BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS039C03

Length=625
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008461868.1|  PREDICTED: alanine--tRNA ligase-like               241   1e-74   Cucumis melo [Oriental melon]
gb|EPS72880.1|  hypothetical protein M569_01869                         251   5e-74   Genlisea aurea
ref|XP_011084638.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    251   8e-74   
ref|XP_009351710.1|  PREDICTED: alanine--tRNA ligase                    248   6e-73   
ref|XP_003607217.1|  Alanyl-tRNA synthetase                             247   2e-72   
ref|XP_011022066.1|  PREDICTED: alanine--tRNA ligase                    247   2e-72   Populus euphratica
ref|XP_003619276.1|  Alanyl-tRNA synthetase                             246   2e-72   
ref|XP_008340455.1|  PREDICTED: alanine--tRNA ligase                    247   2e-72   Malus domestica [apple tree]
ref|XP_002277341.1|  PREDICTED: alanine--tRNA ligase                    246   3e-72   Vitis vinifera
gb|KDO52982.1|  hypothetical protein CISIN_1g001826mg                   246   3e-72   Citrus sinensis [apfelsine]
ref|XP_006437524.1|  hypothetical protein CICLE_v10030624mg             246   4e-72   Citrus clementina [clementine]
ref|XP_002307181.2|  alanyl-tRNA synthetase family protein              246   4e-72   
gb|KDO52980.1|  hypothetical protein CISIN_1g001826mg                   246   4e-72   Citrus sinensis [apfelsine]
gb|KDO52985.1|  hypothetical protein CISIN_1g001826mg                   246   4e-72   Citrus sinensis [apfelsine]
gb|KDO52986.1|  hypothetical protein CISIN_1g001826mg                   245   4e-72   Citrus sinensis [apfelsine]
gb|KDO52987.1|  hypothetical protein CISIN_1g001826mg                   244   5e-72   Citrus sinensis [apfelsine]
gb|KDO52981.1|  hypothetical protein CISIN_1g001826mg                   246   5e-72   Citrus sinensis [apfelsine]
gb|KDO52984.1|  hypothetical protein CISIN_1g001826mg                   246   5e-72   Citrus sinensis [apfelsine]
gb|KDO52983.1|  hypothetical protein CISIN_1g001826mg                   246   5e-72   Citrus sinensis [apfelsine]
ref|XP_010273668.1|  PREDICTED: alanine--tRNA ligase                    246   8e-72   Nelumbo nucifera [Indian lotus]
ref|XP_002531134.1|  alanyl-tRNA synthetase, putative                   245   9e-72   
ref|XP_009601820.1|  PREDICTED: alanine--tRNA ligase {ECO:0000255...    245   9e-72   Nicotiana tomentosiformis
ref|XP_008221037.1|  PREDICTED: alanine--tRNA ligase                    245   1e-71   Prunus mume [ume]
ref|XP_004148575.1|  PREDICTED: alanine--tRNA ligase-like               244   2e-71   
ref|XP_004163302.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    244   2e-71   
ref|XP_009802310.1|  PREDICTED: alanine--tRNA ligase                    244   3e-71   Nicotiana sylvestris
emb|CDP04914.1|  unnamed protein product                                224   3e-71   Coffea canephora [robusta coffee]
gb|KGN58521.1|  hypothetical protein Csa_3G656490                       244   3e-71   Cucumis sativus [cucumbers]
gb|KDP43289.1|  hypothetical protein JCGZ_24210                         244   3e-71   Jatropha curcas
ref|XP_010662077.1|  PREDICTED: alanine--tRNA ligase-like               243   8e-71   Vitis vinifera
ref|XP_004505726.1|  PREDICTED: alanine--tRNA ligase-like               243   9e-71   Cicer arietinum [garbanzo]
ref|XP_003607220.1|  Alanyl-tRNA synthetase                             238   1e-70   
gb|AES89417.2|  alanyl-tRNA synthetase                                  238   1e-70   Medicago truncatula
ref|XP_010683781.1|  PREDICTED: alanine--tRNA ligase                    242   2e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006484669.1|  PREDICTED: alanine--tRNA ligase-like isoform X2    241   2e-70   Citrus sinensis [apfelsine]
ref|XP_007043323.1|  Alanyl-tRNA synthetase, putative                   241   2e-70   
ref|XP_006347609.1|  PREDICTED: alanine--tRNA ligase-like               241   2e-70   Solanum tuberosum [potatoes]
ref|XP_004235270.1|  PREDICTED: alanine--tRNA ligase                    241   2e-70   Solanum lycopersicum
ref|XP_006484668.1|  PREDICTED: alanine--tRNA ligase-like isoform X1    241   3e-70   
ref|XP_003537781.2|  PREDICTED: alanine--tRNA ligase-like isoform X1    241   3e-70   Glycine max [soybeans]
ref|XP_010523577.1|  PREDICTED: alanine--tRNA ligase-like isoform X1    241   3e-70   Tarenaya hassleriana [spider flower]
emb|CBI27126.3|  unnamed protein product                                240   6e-70   Vitis vinifera
gb|KJB50036.1|  hypothetical protein B456_008G149700                    240   8e-70   Gossypium raimondii
gb|KJB50037.1|  hypothetical protein B456_008G149700                    240   8e-70   Gossypium raimondii
gb|KJB50034.1|  hypothetical protein B456_008G149700                    239   8e-70   Gossypium raimondii
gb|KJB50041.1|  hypothetical protein B456_008G149700                    240   8e-70   Gossypium raimondii
gb|KJB50035.1|  hypothetical protein B456_008G149700                    239   9e-70   Gossypium raimondii
gb|KJB50038.1|  hypothetical protein B456_008G149700                    239   9e-70   Gossypium raimondii
gb|KJB50039.1|  hypothetical protein B456_008G149700                    239   1e-69   Gossypium raimondii
gb|KJB31825.1|  hypothetical protein B456_005G210000                    239   1e-69   Gossypium raimondii
gb|KJB31826.1|  hypothetical protein B456_005G210000                    239   1e-69   Gossypium raimondii
ref|XP_004297751.1|  PREDICTED: alanine--tRNA ligase                    239   1e-69   Fragaria vesca subsp. vesca
ref|XP_007131657.1|  hypothetical protein PHAVU_011G031100g             239   2e-69   Phaseolus vulgaris [French bean]
ref|XP_010031895.1|  PREDICTED: alanine--tRNA ligase                    239   2e-69   Eucalyptus grandis [rose gum]
emb|CDP16859.1|  unnamed protein product                                222   3e-69   Coffea canephora [robusta coffee]
ref|XP_008778009.1|  PREDICTED: alanine--tRNA ligase-like               238   4e-69   
gb|AAK70626.1|AC091238_4  Putative cytosolic tRNA-Ala synthetase        226   7e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010541854.1|  PREDICTED: alanine--tRNA ligase-like               236   1e-68   Tarenaya hassleriana [spider flower]
ref|XP_009386816.1|  PREDICTED: alanine--tRNA ligase {ECO:0000255...    236   1e-68   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI26461.3|  unnamed protein product                                236   1e-68   Vitis vinifera
ref|XP_006826671.1|  hypothetical protein AMTR_s00137p00047050          235   3e-68   Amborella trichopoda
emb|CDY45055.1|  BnaA08g02200D                                          235   3e-68   Brassica napus [oilseed rape]
ref|XP_009107233.1|  PREDICTED: alanine--tRNA ligase                    235   4e-68   Brassica rapa
gb|KHN32273.1|  Alanine--tRNA ligase                                    234   6e-68   Glycine soja [wild soybean]
ref|XP_010904628.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    234   6e-68   Elaeis guineensis
gb|KDD75735.1|  class II (A) tRNA synthetase                            231   9e-68   Helicosporidium sp. ATCC 50920
ref|XP_001773539.1|  predicted protein                                  233   2e-67   
ref|XP_010927937.1|  PREDICTED: alanine--tRNA ligase-like               233   2e-67   Elaeis guineensis
gb|KHN05437.1|  Alanine--tRNA ligase                                    221   2e-67   Glycine soja [wild soybean]
ref|XP_007225354.1|  hypothetical protein PRUPE_ppa000923mg             233   2e-67   
ref|XP_006305941.1|  hypothetical protein CARUB_v10011180mg             233   2e-67   Capsella rubella
ref|XP_008810668.1|  PREDICTED: alanine--tRNA ligase-like isoform X1    233   2e-67   Phoenix dactylifera
ref|XP_008810673.1|  PREDICTED: alanine--tRNA ligase-like isoform X2    233   2e-67   
emb|CAA80381.1|  cytosolic tRNA-Ala synthetase                          232   3e-67   Arabidopsis thaliana [mouse-ear cress]
gb|AAD50044.1|AC007980_9  cytosolic tRNA-Ala synthetase                 232   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185186.1|  Alanyl-tRNA synthetase                             232   4e-67   
ref|XP_002894237.1|  cytosolic tRNA-Ala synthetase                      232   4e-67   
pir||S32671  alanine-tRNA ligase (EC 6.1.1.7) - Arabidopsis thali...    232   4e-67
