNPEWKQVFAFSKEKIQSSVLEVFVRDREIVGR  129

Query  535  dS-VGRVVFDL  564
            D  +G+VVFD+
Sbjct  130  DDYIGKVVFDM  140



>ref|XP_007051844.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein isoform 1 [Theobroma cacao]
 gb|EOX96001.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein isoform 1 [Theobroma cacao]
Length=1001

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 100/123 (81%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G      D+  STYDLVEQM+YL+VRVVKA+DLP KDV GSLD
Sbjct  230  DYALKETSPFLGGGQIVGGRVIRGDRPASTYDLVEQMRYLFVRVVKAQDLPSKDVAGSLD  289

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEV++GNYKG T+H+EKK NPEWNQVFAF+++ +Q S+LEVI+KDKD  KDD VG V 
Sbjct  290  PYVEVKVGNYKGITKHYEKKQNPEWNQVFAFARDTVQTSVLEVILKDKDLVKDDFVGIVR  349

Query  556  FDL  564
            FDL
Sbjct  350  FDL  352



>gb|KDO83484.1| hypothetical protein CISIN_1g001696mg [Citrus sinensis]
Length=1026

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 100/131 (76%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            QE++ LK+T P LG            G ++G++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  241  QEEYNLKDTNPQLGERWPNGGGYGGRGWMSGERFTSTYDLVEQMSYLYVRVVKAKDLPPS  300

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             +TGS DPYVEV++GNYKG T+HFEK+ NPEWNQVFAFSKERIQ+SMLEV +KDK+    
Sbjct  301  SITGSCDPYVEVKMGNYKGRTKHFEKRMNPEWNQVFAFSKERIQSSMLEVFLKDKEMVGR  360

Query  535  dS-VGRVVFDL  564
            D  +GRV FDL
Sbjct  361  DDYLGRVAFDL  371



>ref|XP_008240964.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Prunus mume]
Length=795

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 101/133 (76%), Gaps = 12/133 (9%)
 Frame = +1

Query  202  PPQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLP  348
            P QED+ LK+TKPHLG           GG I+ ++ TSTYDLVEQM YLYVRVVKA+DLP
Sbjct  7    PNQEDYKLKDTKPHLGERWPHGGIRGGGGWISSERATSTYDLVEQMFYLYVRVVKAKDLP  66

Query  349  PKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfd  528
               VTG  DP+V V+LGNYKG T+HFEKK+NPEWNQVFAFSKE+IQAS+LEV VKDK   
Sbjct  67   TNPVTGICDPFVAVKLGNYKGKTQHFEKKTNPEWNQVFAFSKEKIQASILEVYVKDKAMV  126

Query  529  kddS-VGRVVFDL  564
              D  VG+VVFD+
Sbjct  127  ARDDYVGKVVFDM  139



>gb|KJB41306.1| hypothetical protein B456_007G098200 [Gossypium raimondii]
Length=1005

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 101/123 (82%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            DF LKET P LG G+I G      D+ TSTYDLVEQM+YL+VRVVKARDLP KD+TGSLD
Sbjct  232  DFALKETSPFLGEGRIIGGRVIRGDRPTSTYDLVEQMRYLFVRVVKARDLPSKDLTGSLD  291

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEV++GNYKG T+H+E+  NPEWNQVFAF++E +Q+++LEV++KDKD  KDD VG V 
Sbjct  292  PYVEVKVGNYKGITKHYERNQNPEWNQVFAFARETMQSTVLEVVLKDKDLVKDDFVGIVR  351

Query  556  FDL  564
            FDL
Sbjct  352  FDL  354



>emb|CDP08834.1| unnamed protein product [Coffea canephora]
Length=1004

 Score =   155 bits (392),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 98/123 (80%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            ++ LKET P LGGG+      I  DK  STYDLVE MQ+L+VRVVKARDLP KDVTGSLD
Sbjct  235  EYALKETSPVLGGGQVVQGRVIRADKPASTYDLVEPMQFLFVRVVKARDLPSKDVTGSLD  294

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEVR+GNY+G T HFEK+ NPEWN VFAF+K+RIQ+S +EV+VKDKD  KDD VG + 
Sbjct  295  PYVEVRVGNYRGVTSHFEKRQNPEWNAVFAFAKDRIQSSFVEVVVKDKDMLKDDFVGMIR  354

Query  556  FDL  564
            FDL
Sbjct  355  FDL  357



>ref|XP_007220593.1| hypothetical protein PRUPE_ppa000616mg [Prunus persica]
 gb|EMJ21792.1| hypothetical protein PRUPE_ppa000616mg [Prunus persica]
Length=1070

 Score =   155 bits (392),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 103/131 (79%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            Q+++ LK+T P LG         GG+  ++G++ TSTYDLVEQM YL+VRVVKA+DLPP 
Sbjct  283  QDEYELKDTNPQLGERWPNGGAHGGRGWMSGERFTSTYDLVEQMFYLFVRVVKAKDLPPS  342

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             +TGS DPYVEV+LGNYKG TRHFE+K NPEWNQVFAFSK+RIQ+S++EV VKDK+    
Sbjct  343  SITGSCDPYVEVKLGNYKGRTRHFERKMNPEWNQVFAFSKDRIQSSVVEVFVKDKEMIGR  402

Query  535  dS-VGRVVFDL  564
            D  +GRVVFDL
Sbjct  403  DDYLGRVVFDL  413



>ref|XP_008231338.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X4 [Prunus mume]
Length=1029

 Score =   155 bits (392),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 103/131 (79%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            Q+D+ LK+T P LG         GG+  ++G++ TSTYDLVEQM YL+VRVVKA++LPP 
Sbjct  242  QDDYELKDTNPQLGERWPNGGAHGGRGWMSGERFTSTYDLVEQMFYLFVRVVKAKELPPS  301

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             +TGS DPYVEV+LGNYKG TRHFE+K NPEWNQVFAFSK+RIQ+S++EV VKDK+    
Sbjct  302  SITGSCDPYVEVKLGNYKGRTRHFERKMNPEWNQVFAFSKDRIQSSVVEVFVKDKEMIGR  361

Query  535  dS-VGRVVFDL  564
            D  +GRVVFDL
Sbjct  362  DDYLGRVVFDL  372



>ref|XP_009588959.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=768

 Score =   154 bits (388),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 103/127 (81%), Gaps = 4/127 (3%)
 Frame = +1

Query  193  MQRPP-QEDFMLKETKPHLGGG--KITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVT  363
            MQ+ P QE+F LK+T P + G    I GDK+T  YDLVEQM+YLYVRVVKA++L  KDVT
Sbjct  1    MQKGPIQEEFALKQTAPKIVGSGVMIGGDKVTVAYDLVEQMEYLYVRVVKAKELT-KDVT  59

Query  364  GSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSV  543
            GS DPYVEV++GNYKG T+HFEKK+NPEWN VFAFS++R+QAS +EV +KDKD   DD +
Sbjct  60   GSCDPYVEVKVGNYKGVTKHFEKKTNPEWNYVFAFSQDRLQASFIEVCLKDKDVVLDDLI  119

Query  544  GRVVFDL  564
            GRV+FDL
Sbjct  120  GRVIFDL  126



>gb|KCW51799.1| hypothetical protein EUGRSUZ_J01251, partial [Eucalyptus grandis]
Length=756

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 99/130 (76%), Gaps = 12/130 (9%)
 Frame = +1

Query  211  EDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKD  357
            +D+ +K+  P LG         GG+  ++ ++ TSTYDLVEQM YLYVRVVKARDLPP  
Sbjct  14   DDYKVKDANPELGERWLNSGSYGGRGWMSSERFTSTYDLVEQMFYLYVRVVKARDLPPSS  73