ref|NP_175439.2|  Alanyl-tRNA synthetase                                232   4e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CAA80380.1|  mitochondrial tRNA-Ala synthetase                      232   4e-67   Arabidopsis thaliana [mouse-ear cress]
gb|EEC66648.1|  hypothetical protein OsI_32912                          231   6e-67   Oryza sativa Indica Group [Indian rice]
emb|CBK21983.2|  unnamed protein product                                231   8e-67   Blastocystis hominis
ref|XP_006393171.1|  hypothetical protein EUTSA_v10011205mg             231   8e-67   
ref|XP_006393173.1|  hypothetical protein EUTSA_v10011205mg             231   9e-67   
ref|XP_006393172.1|  hypothetical protein EUTSA_v10011205mg             231   9e-67   Eutrema salsugineum [saltwater cress]
gb|AFW56405.1|  hypothetical protein ZEAMMB73_266824                    221   1e-66   
ref|NP_001064254.1|  Os10g0182000                                       231   1e-66   
ref|XP_009147848.1|  PREDICTED: alanine--tRNA ligase-like               230   2e-66   Brassica rapa
emb|CDY22784.1|  BnaA06g02930D                                          230   2e-66   Brassica napus [oilseed rape]
ref|XP_010500574.1|  PREDICTED: alanine--tRNA ligase-like               230   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010479473.1|  PREDICTED: alanine--tRNA ligase                    230   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010463338.1|  PREDICTED: alanine--tRNA ligase-like               231   2e-66   Camelina sativa [gold-of-pleasure]
emb|CDY42520.1|  BnaC06g03380D                                          230   2e-66   Brassica napus [oilseed rape]
ref|XP_004983350.1|  PREDICTED: alanine--tRNA ligase-like isoform X3    229   5e-66   
ref|XP_003571715.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    229   5e-66   
ref|XP_004983349.1|  PREDICTED: alanine--tRNA ligase-like isoform X2    229   5e-66   Setaria italica
emb|CDY29328.1|  BnaA05g15950D                                          229   6e-66   Brassica napus [oilseed rape]
ref|XP_004983348.1|  PREDICTED: alanine--tRNA ligase-like isoform X1    229   8e-66   
ref|XP_011396133.1|  Alanine-tRNA ligase                                228   1e-65   Auxenochlorella protothecoides
ref|XP_005849315.1|  hypothetical protein CHLNCDRAFT_143654             221   2e-65   Chlorella variabilis
ref|XP_005645178.1|  hypothetical protein COCSUDRAFT_67160              227   6e-65   Coccomyxa subellipsoidea C-169
ref|XP_008662576.1|  PREDICTED: alanine--tRNA ligase                    225   1e-64   Zea mays [maize]
gb|KIH58709.1|  alanine--tRNA ligase                                    211   3e-64   Ancylostoma duodenale
ref|XP_002504833.1|  alanyl-tRNA synthetase                             223   6e-64   Micromonas commoda
gb|KIY74247.1|  hypothetical protein CYLTODRAFT_427840                  223   8e-64   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_005537171.1|  alanine--tRNA ligase cytoplasmic                   223   1e-63   Cyanidioschyzon merolae strain 10D
gb|EPX70595.1|  cytoplasmic alanine-tRNA ligase Ala1                    223   1e-63   Schizosaccharomyces octosporus yFS286
gb|KIZ04229.1|  alanyl-tRNA synthetase                                  222   2e-63   Monoraphidium neglectum
emb|CEL61027.1|  alanyl-tRNA synthetase                                 222   2e-63   Rhizoctonia solani AG-1 IB
gb|KEP53395.1|  alanyl-tRNA synthetase                                  221   2e-63   Rhizoctonia solani 123E
gb|KDQ21195.1|  hypothetical protein BOTBODRAFT_25615                   221   2e-63   Botryobasidium botryosum FD-172 SS1
gb|EUC64360.1|  alanyl-tRNA synthetase                                  221   3e-63   Rhizoctonia solani AG-3 Rhs1AP
dbj|BAJ98134.1|  predicted protein                                      221   3e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CEG77795.1|  Putative Alanyl-tRNA synthetase                        213   3e-63   Rhizopus microsporus
emb|CDK27200.1|  unnamed protein product                                221   3e-63   Kuraishia capsulata CBS 1993
ref|XP_002443089.1|  hypothetical protein SORBIDRAFT_08g008230          221   3e-63   Sorghum bicolor [broomcorn]
ref|XP_001731546.1|  hypothetical protein MGL_1729                      221   5e-63   Malassezia globosa CBS 7966
dbj|BAJ96541.1|  predicted protein                                      221   5e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EJU04465.1|  hypothetical protein DACRYDRAFT_20988                   220   9e-63   Dacryopinax primogenitus
gb|EPY51753.1|  cytoplasmic alanine-tRNA ligase Ala1                    220   9e-63   Schizosaccharomyces cryophilus OY26
gb|EMT18589.1|  Alanyl-tRNA synthetase, mitochondrial                   220   9e-63   
gb|KIM31429.1|  hypothetical protein M408DRAFT_327641                   219   1e-62   Serendipita vermifera MAFF 305830
gb|EKF39507.1|  alanyl-tRNA synthetase, putative                        219   2e-62   Trypanosoma cruzi marinkellei
ref|XP_816499.1|  alanyl-tRNA synthetase                                218   3e-62   Trypanosoma cruzi strain CL Brener
emb|CCV00729.1|  unnamed protein product                                218   3e-62   Malassezia sympodialis ATCC 42132
ref|XP_810193.1|  alanyl-tRNA synthetase                                218   3e-62   Trypanosoma cruzi strain CL Brener
gb|EKG06983.1|  alanyl-tRNA synthetase, putative                        218   3e-62   Trypanosoma cruzi
gb|ESS63542.1|  alanyl-tRNA synthetase                                  218   5e-62   Trypanosoma cruzi Dm28c
gb|KFH15707.1|  cytosolic tRNA-Ala synthetase                           201   5e-62   Toxoplasma gondii MAS
gb|AAA84420.1|  AlaRS A                                                 206   5e-62   Caenorhabditis elegans [roundworm]
ref|XP_003030369.1|  hypothetical protein SCHCODRAFT_82606              217   7e-62   Schizophyllum commune H4-8
emb|CEI92968.1|  Putative Alanyl-tRNA synthetase                        217   8e-62   Rhizopus microsporus
gb|EPS99866.1|  hypothetical protein FOMPIDRAFT_1024013                 217   8e-62   Fomitopsis pinicola FP-58527 SS1
ref|XP_011111424.1|  hypothetical protein H072_5555                     218   9e-62   
gb|KHJ91121.1|  alanine--tRNA ligase                                    212   9e-62   Oesophagostomum dentatum [nodule worm]
gb|KIW00804.1|  alanine-tRNA ligase                                     217   9e-62   Verruconis gallopava
gb|AFR32145.1|  alanyl-tRNA synthetase                                  217   1e-61   Geotrichum candidum
gb|AFR32153.1|  alanyl-tRNA synthetase                                  217   1e-61   Geotrichum candidum
ref|XP_003079014.1|  SYA_ARATH Alanyl-tRNA synthetase, mitochondr...    218   2e-61   
emb|CEF97732.1|  Thioredoxin-like fold                                  218   2e-61   Ostreococcus tauri
emb|CEG71324.1|  Putative Alanyl-tRNA synthetase                        216   2e-61   Rhizopus microsporus
ref|XP_011121665.1|  hypothetical protein AOL_s00078g100                216   2e-61   Arthrobotrys oligospora ATCC 24927
emb|CBQ72435.1|  probable ALA1-alanyl-tRNA synthetase, cytosolic        216   2e-61   Sporisorium reilianum SRZ2
ref|XP_001524092.1|  alanyl-tRNA synthetase                             209   2e-61   Lodderomyces elongisporus NRRL YB-4239
gb|EFW22234.1|  alanyl-tRNA synthetase                                  216   3e-61   Coccidioides posadasii str. Silveira
ref|XP_007847723.1|  alanyl-trna synthetase                             216   3e-61   
gb|EMS67609.1|  Alanyl-tRNA synthetase                                  218   3e-61   Triticum urartu
emb|CDJ84213.1|  Alanyl-tRNA synthetase and Threonyl alanyl tRNA ...    215   3e-61   Haemonchus contortus [red stomach worm]
emb|CEP13586.1|  hypothetical protein                                   215   3e-61   Parasitella parasitica
ref|XP_001248510.1|  alanyl-tRNA synthetase, cytoplasmic                216   4e-61   Coccidioides immitis RS
ref|XP_004335848.1|  alanine-tRNA ligase                                215   4e-61   Acanthamoeba castellanii str. Neff
ref|XP_001877691.1|  predicted protein                                  215   4e-61   Laccaria bicolor S238N-H82
ref|XP_001683305.1|  putative alanyl-tRNA synthetase                    215   4e-61   Leishmania major strain Friedlin