Query  358  VTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkdd  537
            +TGS DPYVEV+LGNY+G TRHFEKK NPEWNQVFAFSK+RIQ+S LEV VKDK+    D
Sbjct  74   ITGSCDPYVEVKLGNYRGRTRHFEKKMNPEWNQVFAFSKDRIQSSTLEVFVKDKEMVGRD  133

Query  538  S-VGRVVFDL  564
              VGRVVFDL
Sbjct  134  DYVGRVVFDL  143



>ref|XP_008231335.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X2 [Prunus mume]
Length=1054

 Score =   155 bits (392),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 103/131 (79%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            Q+D+ LK+T P LG         GG+  ++G++ TSTYDLVEQM YL+VRVVKA++LPP 
Sbjct  267  QDDYELKDTNPQLGERWPNGGAHGGRGWMSGERFTSTYDLVEQMFYLFVRVVKAKELPPS  326

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             +TGS DPYVEV+LGNYKG TRHFE+K NPEWNQVFAFSK+RIQ+S++EV VKDK+    
Sbjct  327  SITGSCDPYVEVKLGNYKGRTRHFERKMNPEWNQVFAFSKDRIQSSVVEVFVKDKEMIGR  386

Query  535  dS-VGRVVFDL  564
            D  +GRVVFDL
Sbjct  387  DDYLGRVVFDL  397



>ref|XP_008231334.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X1 [Prunus mume]
Length=1070

 Score =   155 bits (392),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 103/131 (79%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            Q+D+ LK+T P LG         GG+  ++G++ TSTYDLVEQM YL+VRVVKA++LPP 
Sbjct  283  QDDYELKDTNPQLGERWPNGGAHGGRGWMSGERFTSTYDLVEQMFYLFVRVVKAKELPPS  342

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             +TGS DPYVEV+LGNYKG TRHFE+K NPEWNQVFAFSK+RIQ+S++EV VKDK+    
Sbjct  343  SITGSCDPYVEVKLGNYKGRTRHFERKMNPEWNQVFAFSKDRIQSSVVEVFVKDKEMIGR  402

Query  535  dS-VGRVVFDL  564
            D  +GRVVFDL
Sbjct  403  DDYLGRVVFDL  413



>ref|XP_004235089.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Solanum lycopersicum]
Length=789

 Score =   154 bits (389),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 103/132 (78%), Gaps = 12/132 (9%)
 Frame = +1

Query  205  PQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  351
            PQ+D+  KETKP LG           GG I+ D++TSTYDLVEQM +LYVRVVKARDLPP
Sbjct  9    PQDDYKAKETKPQLGERWPHGGFRGGGGWISSDRVTSTYDLVEQMHFLYVRVVKARDLPP  68

Query  352  KDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdk  531
              VTGS DPYVEV+LGNYKG T+HF+KK NPEW QVFAFSKE+IQ+S+++V V+DK+  +
Sbjct  69   NPVTGSCDPYVEVKLGNYKGKTKHFDKKVNPEWKQVFAFSKEKIQSSVIDVFVRDKEMVQ  128

Query  532  ddS-VGRVVFDL  564
             D  +G+VVFD+
Sbjct  129  RDDYLGKVVFDM  140



>ref|XP_002513191.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF49182.1| synaptotagmin, putative [Ricinus communis]
Length=1049

 Score =   155 bits (391),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 99/131 (76%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG-----GGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            Q+D+ LK+T P LG     GG   G      ++  STYDLVEQM YLYVRVVKA+DLPP 
Sbjct  264  QDDYTLKDTNPQLGERWPAGGAYGGRGWMHSERYASTYDLVEQMSYLYVRVVKAKDLPPS  323

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             +TGS DPYVEV+LGNY+G ++HFEKK NPEWNQVFAFSK+RIQ+SMLEV VKDK+    
Sbjct  324  SITGSCDPYVEVKLGNYRGRSKHFEKKMNPEWNQVFAFSKDRIQSSMLEVFVKDKEMFGR  383

Query  535  dS-VGRVVFDL  564
            D  +GRVVFDL
Sbjct  384  DDYLGRVVFDL  394



>ref|XP_008231337.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X3 [Prunus mume]
Length=1047

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 103/131 (79%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            Q+D+ LK+T P LG         GG+  ++G++ TSTYDLVEQM YL+VRVVKA++LPP 
Sbjct  260  QDDYELKDTNPQLGERWPNGGAHGGRGWMSGERFTSTYDLVEQMFYLFVRVVKAKELPPS  319

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             +TGS DPYVEV+LGNYKG TRHFE+K NPEWNQVFAFSK+RIQ+S++EV VKDK+    
Sbjct  320  SITGSCDPYVEVKLGNYKGRTRHFERKMNPEWNQVFAFSKDRIQSSVVEVFVKDKEMIGR  379

Query  535  dS-VGRVVFDL  564
            D  +GRVVFDL
Sbjct  380  DDYLGRVVFDL  390



>gb|KDP43429.1| hypothetical protein JCGZ_16716 [Jatropha curcas]
Length=1030

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 98/131 (75%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG-----GGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            Q+D+ LK+T P LG     GG   G      ++  STYDLVEQM YLYVRVVKA+DLPP 
Sbjct  245  QDDYSLKDTNPQLGERWPAGGAFGGRGWMNSERYASTYDLVEQMSYLYVRVVKAKDLPPS  304

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             +TGS DPYVEV+LGNYKG TRHFEK+ NPEWNQVF+FSK+RIQ+S LEV VKDK+    
Sbjct  305  SITGSCDPYVEVKLGNYKGRTRHFEKRMNPEWNQVFSFSKDRIQSSTLEVFVKDKEMLGR  364

Query  535  dS-VGRVVFDL  564
            D  +GRVVFDL
Sbjct  365  DDYLGRVVFDL  375



>ref|XP_010032396.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Eucalyptus grandis]
Length=798

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 99/130 (76%), Gaps = 12/130 (9%)
 Frame = +1

Query  211  EDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKD  357
            +D+ +K+  P LG         GG+  ++ ++ TSTYDLVEQM YLYVRVVKARDLPP  
Sbjct  14   DDYKVKDANPELGERWLNSGSYGGRGWMSSERFTSTYDLVEQMFYLYVRVVKARDLPPSS  73

Query  358  VTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkdd  537
            +TGS DPYVEV+LGNY+G TRHFEKK NPEWNQVFAFSK+RIQ+S LEV VKDK+    D
Sbjct  74   ITGSCDPYVEVKLGNYRGRTRHFEKKMNPEWNQVFAFSKDRIQSSTLEVFVKDKEMVGRD  133

Query  538  S-VGRVVFDL  564
              VGRVVFDL
Sbjct  134  DYVGRVVFDL  143



>gb|KDP24593.1| hypothetical protein JCGZ_25509 [Jatropha curcas]
Length=788

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 101/131 (77%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            +EDF LK+TKP LG           GG I+ D+ TSTYDLVEQM YLYVRV KARDLP  
Sbjct  7    KEDFKLKDTKPQLGERWPHGGLRSGGGWISSDRATSTYDLVEQMFYLYVRVEKARDLPTN  66

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             VTG+LDPYVEV++GNY+G T+HFEKK+NPEW QVFAFSK++IQ+S+LEV V+D++    
Sbjct  67   PVTGNLDPYVEVKVGNYRGRTKHFEKKTNPEWKQVFAFSKDKIQSSVLEVFVRDREMVGR  126

Query  535  dS-VGRVVFDL  564
            D  VG+VVFD+
Sbjct  127  DDYVGKVVFDM  137



>ref|XP_010241420.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Nelumbo nucifera]
Length=1056

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 100/131 (76%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            +ED+ LK+T P LG           GG ++GDK TSTYDLVEQM YLYVRVVKA++LP  
Sbjct  271  EEDYKLKDTSPQLGERWPSGGIRGGGGWMSGDKFTSTYDLVEQMYYLYVRVVKAKELPTN  330

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             + G+ DPY EV+LGNYKGTTRHFEKK+NPEWNQVFAFSKERIQ+S LEV VKDK+    
Sbjct  331  SIAGNCDPYAEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKERIQSSALEVFVKDKEMVAR  390

Query  535  dS-VGRVVFDL  564
            D  +G+VVFDL
Sbjct  391  DDYLGKVVFDL  401



>ref|XP_008795741.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Phoenix dactylifera]
Length=998

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 110/152 (72%), Gaps = 16/152 (11%)
 Frame = +1

Query  157  VFVVLWKKNNHKMQRPPQ-EDFMLKETKPHLG----------GG----KITGDKLTSTYD  291
            V ++ + +  H   +P + E++ LK+T P LG          GG     + GDK TSTYD
Sbjct  220  VPIMTYHQVQHGQAQPSRGEEYKLKDTTPQLGERWPAGAHGRGGAWMTSLYGDKFTSTYD  279

Query  292  LVEQMQYLYVRVVKARDLPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFS  471
            LVEQM YLYVRVVKA+DLPP  +TGS DPY EV+LGNY+GTT+H+EK+++PEWNQVFAFS
Sbjct  280  LVEQMYYLYVRVVKAKDLPPNALTGSCDPYAEVKLGNYRGTTKHYEKRTHPEWNQVFAFS  339

Query  472  KERIQASMLEVIVkdkdfdkddS-VGRVVFDL  564
            KERIQ+++LEV VKD++    D  VG+VVFDL
Sbjct  340  KERIQSTVLEVFVKDREMVARDDYVGKVVFDL  371


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 29/52 (56%), Gaps = 0/52 (0%)
 Frame = +1

Query  313  LYVRVVKARDLPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAF  468
            L V VV ARDL PKD  GS   +VEV  GN    TR   K  NP WNQ  +F
Sbjct  3    LVVEVVDARDLMPKDGEGSASAFVEVDFGNQLIRTRTIPKDLNPVWNQKLSF  54



>gb|AFN53655.1| putative synaptotagmin protein [Linum usitatissimum]
Length=793

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 102/131 (78%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            +EDF LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRVVKARDLPP 
Sbjct  10   KEDFKLKDTKPQLGERWPHGGSRGGGGWISSERATSTYDLVEQMFYLYVRVVKARDLPPN  69

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             V+GS DPYVEV+LGNYKG T+HFEKK+NPEWNQVFAFSKE++Q+S+LEV V+D++    
Sbjct  70   PVSGSCDPYVEVKLGNYKGKTQHFEKKTNPEWNQVFAFSKEKLQSSVLEVYVRDREMVGR  129

Query  535  dS-VGRVVFDL  564
            D   G+V+FD+
Sbjct  130  DDYAGKVIFDM  140



>ref|XP_002265157.2| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Vitis vinifera]
Length=1046

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 102/141 (72%), Gaps = 12/141 (9%)
 Frame = +1

Query  178  KNNHKMQRPPQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVR  324
            + N  +   PQ+D+ LKE  P LG            G ++G++  +TYDLVEQM YLYVR
Sbjct  251  QANPDIHPSPQDDYNLKEMDPQLGERWPGGGVYGGRGWMSGERFATTYDLVEQMYYLYVR  310

Query  325  VVKARDLPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV  504
            VVKA+DLPP  +TGS DPYVEV+LGNYKG TRHFEKK NPEWNQVFAFSK+RIQ+S LEV
Sbjct  311  VVKAKDLPPGALTGSCDPYVEVKLGNYKGRTRHFEKKMNPEWNQVFAFSKDRIQSSSLEV  370

Query  505  IVkdkdfdkddS-VGRVVFDL  564
             VKDK+    D  +GRVVFD+
Sbjct  371  FVKDKEMVGRDDYLGRVVFDM  391



>ref|XP_002320122.2| hypothetical protein POPTR_0014s07750g [Populus trichocarpa]
 gb|EEE98437.2| hypothetical protein POPTR_0014s07750g [Populus trichocarpa]
Length=1008

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 99/122 (81%), Gaps = 6/122 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G      D+ +S+YDLVEQM+YLYVRVVKA DLP  DVTGSLD
Sbjct  236  DYALKETSPFLGGGQIVGGRVIRGDRPSSSYDLVEQMKYLYVRVVKAHDLPTMDVTGSLD  295

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEV++GNYKG T+HFEK  NPEWN+VFAF+ +R+Q+S+LEV+VKDKD  KDD VG V 
Sbjct  296  PYVEVKVGNYKGITKHFEKNKNPEWNEVFAFAGDRLQSSVLEVMVKDKDLVKDDFVGIVR  355

Query  556  FD  561
            FD
Sbjct  356  FD  357



>ref|XP_004309445.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Fragaria vesca subsp. vesca]
Length=796

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 102/132 (77%), Gaps = 12/132 (9%)
 Frame = +1

Query  205  PQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  351
            PQED+ LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRVVKA+DLP 
Sbjct  9    PQEDYKLKDTKPQLGERWPHGGVRGGGGWISNERATSTYDLVEQMFYLYVRVVKAKDLPT  68

Query  352  KDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdk  531
              VTGS DPYVEV+LGNYKG T+HFEKK+NPEW QVFAFSK++IQ+S+LEV V++KD   
Sbjct  69   NPVTGSCDPYVEVKLGNYKGKTQHFEKKTNPEWKQVFAFSKDKIQSSILEVYVREKDMVA  128

Query  532  ddS-VGRVVFDL  564
             D  VG+VVFD+
Sbjct  129  RDDYVGKVVFDM  140



>ref|XP_006598248.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Glycine max]
Length=810

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 98/127 (77%), Gaps = 9/127 (7%)
 Frame = +1

Query  211  EDFMLKETKPHLGG--------GKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  366
            ED+ L+ET P LGG        G I G++ +STYDLVEQM YLYVRVVKA+DL P  +T 
Sbjct  29   EDYNLRETDPQLGGDRWPNARRGWIGGERFSSTYDLVEQMFYLYVRVVKAKDLSPSTLTS  88

Query  367  SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddS-V  543
            S DPYVEV+LGNYKG T+H EKK+NPEWNQV+AFSK+RIQ+S+LEVIVKDK+    D  +
Sbjct  89   SCDPYVEVKLGNYKGRTKHIEKKTNPEWNQVYAFSKDRIQSSVLEVIVKDKEMLGRDDYI  148

Query  544  GRVVFDL  564
            GRV FDL
Sbjct  149  GRVAFDL  155



>gb|KJB25055.1| hypothetical protein B456_004G174500 [Gossypium raimondii]
Length=805

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 99/132 (75%), Gaps = 13/132 (10%)
 Frame = +1

Query  208  QEDFMLKETKPHLG-----GGKITG-------DKLTSTYDLVEQMQYLYVRVVKARDLPP  351
            QED+ LK+T P LG     GG   G       D+ TSTYDLVEQM YLYVRVVKA++LPP
Sbjct  20   QEDYNLKDTSPQLGERWPNGGTFGGRGWMNGGDRFTSTYDLVEQMFYLYVRVVKAKELPP  79

Query  352  KDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdk  531
              +TGS DPYVEV+LGNYKG T+HF++KSNPEWNQVFAFSK+R+Q+S+LEV VKDK+   
Sbjct  80   SSLTGSCDPYVEVKLGNYKGRTKHFDRKSNPEWNQVFAFSKDRVQSSLLEVFVKDKEMAG  139