ref|XP_003070819.1|  Alanyl-tRNA synthetase, cytoplasmic , putative     216   4e-61   Coccidioides posadasii C735 delta SOWgp
ref|XP_008720639.1|  alanyl-tRNA synthetase                             215   4e-61   Cyphellophora europaea CBS 101466
ref|XP_001465654.1|  putative alanyl-tRNA synthetase                    215   5e-61   Leishmania infantum JPCM5
emb|CDJ87289.1|  Alanyl-tRNA synthetase and Threonyl alanyl tRNA ...    215   5e-61   Haemonchus contortus [red stomach worm]
gb|AFR32146.1|  alanyl-tRNA synthetase                                  215   5e-61   Geotrichum candidum
ref|XP_009547440.1|  hypothetical protein HETIRDRAFT_476425             215   6e-61   Heterobasidion irregulare TC 32-1
emb|CDO95315.1|  unnamed protein product                                214   9e-61   Kluyveromyces dobzhanskii CBS 2104
emb|CDO74931.1|  hypothetical protein BN946_scf184945.g3                214   9e-61   Trametes cinnabarina
gb|EYB99703.1|  hypothetical protein Y032_0120g894                      214   9e-61   Ancylostoma ceylanicum
ref|XP_009493046.1|  alanyl-tRNA synthetase                             214   1e-60   Fonticula alba
gb|EGD95966.1|  alanyl-tRNA synthetase                                  214   1e-60   Trichophyton tonsurans CBS 112818
gb|KIP06586.1|  hypothetical protein PHLGIDRAFT_128168                  214   1e-60   Phlebiopsis gigantea 11061_1 CR5-6
gb|EGE01186.1|  alanyl-tRNA synthetase                                  214   1e-60   Trichophyton equinum CBS 127.97
dbj|BAP72231.1|  alanyl-tRNA synthetase                                 214   1e-60   Kluyveromyces marxianus
dbj|BAO40758.1|  alanyl-tRNA synthetase                                 214   1e-60   Kluyveromyces marxianus DMKU3-1042
gb|EZF33517.1|  alanyl-tRNA synthetase                                  214   1e-60   Trichophyton interdigitale H6
ref|XP_455190.1|  hypothetical protein                                  214   1e-60   Kluyveromyces lactis
gb|EIE82853.1|  alanyl-tRNA synthetase                                  214   1e-60   Rhizopus delemar RA 99-880
ref|XP_007317881.1|  hypothetical protein SERLADRAFT_361256             214   1e-60   Serpula lacrymans var. lacrymans S7.9
ref|XP_004198838.1|  Piso0_002228                                       214   1e-60   
gb|EST08427.1|  alanyl-tRNA synthetase                                  214   1e-60   Kalmanozyma brasiliensis GHG001
ref|XP_002843973.1|  alanyl-tRNA synthetase                             214   1e-60   Microsporum canis CBS 113480
ref|XP_003875608.1|  putative alanyl-tRNA synthetase                    214   1e-60   Leishmania mexicana MHOM/GT/2001/U1103
ref|XP_006676752.1|  hypothetical protein BATDEDRAFT_32863              214   2e-60   Batrachochytrium dendrobatidis JAM81
ref|XP_003172403.1|  alanyl-tRNA synthetase                             213   2e-60   Nannizzia gypsea CBS 118893
gb|ESL08568.1|  alanyl-tRNA synthetase                                  213   2e-60   Trypanosoma rangeli SC58
ref|XP_002615762.1|  hypothetical protein CLUG_04644                    213   2e-60   Clavispora lusitaniae ATCC 42720
ref|XP_001643652.1|  hypothetical protein Kpol_1040p7                   213   2e-60   Vanderwaltozyma polyspora DSM 70294
gb|KGK39868.1|  hypothetical protein JL09_g980                          216   2e-60   Pichia kudriavzevii
ref|XP_011388270.1|  putative alanine--tRNA ligase                      213   2e-60   Ustilago maydis 521
gb|KDQ57564.1|  hypothetical protein JAAARDRAFT_35260                   213   2e-60   Jaapia argillacea MUCL 33604
gb|KHN71931.1|  Alanine--tRNA ligase, cytoplasmic                       201   2e-60   Toxocara canis
ref|XP_845193.1|  alanyl-tRNA synthetase                                213   2e-60   Trypanosoma brucei brucei TREU927
gb|KIW56168.1|  alanine-tRNA ligase                                     214   2e-60   Exophiala xenobiotica
gb|KIV89764.1|  alanine-tRNA ligase                                     214   2e-60   Exophiala mesophila
emb|CCC48230.1|  putative alanyl-tRNA synthetase                        213   2e-60   Trypanosoma vivax Y486
gb|KIV89765.1|  alanine-tRNA ligase, variant 1                          213   3e-60   Exophiala mesophila
ref|NP_593640.1|  mitochondrial and cytoplasmic alanine-tRNA liga...    213   3e-60   Schizosaccharomyces pombe
dbj|GAN03494.1|  alanyl-tRNA synthetase                                 213   3e-60   Mucor ambiguus
ref|XP_002173036.1|  cytoplasmic alanine-tRNA ligase Ala1               213   3e-60   Schizosaccharomyces japonicus yFS275
gb|EPB88726.1|  alanyl-tRNA synthetase                                  213   3e-60   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_007724363.1|  alanyl-tRNA synthetase                             213   4e-60   Capronia coronata CBS 617.96
ref|XP_456501.2|  DEHA2A03652p                                          213   4e-60   Debaryomyces hansenii CBS767
gb|KIW20001.1|  alanine-tRNA ligase                                     213   4e-60   Exophiala spinifera
ref|XP_010699144.1|  alanyl-tRNA synthetase, putative                   213   4e-60   Leishmania panamensis
ref|XP_001565061.2|  putative alanyl-tRNA synthetase                    213   4e-60   Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_002839828.1|  hypothetical protein                               212   4e-60   Tuber melanosporum Mel28
dbj|GAC93028.1|  alanyl-tRNA synthetase                                 214   5e-60   Pseudozyma hubeiensis SY62
ref|XP_009159895.1|  alanyl-tRNA synthetase                             213   5e-60   Exophiala dermatitidis NIH/UT8656
ref|XP_004199688.1|  Piso0_002228                                       212   5e-60   
ref|XP_002552804.1|  KLTH0D01848p                                       212   6e-60   Lachancea thermotolerans CBS 6340
gb|KIW23162.1|  alanine-tRNA ligase                                     213   6e-60   Cladophialophora immunda
ref|XP_003676658.1|  hypothetical protein NCAS_0E02290                  212   7e-60   Naumovozyma castellii CBS 4309
ref|XP_500483.1|  YALI0B04180p                                          212   7e-60   Yarrowia lipolytica CLIB122
gb|KDR75441.1|  hypothetical protein GALMADRAFT_249500                  212   7e-60   Galerina marginata CBS 339.88
ref|XP_627438.1|  alanyl-tRNA synthetase (with HxxxH domain)            212   7e-60   Cryptosporidium parvum Iowa II
emb|CCF49697.1|  probable ALA1-alanyl-tRNA synthetase, cytosolic        212   8e-60   Ustilago hordei
gb|KIW83490.1|  alanine-tRNA ligase                                     211   8e-60   Fonsecaea pedrosoi CBS 271.37
gb|KIK03536.1|  hypothetical protein K443DRAFT_676709                   211   8e-60   Laccaria amethystina LaAM-08-1
ref|XP_665905.1|  cytosolic tRNA-Ala synthetase                         212   9e-60   Cryptosporidium hominis TU502
sp|Q5AQL1.2|SYA_EMENI  RecName: Full=Alanine--tRNA ligase; AltNam...    211   9e-60   Aspergillus nidulans FGSC A4
ref|XP_001486846.1|  hypothetical protein PGUG_00223                    211   9e-60   Meyerozyma guilliermondii ATCC 6260
emb|CDI53029.1|  probable ALA1-alanyl-tRNA synthetase, cytosolic        211   1e-59   Melanopsichium pennsylvanicum 4
ref|XP_003957527.1|  hypothetical protein KAFR_0E02390                  211   1e-59   Kazachstania africana CBS 2517
ref|XP_007582290.1|  putative alanyl-trna synthetase protein            211   1e-59   
dbj|GAA89407.1|  alanyl-tRNA synthetase                                 211   1e-59   Aspergillus kawachii IFO 4308
gb|KIX01548.1|  alanine-tRNA ligase                                     211   1e-59   Rhinocladiella mackenziei CBS 650.93
ref|XP_002646367.1|  C. briggsae CBR-ARS-2 protein                      211   1e-59   Caenorhabditis briggsae
gb|KIL68962.1|  hypothetical protein M378DRAFT_71103                    211   1e-59   Amanita muscaria Koide BX008
gb|EGT52396.1|  hypothetical protein CAEBREN_18885                      211   1e-59   Caenorhabditis brenneri
ref|XP_005709097.1|  alanyl-tRNA synthetase                             211   1e-59   Galdieria sulphuraria
gb|EGT32559.1|  hypothetical protein CAEBREN_22812                      211   1e-59   Caenorhabditis brenneri
ref|NP_491281.1|  Protein AARS-2                                        211   1e-59   Caenorhabditis elegans [roundworm]
ref|XP_007353910.1|  hypothetical protein AURDEDRAFT_116636             211   1e-59   