Query  532  ddS-VGRVVFDL  564
             D  V RV FDL
Sbjct  140  RDDYVRRVAFDL  151



>gb|KHN49030.1| Putative Ras GTPase-activating protein 4B [Glycine soja]
Length=796

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 98/127 (77%), Gaps = 9/127 (7%)
 Frame = +1

Query  211  EDFMLKETKPHLGG--------GKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  366
            ED+ L+ET P LGG        G I G++ +STYDLVEQM YLYVRVVKA+DL P  +T 
Sbjct  15   EDYNLRETDPQLGGDRWPNARRGWIGGERFSSTYDLVEQMFYLYVRVVKAKDLSPSTLTS  74

Query  367  SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddS-V  543
            S DPYVEV+LGNYKG T+H EKK+NPEWNQV+AFSK+RIQ+S+LEVIVKDK+    D  +
Sbjct  75   SCDPYVEVKLGNYKGRTKHIEKKTNPEWNQVYAFSKDRIQSSVLEVIVKDKEMLGRDDYI  134

Query  544  GRVVFDL  564
            GRV FDL
Sbjct  135  GRVAFDL  141



>ref|XP_009763246.1| PREDICTED: uncharacterized protein LOC104215187 [Nicotiana sylvestris]
 ref|XP_009763247.1| PREDICTED: uncharacterized protein LOC104215187 [Nicotiana sylvestris]
Length=785

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 102/131 (78%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            ++D+  KETKP LG           GG I+ D++TSTYDLVEQM +LYVRVVKARDLPP 
Sbjct  4    EDDYKAKETKPQLGERWPHGGFRGGGGWISSDRVTSTYDLVEQMHFLYVRVVKARDLPPN  63

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             VTGS DPYVEV+LGNYKG T+HF+KK NPEW QVFAFSKE+IQ+S+LEV V+DK+  + 
Sbjct  64   PVTGSCDPYVEVKLGNYKGKTKHFDKKVNPEWKQVFAFSKEKIQSSILEVFVRDKEMVQR  123

Query  535  dS-VGRVVFDL  564
            D  +G+VVFD+
Sbjct  124  DDYLGKVVFDM  134



>ref|XP_004299880.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Fragaria vesca subsp. vesca]
Length=1036

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 100/134 (75%), Gaps = 8/134 (6%)
 Frame = +1

Query  187  HKMQRPPQED--FMLKETKPHLGG------GKITGDKLTSTYDLVEQMQYLYVRVVKARD  342
            H  Q PP+++  F L ET P L        G  TGDK +STYDLVEQM YLYV VVKARD
Sbjct  254  HMQQGPPRQNPEFALVETSPPLAARLRYRPGGFTGDKTSSTYDLVEQMHYLYVSVVKARD  313

Query  343  LPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkd  522
            LP  DV+GSLDPYVEV+LGNY+G T+H EK  NP W Q+FAFSKER+Q+++LEV VKDKD
Sbjct  314  LPTMDVSGSLDPYVEVKLGNYRGVTKHLEKNQNPVWKQIFAFSKERLQSNLLEVSVKDKD  373

Query  523  fdkddSVGRVVFDL  564
            F KDD VGRV FDL
Sbjct  374  FGKDDHVGRVFFDL  387



>ref|XP_009611365.1| PREDICTED: uncharacterized protein LOC104104885 [Nicotiana tomentosiformis]
Length=785

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 102/131 (78%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            ++D+  KETKP LG           GG I+ D++TSTYDLVEQM +LYVRVVKARDLPP 
Sbjct  4    EDDYKAKETKPQLGERWPHGGFRGGGGWISSDRVTSTYDLVEQMHFLYVRVVKARDLPPN  63

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             VTGS DPYVEV+LGNYKG T+HF+KK NPEW QVFAFSKE+IQ+S+LEV V+DK+  + 
Sbjct  64   PVTGSCDPYVEVKLGNYKGKTKHFDKKVNPEWKQVFAFSKEKIQSSILEVFVRDKEMVQR  123

Query  535  dS-VGRVVFDL  564
            D  +G+VVFD+
Sbjct  124  DDYLGKVVFDM  134



>ref|XP_009391825.1| PREDICTED: uncharacterized protein LOC103977897 [Musa acuminata 
subsp. malaccensis]
Length=1041

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 99/131 (76%), Gaps = 13/131 (10%)
 Frame = +1

Query  211  EDFMLKETKPHLG------------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            E++ LK+T P LG            G    GDKLTSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  255  EEYKLKDTSPQLGERWPHARRVGWMGMVGGGDKLTSTYDLVEQMSYLYVRVVKAKDLPPN  314

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             +TGS DPYVEV+LGNYKG T+HF+KKS+PEWNQ FAFSKERIQ+++LEV VKDK+    
Sbjct  315  AITGSCDPYVEVKLGNYKGITKHFDKKSSPEWNQAFAFSKERIQSTVLEVYVKDKEVAAR  374

Query  535  dS-VGRVVFDL  564
            D  +GRVVFDL
Sbjct  375  DDYIGRVVFDL  385



>gb|EMS48196.1| Multiple C2 and transmembrane domain-containing protein 1 [Triticum 
urartu]
Length=750

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 95/125 (76%), Gaps = 7/125 (6%)
 Frame = +1

Query  199  RPPQ---EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            +PPQ   ED++LKET P LGG    GDK TSTYDLVEQM YLYVR VKA+DL  KD +GS
Sbjct  2    QPPQPRPEDYLLKETTPCLGGFMAAGDKRTSTYDLVEQMPYLYVRAVKAKDLRAKDGSGS  61

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DP VE++LGNY+ TTR FEK +NPEWNQVFAF KE IQ+S +E+ VKDKD      +GR
Sbjct  62   CDPSVEIKLGNYRCTTRQFEKNTNPEWNQVFAFPKECIQSSYIEITVKDKDDI----IGR  117

Query  550  VVFDL  564
            V+FDL
Sbjct  118  VIFDL  122



>ref|XP_010918556.1| PREDICTED: uncharacterized protein LOC105042892 [Elaeis guineensis]
Length=1004

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 102/123 (83%), Gaps = 7/123 (6%)
 Frame = +1

Query  214  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            DF LKET P LGGG+      I G+K    YDLVE+MQYL+VRVVKAR+LP KD+TGSLD
Sbjct  230  DFQLKETSPFLGGGRVVGGRVIPGEK-AGAYDLVEKMQYLFVRVVKARELPAKDLTGSLD  288

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEVRLGN+KGTTRHFEKK+NPEWN+VFAFS+ER+QAS LEV+VKDKD  KDD VG V 
Sbjct  289  PYVEVRLGNFKGTTRHFEKKANPEWNEVFAFSRERLQASFLEVVVKDKDLVKDDFVGIVR  348

Query  556  FDL  564
            FDL
Sbjct  349  FDL  351



>gb|EMT11702.1| hypothetical protein F775_07618 [Aegilops tauschii]
Length=773

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 94/125 (75%), Gaps = 7/125 (6%)
 Frame = +1

Query  199  RPPQ---EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  369
            +PPQ   ED+ LKE  P LGG    GDK TSTYDLVEQM YLYVR VKA+DL  KD +GS
Sbjct  2    QPPQPRPEDYTLKEITPRLGGFMAAGDKRTSTYDLVEQMPYLYVRAVKAKDLHAKDGSGS  61

Query  370  LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGR  549
             DP VE++LGNY+ TTR FEK +NPEWNQVFAF KERIQ+S +E+ VKDKD      +GR
Sbjct  62   CDPSVEIKLGNYRCTTRQFEKNTNPEWNQVFAFPKERIQSSYIEITVKDKDDI----IGR  117

Query  550  VVFDL  564
            V+FDL
Sbjct  118  VIFDL  122



>emb|CBI24845.3| unnamed protein product [Vitis vinifera]
Length=621

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 102/120 (85%), Gaps = 1/120 (1%)
 Frame = +1

Query  208  QEDFMLKETKPHLGGGKIT-GDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPYV  384
            ++D+ LKET P+LGGG+++ GDKLT+ +DLVEQM YLYVRVVKA++LP KD + S DPYV
Sbjct  120  EDDYCLKETSPNLGGGRLSRGDKLTTAFDLVEQMHYLYVRVVKAKELPGKDGSESCDPYV  179

Query  385  EVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVVFDL  564
            EV++GN+KG T+H EKKSNP W+QVFAFSK+R+Q+S +EV VKDK+  KDD +G V+FDL
Sbjct  180  EVKVGNFKGFTKHIEKKSNPVWSQVFAFSKDRLQSSFIEVSVKDKNGGKDDFMGVVLFDL  239



>ref|XP_009419170.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009419171.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009419173.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
Length=797

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 99/131 (76%), Gaps = 13/131 (10%)
 Frame = +1

Query  211  EDFMLKETKPHLG--------GGKIT----GDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            E++ LK+T P LG        GG +     GDKLTSTYDLVEQM YLYVRVVKA++LP  
Sbjct  12   EEYKLKDTSPQLGERWPHARGGGWMGLVYGGDKLTSTYDLVEQMHYLYVRVVKAKNLPTN  71

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             V+GS DPYVEV+LGNY GTT+HF+K+ NPEWNQVFAFSKERIQ+++LEV VKD++    
Sbjct  72   AVSGSCDPYVEVKLGNYHGTTKHFDKRVNPEWNQVFAFSKERIQSTILEVYVKDREMVAR  131

Query  535  dS-VGRVVFDL  564
            D  VGRV FDL
Sbjct  132  DDYVGRVAFDL  142



>ref|XP_010111400.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
 gb|EXC30878.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
Length=787

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 104/135 (77%), Gaps = 12/135 (9%)
 Frame = +1

Query  196  QRPPQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARD  342
            Q  P+ED+ LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRVVKA++
Sbjct  4    QAAPKEDYKLKDTKPQLGERWPHGGLRGGGGWISSERATSTYDLVEQMFYLYVRVVKAKN  63

Query  343  LPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkd  522
            LP   VTG+ DPYVEV+LGNYKG T+HFEKK+NPEWNQVFAFSKE+IQ+S++EV V+D++
Sbjct  64   LPTNPVTGNCDPYVEVKLGNYKGKTKHFEKKTNPEWNQVFAFSKEKIQSSVVEVYVRDRE  123

Query  523  fdkddS-VGRVVFDL  564
                D  +G+VVFD+
Sbjct  124  MVSRDDYIGKVVFDM  138



>ref|XP_002299538.2| hypothetical protein POPTR_0001s09250g [Populus trichocarpa]
 gb|EEE84343.2| hypothetical protein POPTR_0001s09250g [Populus trichocarpa]
Length=1008

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 101/123 (82%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+      I GDK  STYDLVE+M +LYVRVVKARDLP  DVTGSLD
Sbjct  236  DYALKETSPFLGGGRVVGGRVIHGDKTASTYDLVERMYFLYVRVVKARDLPAMDVTGSLD  295

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            P+VEVR+GNY+G T+HFEKK NPEWNQVFAFS+ER+QAS+LEV++KDKD  KDD VG + 
Sbjct  296  PFVEVRIGNYRGITKHFEKKQNPEWNQVFAFSRERMQASVLEVVIKDKDLVKDDFVGVIR  355

Query  556  FDL  564
            FD+
Sbjct  356  FDI  358



>ref|XP_011007360.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2-like [Populus euphratica]
Length=1052

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 99/130 (76%), Gaps = 12/130 (9%)
 Frame = +1

Query  211  EDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKD  357
            +DF LK+T P LG         GG+  + G++  ST+DLVEQM YLYVRVVKA+DLPP  
Sbjct  268  DDFDLKDTNPKLGERWPSGGAYGGRGWMNGERYASTFDLVEQMSYLYVRVVKAKDLPPSP  327

Query  358  VTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkdd  537
            +TGS DPYVEV+LGNYKG TRHFEKK NPEWNQVFAFSKER+Q+ +LEV VKDK+    D
Sbjct  328  ITGSCDPYVEVKLGNYKGRTRHFEKKMNPEWNQVFAFSKERMQSLVLEVFVKDKEMVGRD  387

Query  538  S-VGRVVFDL  564
              +GRVVFDL
Sbjct  388  DYLGRVVFDL  397



>ref|XP_009354691.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Pyrus x bretschneideri]
Length=1051

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 98/132 (74%), Gaps = 13/132 (10%)
 Frame = +1

Query  208  QEDFMLKETKPHLG------------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  351
            Q D+ LK+T P LG            G    G++ TSTYDLVEQM YLYVRVVKA+DLPP
Sbjct  263  QGDYELKDTSPQLGERWPNGGAYGGRGWMSGGERFTSTYDLVEQMFYLYVRVVKAKDLPP  322

Query  352  KDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdk  531
              +TGS DPYVEV+LGNYKG T+HFE+K NPEWNQVFAFSK+RIQ+S++EV VKDK+   
Sbjct  323  SSITGSCDPYVEVKLGNYKGRTKHFERKMNPEWNQVFAFSKDRIQSSVVEVFVKDKEMIG  382

Query  532  ddS-VGRVVFDL  564
             D  +GRVVFDL
Sbjct  383  RDDYLGRVVFDL  394



>ref|XP_011029251.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 isoform X1 [Populus euphratica]
 ref|XP_011029252.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 isoform X2 [Populus euphratica]
Length=1007

 Score =   152 bits (384),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 101/123 (82%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+      I GDK  STYDLVE+M +LYVRVVKARDLP  DVTGSLD
Sbjct  235  DYALKETSPFLGGGRVVGGRVIHGDKTASTYDLVERMYFLYVRVVKARDLPAMDVTGSLD  294

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            P+VEVR+GNY+G T+HFEKK NPEWNQVFAFS+ER+QAS+LEV++KDKD  KDD VG + 
Sbjct  295  PFVEVRIGNYRGITKHFEKKQNPEWNQVFAFSRERMQASVLEVVIKDKDLLKDDFVGVIR  354

Query  556  FDL  564
            FD+
Sbjct  355  FDV  357



>ref|XP_010534658.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
Length=749

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 100/131 (76%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            QED+ LK+ KP LG            G I+ ++  STYDLVEQM YLYVRVVKA+DLPP 
Sbjct  10   QEDYKLKDMKPELGERWPHGGLRGGSGWISSERAASTYDLVEQMFYLYVRVVKAKDLPPN  69

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             VTG+ DPYV+V+LGNYKG T+HFEK++NPEWNQVFAFSK++IQ+S++EV V+DK+    
Sbjct  70   PVTGNCDPYVDVKLGNYKGKTKHFEKRTNPEWNQVFAFSKDKIQSSVVEVFVRDKEMVTR  129

Query  535  dS-VGRVVFDL  564
            D  +G+VVFD+
Sbjct  130  DDYIGKVVFDM  140



>ref|XP_011078852.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Sesamum indicum]
Length=789

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 102/132 (77%), Gaps = 12/132 (9%)
 Frame = +1

Query  205  PQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  351
            PQ+D+ +K+TKP LG           GG I+ D++TSTYDLVEQM YLYVRVVKARDLP 
Sbjct  6    PQDDYKIKDTKPQLGERWPHGGVRGGGGWISSDRVTSTYDLVEQMYYLYVRVVKARDLPT  65