emb|CCW61998.1|  unnamed protein product                                211   1e-59   Phytomonas sp. isolate EM1
emb|CDH13133.1|  probable ALA1-Alanyl-tRNA synthetase,cytosolic         211   1e-59   Zygosaccharomyces bailii ISA1307
ref|XP_007291338.1|  tRNA synthetase class II                           211   2e-59   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_007759596.1|  alanyl-tRNA synthetase                             211   2e-59   Cladophialophora yegresii CBS 114405
gb|KIX98796.1|  alanine-tRNA ligase                                     211   2e-59   Fonsecaea multimorphosa CBS 102226
gb|EGA72819.1|  Ala1p                                                   208   2e-59   Saccharomyces cerevisiae AWRI796
ref|XP_007833565.1|  Alanine--tRNA ligase                               211   2e-59   Pestalotiopsis fici W106-1
emb|CDH15032.1|  probable ALA1-Alanyl-tRNA synthetase,cytosolic         211   2e-59   Zygosaccharomyces bailii ISA1307
emb|CDF90599.1|  ZYBA0S07-04786g1_1                                     211   2e-59   Zygosaccharomyces bailii CLIB 213
gb|EKG22385.1|  Alanyl-tRNA synthetase class IIc                        211   2e-59   Macrophomina phaseolina MS6
emb|CCW66342.1|  unnamed protein product                                211   2e-59   Phytomonas sp. isolate Hart1
gb|KDQ33558.1|  hypothetical protein PLEOSDRAFT_1091537                 210   2e-59   Pleurotus ostreatus PC15
ref|XP_007803265.1|  Alanine--tRNA ligase                               210   2e-59   Endocarpon pusillum Z07020
gb|EJK71470.1|  hypothetical protein THAOC_07085                        211   2e-59   Thalassiosira oceanica
gb|KIY44323.1|  hypothetical protein FISHEDRAFT_77527                   210   2e-59   Fistulina hepatica ATCC 64428
ref|XP_008725247.1|  alanyl-tRNA synthetase                             210   2e-59   Cladophialophora carrionii CBS 160.54
dbj|GAK63909.1|  alanyl-tRNA synthetase                                 211   2e-59   Moesziomyces antarcticus
ref|XP_001642960.1|  hypothetical protein Kpol_1071p9                   210   2e-59   Vanderwaltozyma polyspora DSM 70294
gb|KIW48370.1|  alanine-tRNA ligase                                     211   2e-59   Exophiala oligosperma
ref|XP_007377582.1|  alanyl-tRNA synthetase, cytoplasmic                210   3e-59   Spathaspora passalidarum NRRL Y-27907
emb|CCA72755.1|  probable ALA1-alanyl-tRNA synthetase, cytosolic        210   3e-59   Serendipita indica DSM 11827
ref|XP_445923.1|  hypothetical protein                                  210   3e-59   [Candida] glabrata
ref|XP_001417607.1|  predicted protein                                  210   3e-59   Ostreococcus lucimarinus CCE9901
gb|EME44029.1|  hypothetical protein DOTSEDRAFT_44310                   210   3e-59   Dothistroma septosporum NZE10
ref|XP_001830532.2|  tRNA synthetase class II                           210   3e-59   Coprinopsis cinerea okayama7#130
gb|KIK68832.1|  hypothetical protein GYMLUDRAFT_152556                  210   3e-59   Gymnopus luxurians FD-317 M1
gb|KDE06114.1|  alanyl-tRNA synthetase                                  210   3e-59   Microbotryum lychnidis-dioicae p1A1 Lamole
dbj|GAC71363.1|  alanyl-trna synthetase                                 211   3e-59   Moesziomyces antarcticus T-34
gb|ETS61722.1|  hypothetical protein PaG_04227                          211   3e-59   Moesziomyces aphidis DSM 70725
ref|XP_007741222.1|  alanyl-tRNA synthetase                             210   3e-59   Cladophialophora psammophila CBS 110553
ref|XP_003104792.1|  CRE-AARS-2 protein                                 210   4e-59   Caenorhabditis remanei
ref|XP_003060777.1|  alanyl-tRNA synthetase                             209   4e-59   Micromonas pusilla CCMP1545
gb|KIW91962.1|  alanine-tRNA ligase                                     209   4e-59   Cladophialophora bantiana CBS 173.52
gb|KIW65631.1|  alanine-tRNA ligase                                     210   5e-59   Phialophora americana
ref|XP_007779583.1|  alanyl-tRNA synthetase                             209   5e-59   Coniosporium apollinis CBS 100218
gb|EXX57273.1|  alanine--tRNA ligase                                    208   5e-59   Rhizophagus irregularis DAOM 197198w
gb|EGA56826.1|  Ala1p                                                   208   5e-59   Saccharomyces cerevisiae FostersB
emb|CCD81172.1|  putative alanyl-tRNA synthetase                        209   5e-59   Schistosoma mansoni
gb|ERZ95099.1|  hypothetical protein GLOINDRAFT_341419                  209   5e-59   
gb|EGA60508.1|  Ala1p                                                   208   6e-59   Saccharomyces cerevisiae FostersO
ref|XP_009309736.1|  putative alanyl-tRNA synthetase                    209   6e-59   Trypanosoma grayi
ref|XP_007511747.1|  alanyl-tRNA synthetase                             211   6e-59   Bathycoccus prasinos
emb|CCX13711.1|  Similar to Alanine--tRNA ligase; acc. no. Q5AQL1       209   6e-59   Pyronema omphalodes CBS 100304
gb|KFG64908.1|  cytosolic tRNA-Ala synthetase                           202   6e-59   Toxoplasma gondii RUB
ref|XP_003053770.1|  predicted protein                                  209   6e-59   [Nectria] haematococca mpVI 77-13-4
gb|EEU07514.1|  Ala1p                                                   209   6e-59   Saccharomyces cerevisiae JAY291
gb|EDV10897.1|  alanyl-tRNA synthetase                                  209   6e-59   Saccharomyces cerevisiae RM11-1a
ref|NP_014980.3|  alanine--tRNA ligase                                  209   7e-59   Saccharomyces cerevisiae S288C
dbj|GAA26640.1|  K7_Ala1p                                               209   7e-59   Saccharomyces cerevisiae Kyokai no. 7
gb|EGA76661.1|  Ala1p                                                   209   7e-59   Saccharomyces cerevisiae Vin13
ref|XP_007797550.1|  putative alanyl-trna synthetase protein            209   7e-59   
sp|P40825.3|SYA_YEAST  RecName: Full=Alanine--tRNA ligase, mitoch...    209   7e-59   Saccharomyces cerevisiae S288C
gb|EWH16115.1|  Ala1p                                                   209   7e-59   
gb|EDN63655.1|  alanyl-tRNA synthetase                                  209   7e-59   
gb|AJP41837.1|  Ala1p                                                   209   7e-59   
ref|XP_007308256.1|  hypothetical protein STEHIDRAFT_149395             209   7e-59   
emb|CEJ88871.1|  Putative Alanyl-tRNA synthetase                        209   7e-59   
gb|EIF48501.1|  cytoplasmic alanyl-trna synthetase                      209   7e-59   
gb|EFQ25498.1|  tRNA synthetase class II                                209   7e-59   
ref|XP_007737759.1|  alanyl-tRNA synthetase                             209   7e-59   
ref|XP_005710836.1|  Alanine--tRNA ligase                               209   8e-59   
ref|XP_002496623.1|  ZYRO0D04378p                                       209   8e-59   
ref|XP_003870578.1|  Ala1 alanyl-tRNA synthetase                        209   8e-59   
gb|EHN00072.1|  Ala1p                                                   209   8e-59   
gb|EMG50125.1|  Alanyl-tRNA synthetase, putative                        209   8e-59   
gb|EJT44225.1|  ALA1-like protein                                       209   9e-59   
ref|XP_007380880.1|  hypothetical protein PUNSTDRAFT_141744             209   9e-59   
ref|XP_003670443.1|  hypothetical protein NDAI_0E03830                  208   1e-58   
dbj|GAM82706.1|  hypothetical protein ANO11243_006900                   209   1e-58   
gb|ETN73632.1|  alanine--tRNA ligase                                    210   1e-58   
gb|EMD37438.1|  hypothetical protein CERSUDRAFT_83193                   208   1e-58   
gb|AAC49007.1|  cytoplasmic alanyl-tRNA synthetase                      208   1e-58   
gb|EWC45240.1|  alanine--tRNA ligase                                    208   1e-58   
ref|XP_007878798.1|  hypothetical protein PFL1_03091                    208   1e-58   
gb|EWM22315.1|  alanyl-trna synthetase                                  207   1e-58   
ref|XP_003652306.1|  hypothetical protein THITE_2113640                 208   1e-58   
emb|CAK47129.1|  unnamed protein product                                208   1e-58   
emb|CEP64837.1|  LALA0S14e00408g1_1                                     208   1e-58   
emb|CCJ30352.1|  unnamed protein product                                208   1e-58   
ref|XP_002796769.1|  alanyl-tRNA synthetase                             208   1e-58   