Query  352  KDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdk  531
              VTGS DPYVEV+LGNYKG T+HFEKK NPEWNQVFAF+K++IQ++ LEV V+D++   
Sbjct  66   NPVTGSCDPYVEVKLGNYKGKTQHFEKKMNPEWNQVFAFAKDKIQSTDLEVFVRDREMVG  125

Query  532  ddS-VGRVVFDL  564
             D  +G+VVFD+
Sbjct  126  RDDYLGKVVFDM  137



>ref|XP_004228622.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum lycopersicum]
 ref|XP_010315889.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum lycopersicum]
Length=768

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 97/121 (80%), Gaps = 3/121 (2%)
 Frame = +1

Query  208  QEDFMLKETKPHLGGG--KITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPY  381
             E+F LK+T P + G    I GDK+T  YDLVEQM+YLYVRVVKA++L  KDVTGS DPY
Sbjct  7    HEEFALKQTAPKIVGSGVMIGGDKVTVAYDLVEQMEYLYVRVVKAKELT-KDVTGSCDPY  65

Query  382  VEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVVFD  561
            VEV++GNYKG T+HFEKK NPEWN VFAFS++RIQAS +EV VKDKD   DD +GRVVFD
Sbjct  66   VEVKVGNYKGVTKHFEKKINPEWNYVFAFSQDRIQASYIEVCVKDKDVLLDDMIGRVVFD  125

Query  562  L  564
            L
Sbjct  126  L  126



>emb|CDY70344.1| BnaA03g55080D, partial [Brassica napus]
Length=504

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 99/131 (76%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            QED+ LK+ KP LG            G I+ +++ STYDLVEQM YLYVRVVKA+DLPP 
Sbjct  9    QEDYKLKDMKPDLGEKWPHGGQRGGSGWISSERVASTYDLVEQMFYLYVRVVKAKDLPPN  68

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             VT + DPYVEV++GNYKG T+HFEK++NPEWNQVFAFSK++IQ+S +EV V+DK+    
Sbjct  69   PVTSNCDPYVEVKIGNYKGKTKHFEKRTNPEWNQVFAFSKDKIQSSTVEVFVRDKEMVTR  128

Query  535  dS-VGRVVFDL  564
            D  +G+VVFD+
Sbjct  129  DDYIGKVVFDM  139



>ref|XP_009773349.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
Length=768

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 102/127 (80%), Gaps = 4/127 (3%)
 Frame = +1

Query  193  MQRPP-QEDFMLKETKPHLGGG--KITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVT  363
            MQ+ P  E+F LK+T P + G    I GDK+T  YDLVEQM+YLYVRVVKA++L  KDVT
Sbjct  1    MQKGPIPEEFALKQTAPKIVGSGVMIGGDKVTVAYDLVEQMEYLYVRVVKAKELT-KDVT  59

Query  364  GSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSV  543
            GS DPYVEV++GNYKG T+HFEKK+NPEWN VFAFS++R+QAS +EV +KDKD   DD +
Sbjct  60   GSCDPYVEVKVGNYKGVTKHFEKKANPEWNYVFAFSQDRLQASYIEVCLKDKDVLLDDLI  119

Query  544  GRVVFDL  564
            GRV+FDL
Sbjct  120  GRVIFDL  126



>emb|CDP07723.1| unnamed protein product [Coffea canephora]
Length=1054

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 104/141 (74%), Gaps = 12/141 (9%)
 Frame = +1

Query  178  KNNHKMQRPPQEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVR  324
            + N +    P +D+ +K+T P LG         GG+  I+ ++ TSTYDLVEQM YLYVR
Sbjct  261  QANPQAHPSPDDDYEVKDTSPQLGDQWPSGGAYGGRGWISSERYTSTYDLVEQMFYLYVR  320

Query  325  VVKARDLPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV  504
            VVKA+DLPP  +T + DPYVEV+LGNYKG T+HFEKK NPEWNQVFAFSK+RIQ+S+LEV
Sbjct  321  VVKAKDLPPNSITATCDPYVEVKLGNYKGRTKHFEKKLNPEWNQVFAFSKDRIQSSVLEV  380

Query  505  IVkdkdfdkddS-VGRVVFDL  564
             VKDK+    D  +G+V+FDL
Sbjct  381  FVKDKEMVGRDEYLGKVIFDL  401


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 33/65 (51%), Gaps = 0/65 (0%)
 Frame = +1

Query  313  LYVRVVKARDLPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQAS  492
            L V VV A DL PKD  GS  PYVEV  GN    T    K  NP WNQ   F+ E  +  
Sbjct  3    LVVEVVDAHDLMPKDGKGSASPYVEVDFGNQLSRTTTVPKNLNPIWNQKLLFNLEEARNY  62

Query  493  MLEVI  507
            + + I
Sbjct  63   LHQTI  67



>ref|XP_008392066.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2-like [Malus domestica]
Length=795

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 102/133 (77%), Gaps = 12/133 (9%)
 Frame = +1

Query  202  PPQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLP  348
            P QED+ LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRV KA+DLP
Sbjct  7    PNQEDYKLKDTKPRLGERWPHGGVRGGGGWISSERATSTYDLVEQMFYLYVRVEKAKDLP  66

Query  349  PKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVk-dkdf  525
               VTGS DPY+EV+LGNYKG T+HFEKK+NPEW QVFAFSKE+IQ+S+LEV V+  +  
Sbjct  67   TNPVTGSCDPYIEVKLGNYKGKTKHFEKKTNPEWKQVFAFSKEKIQSSILEVYVRDREMV  126

Query  526  dkddSVGRVVFDL  564
             +DD+VG+VVFD+
Sbjct  127  ARDDNVGKVVFDM  139



>ref|XP_008350856.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2 [Malus domestica]
Length=1029

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 98/132 (74%), Gaps = 13/132 (10%)
 Frame = +1

Query  208  QEDFMLKETKPHLG------------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  351
            Q+D+ LK+T P LG            G    G++ TSTYDLVEQM YLYVRVVKA+DLPP
Sbjct  241  QDDYDLKDTSPQLGERWPNGGEYGGRGWMSGGERFTSTYDLVEQMFYLYVRVVKAKDLPP  300

Query  352  KDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdk  531
              +TGS DPYVEV+LGNYKG T+HFE+K NPEWNQVFAFSK+RIQ+S++EV VKDK+   
Sbjct  301  SSITGSCDPYVEVKLGNYKGRTKHFERKMNPEWNQVFAFSKDRIQSSVVEVFVKDKEMIG  360

Query  532  ddS-VGRVVFDL  564
             D  +GRVV DL
Sbjct  361  RDDYIGRVVLDL  372



>ref|XP_004497937.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cicer arietinum]
Length=798

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 103/137 (75%), Gaps = 12/137 (9%)
 Frame = +1

Query  190  KMQRPPQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKA  336
            K  +P Q+D+ LK+TKP LG            G I  ++ TSTYDLVEQM YLYVRVVKA
Sbjct  6    KDSKPNQDDYKLKDTKPELGEKWPHGGQRGGTGWIYTERATSTYDLVEQMFYLYVRVVKA  65

Query  337  RDLPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkd  516
            ++LPP  VTG++DPYVEV++GNYKG TRHFEKK+NPEW QVFAFSKE+IQ+S++EV V+D
Sbjct  66   KELPPNPVTGNVDPYVEVKVGNYKGKTRHFEKKTNPEWKQVFAFSKEKIQSSIVEVFVRD  125

Query  517  kdfdkddS-VGRVVFDL  564
            K+    D  +G+V FD+
Sbjct  126  KEMVARDDYIGKVEFDM  142



>emb|CDY01973.1| BnaC02g27540D [Brassica napus]
Length=991

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 101/128 (79%), Gaps = 8/128 (6%)
 Frame = +1

Query  205  PQEDFMLKETKPHLGGGKITGDKL--------TSTYDLVEQMQYLYVRVVKARDLPPKDV  360
            P  DF +KET P LGGG+I G ++        + TYDLVE+M++L+VRVVKARDLP +D+
Sbjct  213  PPSDFSVKETSPFLGGGQIIGGRVVRGTKRPASGTYDLVEEMRFLFVRVVKARDLPDRDL  272

Query  361  TGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddS  540
            TGSLDPYVEV++GN+KG TRH +K S+PEWNQVFAF+KE +Q+++LE++VKDKD   DD 
Sbjct  273  TGSLDPYVEVKIGNFKGVTRHLDKNSDPEWNQVFAFAKENLQSNVLEIVVKDKDLVLDDY  332

Query  541  VGRVVFDL  564
            VG V FDL
Sbjct  333  VGTVRFDL  340



>ref|XP_008461778.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2 [Cucumis melo]
Length=1053

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 100/131 (76%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            Q+D+ +++T P LG         GG+  ++G++ TSTYDLVEQM YLYVRV+KARDLP  
Sbjct  268  QDDYEIRDTNPQLGEQWPNGGGYGGRSWLSGERHTSTYDLVEQMFYLYVRVMKARDLPSS  327

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             +TG  DPYVEV+LGNYKG T+HF+KK NPEWNQVFAFSKERIQ+S LEV VKDK+    
Sbjct  328  SITGGCDPYVEVKLGNYKGRTKHFDKKQNPEWNQVFAFSKERIQSSALEVFVKDKEMLGR  387

Query  535  dS-VGRVVFDL  564
            D  +GRVVFDL
Sbjct  388  DDYLGRVVFDL  398


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 0/68 (0%)
 Frame = +1

Query  304  MQYLYVRVVKARDLPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERI  483
            M+ L V V+ A DL PKD  GS  P+VEV   N+   T+   K  +P WNQ  +F+ ++ 
Sbjct  1    MEQLVVEVIDAHDLMPKDGEGSASPFVEVDFQNHISRTKTVPKSXDPIWNQKLSFNFDKT  60

Query  484  QASMLEVI  507
            Q    + I
Sbjct  61   QNHQYQNI  68



>ref|XP_006379108.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|ERP56905.1| C2 domain-containing family protein [Populus trichocarpa]
Length=1029

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 98/130 (75%), Gaps = 12/130 (9%)
 Frame = +1

Query  211  EDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKD  357
            +DF LK+T P LG         GG+  + G++  ST+DLVEQM YLYVRVVKA+DLPP  
Sbjct  245  DDFDLKDTNPKLGERWPSGGAYGGRGWMNGERYASTFDLVEQMSYLYVRVVKAKDLPPSS  304

Query  358  VTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkdd  537
            +T S DPYVEV+LGNYKG TRHFEKK NPEWNQVFAFSKER+Q+ +LEV VKDK+    D
Sbjct  305  ITASCDPYVEVKLGNYKGRTRHFEKKMNPEWNQVFAFSKERMQSLVLEVFVKDKEMVGRD  364

Query  538  S-VGRVVFDL  564
              +GRVVFDL
Sbjct  365  DYLGRVVFDL  374



>gb|EYU20710.1| hypothetical protein MIMGU_mgv1a023485mg [Erythranthe guttata]
Length=785

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 101/132 (77%), Gaps = 12/132 (9%)
 Frame = +1

Query  205  PQEDFMLKETKPHLG-----GGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPP  351
            PQ+D+ +KETKP LG     GG   G      +++TSTYDLVEQM YLYVRVVKA+DLP 
Sbjct  3    PQDDYKIKETKPQLGERWPHGGARGGLWWTGSERITSTYDLVEQMYYLYVRVVKAKDLPT  62

Query  352  KDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdk  531
              V+GS DPYVEV+LGNYKG T+ FEKK+NPEW QVFAFSKE+IQ+S+LEV V+D++   
Sbjct  63   NPVSGSCDPYVEVKLGNYKGKTQRFEKKTNPEWKQVFAFSKEKIQSSVLEVFVRDREMVG  122

Query  532  ddS-VGRVVFDL  564
             D  +GRVVFD+
Sbjct  123  RDDYLGRVVFDM  134



>ref|XP_008383982.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Malus domestica]
Length=1011

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 101/123 (82%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            DF LKET P+LGGG+      I GDK  STYDLVE+M +LYVRVVKAR+LP  DVTGSLD
Sbjct  238  DFALKETSPYLGGGRVVGGRVIHGDKTASTYDLVERMYFLYVRVVKARELPAMDVTGSLD  297

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEVR+GNY+G T+HFEK+ NP WNQVFAFSK+R+QAS+LEV++KDKD  KDD VG V 
Sbjct  298  PYVEVRIGNYRGITKHFEKQQNPTWNQVFAFSKDRMQASVLEVVIKDKDLIKDDFVGLVR  357

Query  556  FDL  564
            FD+
Sbjct  358  FDI  360



>ref|XP_009339918.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Pyrus x bretschneideri]
Length=1011

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 101/123 (82%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            DF LKET P+LGGG+      I GDK  STYDLVE+M +LYVRVVKAR+LP  DVTGSLD
Sbjct  238  DFALKETSPYLGGGRVVGGRVIHGDKTASTYDLVERMYFLYVRVVKARELPAMDVTGSLD  297

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEVR+GNY+G T+HFEK+ NP WNQVFAFSK+R+QAS+LEV++KDKD  KDD VG V 
Sbjct  298  PYVEVRIGNYRGITKHFEKQQNPTWNQVFAFSKDRMQASVLEVVIKDKDLIKDDFVGLVR  357

Query  556  FDL  564
            FD+
Sbjct  358  FDI  360



>ref|XP_004138509.1| PREDICTED: uncharacterized protein LOC101203632 [Cucumis sativus]
 gb|KGN45648.1| hypothetical protein Csa_6G003400 [Cucumis sativus]
Length=1018

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 101/124 (81%), Gaps = 6/124 (5%)
 Frame = +1

Query  211  EDFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
             D+ ++ET P+LGGG + G +L      T+TYDLVE+M YL+VRVVKARDLP KD+TG L
Sbjct  238  NDYSIRETSPYLGGGMVVGGRLALRDRPTNTYDLVEKMHYLFVRVVKARDLPTKDLTGGL  297

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGN+KGTT+H+EK S+PEWN+VFAFS+  +Q+++LEV +KDKD  KDD VGR+
Sbjct  298  DPYVEVKLGNFKGTTKHYEKNSSPEWNEVFAFSRTDVQSTVLEVTLKDKDHIKDDYVGRL  357

Query  553  VFDL  564
             FDL
Sbjct  358  YFDL  361



>ref|XP_011025029.1| PREDICTED: uncharacterized protein LOC105126018 isoform X2 [Populus 
euphratica]
Length=897

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 98/130 (75%), Gaps = 12/130 (9%)
 Frame = +1

Query  211  EDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKD  357
            +DF LK+T P LG         GG+  + G++  STYDLVEQ+ YLYVR+VKA+DLP   
Sbjct  268  DDFNLKDTDPQLGELWPSGGAYGGRGWMNGERYASTYDLVEQVSYLYVRIVKAKDLPSSS  327

Query  358  VTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkdd  537
            +T S DPYVEV+LGNYKG TRHFEKK NPEWNQVFAFSK+RIQ+S+LEV VKDK+    D
Sbjct  328  ITASCDPYVEVKLGNYKGRTRHFEKKMNPEWNQVFAFSKDRIQSSVLEVFVKDKEMVGRD  387