emb|CCA39700.1|  alanyl-tRNA synthetase                                 208   2e-58   
ref|XP_007397053.1|  hypothetical protein PHACADRAFT_258158             208   2e-58   
ref|XP_003686912.1|  hypothetical protein TPHA_0H02750                  208   2e-58   
ref|XP_002492690.1|  Cytoplasmic alanyl-tRNA synthetase                 208   2e-58   
ref|XP_007872286.1|  alanyl-tRNA synthetase                             208   2e-58   
ref|XP_007266315.1|  hypothetical protein FOMMEDRAFT_167809             208   2e-58   
gb|KIV86028.1|  alanine-tRNA ligase                                     209   2e-58   
emb|CCK70315.1|  hypothetical protein KNAG_0E00470                      207   2e-58   
gb|KHJ35999.1|  putative alanyl-trna synthetase                         208   2e-58   
ref|XP_001383420.2|  Alanyl-tRNA synthetase, cytoplasmic (Alanine...    207   3e-58   
gb|KIJ21967.1|  hypothetical protein PAXINDRAFT_165291                  207   3e-58   
ref|XP_001398230.2|  alanyl-tRNA synthetase, cytoplasmic                207   3e-58   
ref|XP_002548433.1|  alanyl-tRNA synthetase                             206   3e-58   
gb|KFG38414.1|  cytosolic tRNA-Ala synthetase                           201   3e-58   
ref|XP_006966474.1|  predicted protein                                  207   3e-58   
ref|XP_003683463.1|  hypothetical protein TDEL_0H03930                  207   3e-58   
dbj|GAD98516.1|  alanyl-tRNA synthetase, cytoplasmic                    207   3e-58   
ref|XP_011105656.1|  ala1p                                              207   3e-58   
gb|KDN64543.1|  putative tRNA synthetase class II                       207   4e-58   
ref|XP_003328904.2|  alanyl-tRNA synthetase                             207   4e-58   
ref|XP_009262152.1|  hypothetical protein FPSE_10760                    207   4e-58   
ref|XP_006461020.1|  hypothetical protein AGABI2DRAFT_192563            207   4e-58   
ref|XP_007328463.1|  hypothetical protein AGABI1DRAFT_112599            207   4e-58   
gb|KHC63511.1|  alanyl-tRNA synthetase                                  207   4e-58   
emb|CDJ43006.1|  alanyl-tRNA synthetase, putative                       207   4e-58   
ref|XP_011316641.1|  alanyl-tRNA synthetase                             207   4e-58   
ref|XP_002421135.1|  alanyl-tRNA synthetase, putative                   207   4e-58   
gb|ESW96567.1|  Alanine--tRNA ligase                                    207   4e-58   
gb|KGQ84359.1|  alanyl-tRNA synthetase                                  207   4e-58   
gb|EMS24060.1|  alanine-tRNA synthetase                                 207   4e-58   
gb|KHC33201.1|  alanyl-tRNA synthetase                                  207   4e-58   
ref|XP_718082.1|  hypothetical protein CaO19.5746                       207   4e-58   
gb|KIL94735.1|  hypothetical protein FAVG1_01666                        207   4e-58   
gb|KGU04317.1|  alanyl-tRNA synthetase                                  207   4e-58   
gb|KGQ88605.1|  alanyl-tRNA synthetase                                  207   4e-58   
gb|EEQ46641.1|  alanyl-tRNA synthetase                                  207   5e-58   
gb|KGR08732.1|  alanyl-tRNA synthetase                                  207   5e-58   
gb|EGU11988.1|  hypothetical protein RTG_01868                          206   5e-58   
emb|CCC90799.1|  putative alanyl-tRNA synthetase                        207   5e-58   
ref|XP_010755650.1|  alanyl-tRNA synthetase                             207   5e-58   
gb|EEH39315.2|  alanyl-tRNA synthetase                                  207   5e-58   
ref|XP_001261933.1|  alanyl-tRNA synthetase, putative                   206   5e-58   
gb|EEH21600.2|  alanyl-tRNA synthetase                                  207   6e-58   
emb|CCT62693.1|  probable alanine--tRNA ligase, cytosolic               206   6e-58   
emb|CDJ65254.1|  alanyl-tRNA synthetase, putative                       207   6e-58   
ref|XP_002950616.1|  hypothetical protein VOLCADRAFT_120886             207   6e-58   
gb|KII92325.1|  hypothetical protein PLICRDRAFT_37088                   206   6e-58   
ref|XP_007286070.1|  alanyl-trna synthetase                             206   6e-58   
gb|EGZ77942.1|  cytosolic probable alanine--tRNA ligase                 206   6e-58   
ref|XP_009856724.1|  hypothetical protein NEUTE1DRAFT_126487            206   7e-58   
ref|XP_005830058.1|  hypothetical protein GUITHDRAFT_163919             206   7e-58   
emb|CCE39704.1|  hypothetical protein CPAR2_601240                      206   8e-58   
gb|KIK48384.1|  hypothetical protein CY34DRAFT_71989                    206   8e-58   
gb|KIK96545.1|  hypothetical protein PAXRUDRAFT_825820                  206   8e-58   
ref|XP_003346257.1|  hypothetical protein SMAC_05794                    206   8e-58   
emb|CDR44690.1|  CYFA0S15e01530g1_1                                     206   8e-58   
emb|CCF32573.1|  alanyl-tRNA synthetase                                 206   9e-58   
gb|EHK25247.1|  hypothetical protein TRIVIDRAFT_72371                   206   9e-58   
gb|EGU79625.1|  hypothetical protein FOXB_09908                         206   9e-58   
gb|EMT61526.1|  Alanyl-tRNA synthetase                                  206   9e-58   
gb|KGO43717.1|  Translation elongation/initiation factor/Ribosoma...    206   9e-58   
ref|XP_002565032.1|  Pc22g10240                                         206   9e-58   
ref|XP_003137715.1|  alanyl-tRNA synthetase                             206   9e-58   
ref|XP_007590082.1|  tRNA synthetase class II                           207   1e-57   
ref|XP_747195.1|  alanyl-tRNA synthetase                                206   1e-57   
gb|KEQ98971.1|  hypothetical protein AUEXF2481DRAFT_62459               206   1e-57   
gb|EDP48921.1|  alanyl-tRNA synthetase, putative                        206   1e-57   
gb|EKV04967.1|  Alanyl-tRNA synthetase, putative                        206   1e-57   
ref|XP_006670682.1|  alanyl-tRNA synthetase                             206   1e-57   
gb|KGQ12010.1|  Alanine--tRNA ligase                                    206   1e-57   
ref|XP_001544824.1|  hypothetical protein HCAG_01871                    205   1e-57   
emb|CDJ57403.1|  alanyl-tRNA synthetase, putative                       206   1e-57   
ref|XP_008593589.1|  tRNA synthetase class II                           206   1e-57   
gb|EMF10929.1|  alanyl-tRNA synthetase                                  206   1e-57   
gb|EJW87808.1|  alanyl-tRNA synthetase                                  205   1e-57   
ref|XP_642382.1|  alanyl-tRNA synthetase                                205   1e-57   
gb|KFM75814.1|  Alanine--tRNA ligase, cytoplasmic                       192   1e-57   
ref|NP_984459.1|  ADR363Cp                                              205   1e-57   
gb|ENH77318.1|  alanyl-trna synthetase                                  205   1e-57   
gb|AAF05592.1|AF188717_1  alanyl-tRNA synthetase                        205   1e-57   
ref|XP_003285278.1|  alanyl-tRNA synthetase                             205   2e-57   
gb|KDN40606.1|  hypothetical protein K437DRAFT_258595                   205   2e-57   
ref|XP_001276490.1|  alanyl-tRNA synthetase, putative                   205   2e-57   
gb|AGO12026.1|  AaceriADR363Cp                                          205   2e-57   
emb|CBJ30506.1|  Alanyl-tRNA Synthetase                                 205   2e-57   
gb|ERG86277.1|  alanine--trna cytoplasmic                               205   2e-57   
gb|EHK40392.1|  hypothetical protein TRIATDRAFT_153342                  205   2e-57   
gb|EGC43441.1|  alanyl-tRNA synthetase                                  205   2e-57   
gb|EER42379.1|  alanyl-tRNA synthetase                                  205   2e-57   
ref|XP_002296928.1|  alanine-trna ligase                                204   2e-57   
gb|EWG36790.1|  alanyl-tRNA synthetase                                  206   2e-57   
gb|KFH69574.1|  alanyl-tRNA synthetase                                  205   2e-57   
emb|CDJ53239.1|  alanyl-tRNA synthetase, putative                       205   2e-57   
emb|CDM36177.1|  Alanyl-tRNA synthetase                                 205   2e-57   
ref|XP_006687556.1|  hypothetical protein CANTEDRAFT_109802             204   3e-57   
ref|XP_011270692.1|  alanyl-tRNA synthetase                             204   3e-57   
gb|EWY93089.1|  alanyl-tRNA synthetase                                  206   3e-57   