Query  538  S-VGRVVFDL  564
              +GRVVFDL
Sbjct  388  DYLGRVVFDL  397



>ref|XP_008458254.1| PREDICTED: uncharacterized protein LOC103497726 [Cucumis melo]
 ref|XP_008458255.1| PREDICTED: uncharacterized protein LOC103497726 [Cucumis melo]
Length=1018

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 101/124 (81%), Gaps = 6/124 (5%)
 Frame = +1

Query  211  EDFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
             D+ ++ET P+LGGG + G +L      T+TYDLVE+M YL+VRVVKARDLP KD+TG L
Sbjct  238  NDYSIRETSPYLGGGMVVGGRLALRDRPTNTYDLVEKMHYLFVRVVKARDLPTKDLTGGL  297

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGN+KGTT+H+EK S+PEWN+VFAFS+  +Q+++LEV +KDKD  KDD VGR+
Sbjct  298  DPYVEVKLGNFKGTTKHYEKNSSPEWNEVFAFSRTDVQSTVLEVTLKDKDHIKDDYVGRL  357

Query  553  VFDL  564
             FDL
Sbjct  358  YFDL  361



>ref|XP_010104492.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
 gb|EXC01093.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
Length=1024

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 98/126 (78%), Gaps = 3/126 (2%)
 Frame = +1

Query  190  KMQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  366
            +MQ P Q  +F L ET+P +   +  GDK  STYDLVEQM YLYV VVKARDLP  D++G
Sbjct  252  RMQVPSQNPEFALVETRPPVAARR--GDKTASTYDLVEQMHYLYVSVVKARDLPVMDISG  309

Query  367  SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVG  546
            SLDPYVEV+LGNYKG TRH+EK  NP W Q+F FSKER+Q+++LEV VKDKD  KDD VG
Sbjct  310  SLDPYVEVKLGNYKGVTRHWEKNPNPVWKQIFGFSKERLQSNLLEVTVKDKDIVKDDFVG  369

Query  547  RVVFDL  564
            RV+FDL
Sbjct  370  RVIFDL  375



>ref|XP_004166328.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101203632 
[Cucumis sativus]
Length=1018

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 101/124 (81%), Gaps = 6/124 (5%)
 Frame = +1

Query  211  EDFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  372
             D+ ++ET P+LGGG + G +L      T+TYDLVE+M YL+VRVVKARDLP KD+TG L
Sbjct  238  NDYSIRETSPYLGGGMVVGGRLALRDRPTNTYDLVEKMHYLFVRVVKARDLPTKDLTGGL  297

Query  373  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRV  552
            DPYVEV+LGN+KGTT+H+EK S+PEWN+VFAFS+  +Q+++LEV +KDKD  KDD VGR+
Sbjct  298  DPYVEVKLGNFKGTTKHYEKNSSPEWNEVFAFSRTDVQSTVLEVTLKDKDHIKDDYVGRL  357

Query  553  VFDL  564
             FDL
Sbjct  358  YFDL  361



>ref|XP_008778754.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 1-like [Phoenix dactylifera]
Length=1005

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 102/123 (83%), Gaps = 6/123 (5%)
 Frame = +1

Query  214  DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  375
            D+ LKET P LGGG+I G      +K  STYDLVEQMQYL+VRVVKARDLP  DV+GSLD
Sbjct  232  DYALKETNPFLGGGQIVGGRVIRAEKPASTYDLVEQMQYLFVRVVKARDLPAMDVSGSLD  291

Query  376  PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVV  555
            PYVEVR+GNY+G T+HFEKK NPEWN+VFAFS++R+Q+S++EV+VKDKD  KDD VG + 
Sbjct  292  PYVEVRVGNYRGITKHFEKKQNPEWNEVFAFSQDRMQSSVVEVVVKDKDLVKDDFVGLIR  351

Query  556  FDL  564
            FDL
Sbjct  352  FDL  354



>ref|XP_002532394.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF29979.1| synaptotagmin, putative [Ricinus communis]
Length=793

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 102/131 (78%), Gaps = 12/131 (9%)
 Frame = +1

Query  208  QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  354
            +EDF LK+TKP LG           GG I+ D+ TSTYDLVEQM YLYVRVVKA+DLP  
Sbjct  7    KEDFKLKDTKPQLGERWPHGGARGGGGWISSDRATSTYDLVEQMFYLYVRVVKAKDLPTN  66

Query  355  DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkd  534
             VTG++DPY+EV+LGNY+G T+HFEKK NPEWNQVFAFSK++IQ+S+LEV V+D++    
Sbjct  67   PVTGNIDPYIEVKLGNYRGKTKHFEKKINPEWNQVFAFSKDKIQSSVLEVFVRDREMVGR  126

Query  535  dS-VGRVVFDL  564
            D  +G+VVFD+
Sbjct  127  DDYIGKVVFDM  137



>ref|XP_011468807.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2 [Fragaria vesca subsp. vesca]
Length=1020

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 97/132 (73%), Gaps = 13/132 (10%)
 Frame = +1

Query  208  QEDFMLKETKPHLG------------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  351
            +ED+ LK+T P LG            G    G++  STYDLVEQM YLYVRVVKA+DLPP
Sbjct  232  EEDYDLKDTNPQLGERWPNGGAYGGRGWMSGGERFASTYDLVEQMFYLYVRVVKAKDLPP  291

Query  352  KDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdk  531
              +T S DPYVEV+LGNYKG T+HFE+K NPEWNQVFAFSK+RIQ+S+LEV VKDK+   
Sbjct  292  SSITASCDPYVEVKLGNYKGRTKHFERKMNPEWNQVFAFSKDRIQSSVLEVFVKDKEMIG  351

Query  532  ddS-VGRVVFDL  564
             D  +GRVVFDL
Sbjct  352  RDDYLGRVVFDL  363



>ref|XP_010659323.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Vitis vinifera]
Length=776

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 102/120 (85%), Gaps = 1/120 (1%)
 Frame = +1

Query  208  QEDFMLKETKPHLGGGKIT-GDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPYV  384
            ++D+ LKET P+LGGG+++ GDKLT+ +DLVEQM YLYVRVVKA++LP KD + S DPYV
Sbjct  13   EDDYCLKETSPNLGGGRLSRGDKLTTAFDLVEQMHYLYVRVVKAKELPGKDGSESCDPYV  72

Query  385  EVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVVFDL  564
            EV++GN+KG T+H EKKSNP W+QVFAFSK+R+Q+S +EV VKDK+  KDD +G V+FDL
Sbjct  73   EVKVGNFKGFTKHIEKKSNPVWSQVFAFSKDRLQSSFIEVSVKDKNGGKDDFMGVVLFDL  132



>ref|XP_006348415.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Solanum tuberosum]
Length=768

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 97/121 (80%), Gaps = 3/121 (2%)
 Frame = +1

Query  208  QEDFMLKETKPHLGGG--KITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPY  381
             E+F LK+T P + G    I GDK+T  YDLVEQM+YLYVRVVKA++L  KDVTGS DPY
Sbjct  7    HEEFALKQTAPKIVGSGVMIGGDKVTVAYDLVEQMEYLYVRVVKAKELT-KDVTGSCDPY  65

Query  382  VEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIVkdkdfdkddSVGRVVFD  561
            VEV++GNYKG T+HFEKK NPEWN VFAFS++R+QAS +EV VKDKD   DD +GRVVFD
Sbjct  66   VEVKVGNYKGITKHFEKKINPEWNYVFAFSQDRLQASYIEVCVKDKDVVLDDMIGRVVFD  125

Query  562  L  564
            L
Sbjct  126  L  126



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920