gb|EXM11972.1|  alanyl-tRNA synthetase                                  206   3e-57   
ref|XP_001899825.1|  Alanyl-tRNA synthetase                             204   3e-57   
emb|CDI78985.1|  alanyl-tRNA synthetase, putative                       205   3e-57   
gb|EWZ90926.1|  alanyl-tRNA synthetase                                  206   3e-57   
gb|EXA52140.1|  alanyl-tRNA synthetase                                  206   3e-57   
gb|EXM30177.1|  alanyl-tRNA synthetase                                  206   3e-57   
gb|EWZ51596.1|  alanyl-tRNA synthetase                                  206   3e-57   
gb|KIM70344.1|  hypothetical protein SCLCIDRAFT_19240                   204   3e-57   
gb|KHE90003.1|  hypothetical protein GE21DRAFT_743                      206   3e-57   
ref|XP_009216994.1|  alanyl-tRNA synthetase                             205   3e-57   
ref|XP_002675895.1|  alanyl-tRNA synthetase                             204   3e-57   
ref|XP_001826622.2|  alanyl-tRNA synthetase, cytoplasmic                205   3e-57   
ref|XP_965697.3|  alanyl-tRNA synthetase                                205   3e-57   
gb|EFX00948.1|  alanyl-tRNA synthetase                                  205   3e-57   
gb|EPE10223.1|  alanyl-trna synthetase                                  204   4e-57   
ref|XP_003852188.1|  alanine--tRNA ligase                               204   4e-57   
ref|XP_004360351.1|  alanyl-tRNA synthetase                             204   4e-57   
gb|KFH05082.1|  cytosolic tRNA-Ala synthetase                           202   4e-57   
emb|CDS33215.1|  alanyl tRNA synthetase, cytoplasmic                    204   4e-57   
ref|XP_002370708.1|  alanyl-tRNA synthetase, putative                   204   5e-57   
emb|CEF67938.1|  Alanine--tRNA ligase, mitochondrial                    204   6e-57   
ref|XP_006696405.1|  cytoplasmic alanyl-tRNA synthetase-like protein    204   7e-57   
ref|XP_007409403.1|  hypothetical protein MELLADRAFT_48072              204   7e-57   
ref|XP_007929747.1|  hypothetical protein MYCFIDRAFT_57749              203   7e-57   
gb|KIM78966.1|  hypothetical protein PILCRDRAFT_824096                  203   7e-57   
ref|XP_004177771.1|  hypothetical protein TBLA_0A04580                  203   7e-57   
ref|XP_007864521.1|  hypothetical protein GLOTRDRAFT_110560             203   7e-57   
gb|KEZ41504.1|  Alanyl-tRNA synthetase                                  204   8e-57   
emb|CDS09810.1|  hypothetical protein LRAMOSA02487                      189   9e-57   
emb|CCE35146.1|  probable alanine--tRNA ligase, cytosolic               203   1e-56   
ref|XP_006956391.1|  hypothetical protein WALSEDRAFT_31222              203   1e-56   
gb|EQL02007.1|  alanyl-tRNA synthetase                                  203   1e-56   
gb|EFA82800.1|  alanyl-tRNA synthetase                                  203   1e-56   
ref|XP_318757.4|  AGAP009701-PA                                         202   1e-56   
ref|XP_007914442.1|  putative alanyl-trna synthetase protein            202   2e-56   
gb|EEQ85258.1|  alanyl-tRNA synthetase                                  202   2e-56   
ref|XP_002628910.1|  alanyl-tRNA synthetase                             202   2e-56   
ref|XP_002183027.1|  predicted protein                                  202   2e-56   
gb|EPT24601.1|  cytosolic tRNA-Ala synthetase                           204   2e-56   
ref|XP_007362527.1|  hypothetical protein DICSQDRAFT_51965              202   2e-56   
gb|ESS28921.1|  cytosolic tRNA-Ala synthetase                           204   2e-56   
gb|EPR63933.1|  cytosolic tRNA-Ala synthetase                           204   2e-56   
gb|EYE95897.1|  alanyl-tRNA synthetase, cytoplasmic                     202   2e-56   
ref|XP_008889427.1|  cytosolic tRNA-Ala synthetase                      204   2e-56   
gb|KIM45032.1|  hypothetical protein M413DRAFT_441675                   202   2e-56   
emb|CAX69310.1|  Alanyl-tRNA synthetase                                 192   2e-56   
gb|KFX85693.1|  hypothetical protein V490_09480                         202   2e-56   
ref|XP_001950431.1|  PREDICTED: alanine--tRNA ligase, cytoplasmic       202   2e-56   
gb|KEF59530.1|  alanyl-tRNA synthetase                                  202   2e-56   
gb|EUB62782.1|  Alanyl-tRNA synthetase, cytoplasmic                     202   2e-56   
ref|XP_007763572.1|  hypothetical protein CONPUDRAFT_115791             202   2e-56   
emb|CDI99859.1|  alanyl tRNA synthetase, cytoplasmic                    202   2e-56   
ref|XP_009021139.1|  hypothetical protein HELRODRAFT_100946             202   3e-56   
ref|XP_003885707.1|  hypothetical protein NCLIV_061050                  202   3e-56   
ref|XP_009033626.1|  hypothetical protein AURANDRAFT_52432              202   3e-56   
emb|CBN75498.1|  Alanyl-tRNA Synthetase                                 203   3e-56   
gb|KFB53790.1|  AGAP009701-PA-like protein                              202   3e-56   
ref|XP_679250.1|  alanine--tRNA ligase                                  202   3e-56   
emb|CDR14283.1|  alanine--tRNA ligase, putative                         203   4e-56   
gb|KFA63023.1|  hypothetical protein S40285_07244                       202   4e-56   
ref|XP_731046.1|  alanyl-tRNA synthetase                                203   4e-56   
gb|ETB61123.1|  alanine-tRNA ligase                                     203   4e-56   
gb|KGO65716.1|  Translation elongation/initiation factor/Ribosoma...    201   4e-56   
gb|EUD73548.1|  alanyl-tRNA synthetase                                  203   4e-56   
gb|KJA29067.1|  hypothetical protein HYPSUDRAFT_61899                   201   5e-56   
gb|EQL37596.1|  alanyl-tRNA synthetase                                  202   5e-56   
ref|XP_007813739.1|  alanyl-tRNA synthetase                             201   6e-56   
gb|ERT02170.1|  alanine-tRNA ligase                                     201   6e-56   
gb|KIH88462.1|  alanyl-tRNA synthetase                                  201   6e-56   
ref|XP_008624155.1|  alanyl-tRNA synthetase                             202   6e-56   
ref|XP_007816858.1|  alanyl-tRNA synthetase                             201   6e-56   
gb|EGE78320.1|  alanyl-tRNA synthetase                                  202   6e-56   
emb|CDS48859.1|  alanine--tRNA ligase, putative                         202   6e-56   
gb|KID97622.1|  alanyl-tRNA synthetase                                  201   6e-56   
gb|KFG77953.1|  alanyl-tRNA synthetase                                  201   7e-56   
gb|EPS26059.1|  hypothetical protein PDE_00995                          201   7e-56   
ref|XP_004533955.1|  PREDICTED: alanine--tRNA ligase, cytoplasmic...    201   7e-56   
gb|KFA78470.1|  hypothetical protein S40288_06921                       201   7e-56   
gb|KHN96797.1|  alanyl-tRNA synthetase                                  201   7e-56   
gb|KID89744.1|  alanyl-tRNA synthetase                                  201   8e-56   
gb|KEY66517.1|  hypothetical protein S7711_04843                        201   8e-56   
gb|KFA51056.1|  hypothetical protein S40293_08227                       201   8e-56   
gb|KGG52105.1|  hypothetical protein DI09_20p220                        201   8e-56   
emb|CCA14233.1|  unnamed protein product                                201   9e-56   
ref|XP_003304705.1|  hypothetical protein PTT_17354                     201   9e-56   
gb|KEQ82195.1|  alanyl-tRNA synthetase                                  200   9e-56   
gb|KFY78954.1|  hypothetical protein V499_01993                         200   1e-55   
ref|XP_001937987.1|  alanyl-tRNA synthetase                             200   1e-55   
gb|ELQ36554.1|  alanyl-tRNA synthetase                                  200   1e-55   
gb|KFZ01012.1|  hypothetical protein V501_10282                         200   1e-55   
gb|EMT07345.1|  Alanyl-tRNA synthetase, mitochondrial                   200   1e-55   
ref|XP_002290312.1|  alanine-trna ligase                                200   1e-55   
gb|ELR05884.1|  alanyl-tRNA synthetase                                  200   2e-55   
gb|KDR10980.1|  Alanyl-tRNA synthetase, cytoplasmic                     200   2e-55   
ref|XP_008023565.1|  hypothetical protein SETTUDRAFT_128760             199   2e-55   
ref|XP_007006963.1|  hypothetical protein TREMEDRAFT_34057              199   2e-55   



>ref|XP_008461868.1| PREDICTED: alanine--tRNA ligase-like [Cucumis melo]
Length=364

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  411
            G+EWP+ +VRDTF +FFE K H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT
Sbjct  82   GVEWPAERVRDTFFRFFEEKNHVYWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  141

Query  412  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWEL  591
             LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWEL
Sbjct  142  SLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAITWAWEL  201

Query  592  LTEVYKLPAIR  624
            LT+VYKLP  R
Sbjct  202  LTQVYKLPTDR  212



>gb|EPS72880.1| hypothetical protein M569_01869, partial [Genlisea aurea]
Length=950

 Score =   251 bits (642),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP+++VRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT DPNTEL
Sbjct  10   EWPANRVRDTFIKFFEGKGHVDWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTADPNTEL  69

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKLKRAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  70   SKLKRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELLT  129

Query  598  EVYKLPAIR  624
            EVYKLP+ R
Sbjct  130  EVYKLPSDR  138



>ref|XP_011084638.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase [Sesamum 
indicum]
Length=1012

 Score =   251 bits (641),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP+++VR+TFIKFF+ KAH   KSSPVVP NDPTLLFANAGMNQFKPIFLGT DPNTEL
Sbjct  84   EWPATRVRETFIKFFQDKAHVNWKSSPVVPYNDPTLLFANAGMNQFKPIFLGTADPNTEL  143

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKL+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAIQWAWELLT
Sbjct  144  SKLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIQWAWELLT  203

Query  598  EVYKLPAIR  624
            EVYKLP+ R
Sbjct  204  EVYKLPSDR  212



>ref|XP_009351710.1| PREDICTED: alanine--tRNA ligase [Pyrus x bretschneideri]
Length=952

 Score =   248 bits (634),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E  GLEWP+ +VRDTF+KFFE KAH   KSSPVVP NDPTLLFANAGMNQFKPIFLGT D
Sbjct  5    ESQGLEWPAKRVRDTFVKFFEEKAHVFWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTAD  64

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PNT+LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  65   PNTQLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIGWA  124

Query  583  WELLTEVYKLPAIR  624
            WELLT+VYKLP  R
Sbjct  125  WELLTKVYKLPEDR  138



>ref|XP_003607217.1| Alanyl-tRNA synthetase [Medicago truncatula]
 gb|AES89414.1| alanine-tRNA ligase [Medicago truncatula]
Length=950

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+++VRDTF+KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGTVDPNT 
Sbjct  9    IEWPANRVRDTFVKFFEEKNHVYWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTVDPNTA  68

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  69   LSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAISWAWELL  128

Query  595  TEVYKLPAIR  624
            T+VYKLP+ R
Sbjct  129  TKVYKLPSDR  138



>ref|XP_011022066.1| PREDICTED: alanine--tRNA ligase [Populus euphratica]
Length=1008

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            ++WP+++VRDTFIKFFE K H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGT DPNT 
Sbjct  62   VDWPANRVRDTFIKFFEEKKHVDWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTADPNTA  121

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  122  LSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  181

Query  595  TEVYKLPAIR  624
            T+VYKLPA R
Sbjct  182  TKVYKLPADR  191



>ref|XP_003619276.1| Alanyl-tRNA synthetase, partial [Medicago truncatula]
Length=900

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+++VRDTF+KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGTVDPNT 
Sbjct  9    IEWPANRVRDTFVKFFEEKNHVYWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTVDPNTA  68

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  69   LSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAISWAWELL  128

Query  595  TEVYKLPAIR  624
            T+VYKLP+ R
Sbjct  129  TKVYKLPSDR  138



>ref|XP_008340455.1| PREDICTED: alanine--tRNA ligase [Malus domestica]
Length=1015

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E  GLEWP+ +VRDTF+KFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT D
Sbjct  68   ESQGLEWPAKRVRDTFVKFFEEKGHVFWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTAD  127

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PNT+LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  128  PNTQLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIGWA  187

Query  583  WELLTEVYKLPAIR  624
            WELLT+VYKLP  R
Sbjct  188  WELLTKVYKLPEDR  201



>ref|XP_002277341.1| PREDICTED: alanine--tRNA ligase [Vitis vinifera]
Length=1002

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP++KVRDTFI FFESK H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGT DPNT 
Sbjct  56   VEWPANKVRDTFINFFESKNHVDWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTADPNTA  115

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  175

Query  595  TEVYKLPAIR  624
            T+VYKLP  R
Sbjct  176  TKVYKLPTDR  185



>gb|KDO52982.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=995

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  595  TEVYKLPAIR  624
            T+VY+LPA R
Sbjct  176  TKVYRLPADR  185



>ref|XP_006437524.1| hypothetical protein CICLE_v10030624mg [Citrus clementina]
 gb|ESR50764.1| hypothetical protein CICLE_v10030624mg [Citrus clementina]
Length=1001

 Score =   246 bits (629),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  595  TEVYKLPAIR  624
            T+VY+LPA R
Sbjct  176  TKVYRLPADR  185



>ref|XP_002307181.2| alanyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|EEE94177.2| alanyl-tRNA synthetase family protein [Populus trichocarpa]
Length=967

 Score =   246 bits (628),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            ++WP+++VRDTFIKFFE K H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGT DPNT 
Sbjct  12   VDWPANRVRDTFIKFFEEKNHVDWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTADPNTA  71

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  72   LSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  131

Query  595  TEVYKLPAIR  624
            T+VYKLPA R
Sbjct  132  TKVYKLPADR  141



>gb|KDO52980.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=1002

 Score =   246 bits (629),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  595  TEVYKLPAIR  624
            T+VY+LPA R
Sbjct  176  TKVYRLPADR  185



>gb|KDO52985.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=936

 Score =   246 bits (628),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  595  TEVYKLPAIR  624
            T+VY+LPA R
Sbjct  176  TKVYRLPADR  185



>gb|KDO52986.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=844

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  595  TEVYKLPAIR  624
            T+VY+LPA R
Sbjct  176  TKVYRLPADR  185



>gb|KDO52987.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=787

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  595  TEVYKLPAIR  624
            T+VY+LPA R
Sbjct  176  TKVYRLPADR  185



>gb|KDO52981.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=972

 Score =   246 bits (628),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  595  TEVYKLPAIR  624
            T+VY+LPA R
Sbjct  176  TKVYRLPADR  185



>gb|KDO52984.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=957

 Score =   246 bits (627),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  595  TEVYKLPAIR  624
            T+VY+LPA R
Sbjct  176  TKVYRLPADR  185



>gb|KDO52983.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=1009

 Score =   246 bits (628),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  595  TEVYKLPAIR  624
            T+VY+LPA R
Sbjct  176  TKVYRLPADR  185



>ref|XP_010273668.1| PREDICTED: alanine--tRNA ligase [Nelumbo nucifera]
Length=1038

 Score =   246 bits (627),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+S+VRDTF+ FFE K H    SSPVVP+NDPTLLFANAGMNQFKPIFLGTVDPNT 
Sbjct  89   VEWPASRVRDTFLSFFEGKGHVNWNSSPVVPLNDPTLLFANAGMNQFKPIFLGTVDPNTS  148

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  149  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKREAIGWAWELL  208

Query  595  TEVYKLPAIR  624
            T+VYKLPA R
Sbjct  209  TQVYKLPADR  218



>ref|XP_002531134.1| alanyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF31254.1| alanyl-tRNA synthetase, putative [Ricinus communis]
Length=1025

 Score =   245 bits (626),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+ KVRDTFI FFE K H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGT DPNT 
Sbjct  79   MEWPAKKVRDTFISFFEDKKHVHWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTADPNTA  138

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  139  LSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKREAIGWAWELL  198

Query  595  TEVYKLPAIR  624
            T++YKLPA R
Sbjct  199  TKIYKLPADR  208



>ref|XP_009601820.1| PREDICTED: alanine--tRNA ligase {ECO:0000255|HAMAP-Rule:MF_03133} 
[Nicotiana tomentosiformis]
Length=1027

 Score =   245 bits (626),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            + A LEWP++KVR TFI FF+ K H  V+SSPVVP NDPTLLFANAGMNQFKPIFLG VD
Sbjct  77   QSAELEWPANKVRQTFINFFQGKGHEQVESSPVVPHNDPTLLFANAGMNQFKPIFLGIVD  136

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PN+ LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  137  PNSPLSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWA  196

Query  583  WELLTEVYKLPAIR  624
            WELLT+VY+LP  R
Sbjct  197  WELLTQVYRLPGDR  210



>ref|XP_008221037.1| PREDICTED: alanine--tRNA ligase [Prunus mume]
Length=1025

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E  G+EWP+ +VRDTF++FFE K+H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT D
Sbjct  78   ESMGVEWPAKRVRDTFMRFFEEKSHVYWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTAD  137

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PNT+LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  138  PNTQLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIGWA  197

Query  583  WELLTEVYKLPAIR  624
            WELLT+VYKLP  R
Sbjct  198  WELLTQVYKLPEDR  211



>ref|XP_004148575.1| PREDICTED: alanine--tRNA ligase-like [Cucumis sativus]
Length=956

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  411
            G+EWP+ ++RDTF +FFE K H    SSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT
Sbjct  8    GVEWPADRIRDTFFRFFEEKNHVYWNSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  67

Query  412  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWEL  591
             LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWEL
Sbjct  68   SLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAITWAWEL  127

Query  592  LTEVYKLPAIR  624
            LT+VYKLP  R
Sbjct  128  LTQVYKLPKDR  138



>ref|XP_004163302.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase-like [Cucumis 
sativus]
Length=956

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  411
            G+EWP+ ++RDTF +FFE K H    SSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT
Sbjct  8    GVEWPADRIRDTFFRFFEEKNHVYWNSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  67

Query  412  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWEL  591
             LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWEL
Sbjct  68   SLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAITWAWEL  127

Query  592  LTEVYKLPAIR  624
            LT+VYKLP  R
Sbjct  128  LTQVYKLPKDR  138



>ref|XP_009802310.1| PREDICTED: alanine--tRNA ligase [Nicotiana sylvestris]
Length=1014

 Score =   244 bits (623),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            LEWP++KVR TFI FF+ K H  V+SSPVVP NDPTLLFANAGMNQFKPIFLG VDPN+ 
Sbjct  81   LEWPANKVRQTFINFFQGKGHEQVESSPVVPHNDPTLLFANAGMNQFKPIFLGIVDPNSP  140

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  141  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  200

Query  595  TEVYKLPAIR  624
            T+VY+LP  R
Sbjct  201  TQVYRLPGDR  210



>emb|CDP04914.1| unnamed protein product [Coffea canephora]
Length=129

 Score =   224 bits (572),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            ++WP+S+VR+TF+ FFE K H   KSSPVVP+NDPTLLFANAGMNQFKPIFLGTVDPNT 
Sbjct  1    MDWPASRVRETFVNFFEGKGHFNWKSSPVVPLNDPTLLFANAGMNQFKPIFLGTVDPNTP  60

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAIQWAWELL
Sbjct  61   LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKGEAIQWAWELL  120

Query  595  TEV  603
             + 
Sbjct  121  IKA  123



>gb|KGN58521.1| hypothetical protein Csa_3G656490 [Cucumis sativus]
Length=1030

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  411
            G+EWP+ ++RDTF +FFE K H    SSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT
Sbjct  82   GVEWPADRIRDTFFRFFEEKNHVYWNSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  141

Query  412  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWEL  591
             LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWEL
Sbjct  142  SLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAITWAWEL  201

Query  592  LTEVYKLPAIR  624
            LT+VYKLP  R
Sbjct  202  LTQVYKLPKDR  212



>gb|KDP43289.1| hypothetical protein JCGZ_24210 [Jatropha curcas]
Length=1019

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+ KVRDTFI FFE K H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGT DPNT 
Sbjct  73   VEWPAKKVRDTFISFFEDKNHVHWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTADPNTA  132

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  133  LSKLIRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  192

Query  595  TEVYKLPAIR  624
            T+VYKLP  R
Sbjct  193  TKVYKLPTDR  202



>ref|XP_010662077.1| PREDICTED: alanine--tRNA ligase-like [Vitis vinifera]
Length=955

 Score =   243 bits (619),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP++KVRDTFI FFE+K H    SSPVVP+NDPTLLFANAGMNQFKPIFLGT DPNT L
Sbjct  10   EWPAAKVRDTFISFFEAKEHVNWVSSPVVPLNDPTLLFANAGMNQFKPIFLGTADPNTPL  69

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  70   SKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKREAIEWAWELLT  129

Query  598  EVYKLPAIR  624
            EVYKLP  R
Sbjct  130  EVYKLPTDR  138



>ref|XP_004505726.1| PREDICTED: alanine--tRNA ligase-like [Cicer arietinum]
Length=990

 Score =   243 bits (619),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP+ +VRDT+IKFF+ K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT DPNT L
Sbjct  50   DWPAKRVRDTYIKFFQEKNHVNWKSSPVVPFNDPTLLFANAGMNQFKPIFLGTADPNTSL  109

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELLT
Sbjct  110  SKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKVEAISWAWELLT  169

Query  598  EVYKLPAIR  624
            EVYKLP+ R
Sbjct  170  EVYKLPSDR  178



>ref|XP_003607220.1| Alanyl-tRNA synthetase [Medicago truncatula]
Length=635

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E   +EWP+ +VRDTF KFFE K H   KSS VVP+NDPTLLFANAGMNQFKPIFLGTVD
Sbjct  5    ESIDIEWPAKRVRDTFAKFFEEKNHVHWKSSAVVPLNDPTLLFANAGMNQFKPIFLGTVD  64

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PNT LSKL RAC+ QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  65   PNTALSKLTRACNIQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAISWA  124

Query  583  WELLTEVYKLPAIR  624
            WELLTEVY LP+ R
Sbjct  125  WELLTEVYNLPSDR  138



>gb|AES89417.2| alanyl-tRNA synthetase [Medicago truncatula]
Length=635

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E   +EWP+ +VRDTF KFFE K H   KSS VVP+NDPTLLFANAGMNQFKPIFLGTVD
Sbjct  5    ESIDIEWPAKRVRDTFAKFFEEKNHVHWKSSAVVPLNDPTLLFANAGMNQFKPIFLGTVD  64

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PNT LSKL RAC+ QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  65   PNTALSKLTRACNIQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAISWA  124

Query  583  WELLTEVYKLPAIR  624
            WELLTEVY LP+ R
Sbjct  125  WELLTEVYNLPSDR  138



>ref|XP_010683781.1| PREDICTED: alanine--tRNA ligase [Beta vulgaris subsp. vulgaris]
Length=1007

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            ++W ++KVRDTFIKFFE K+HT  KSSPVVP NDPTLLFANAGMNQ+KPIFLGT+DPN+ 
Sbjct  61   VDWSATKVRDTFIKFFEGKSHTFWKSSPVVPHNDPTLLFANAGMNQYKPIFLGTIDPNSP  120

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LS +KRAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  121  LSVMKRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  180

Query  595  TEVYKLPAIR  624
            T+VYKLPA R
Sbjct  181  TKVYKLPADR  190



>ref|XP_006484669.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Citrus sinensis]
Length=1002

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRAFNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  595  TEVYKLPAIR  624
            T+VY+LPA R
Sbjct  176  TKVYRLPADR  185



>ref|XP_007043323.1| Alanyl-tRNA synthetase, putative [Theobroma cacao]
 gb|EOX99154.1| Alanyl-tRNA synthetase, putative [Theobroma cacao]
Length=1015

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+ KVRDTF KFFE K H   KSSPVVP+NDPTLLFANAGMNQFKPIFLGTVDPNT 
Sbjct  65   MEWPAKKVRDTFFKFFEGKNHVNWKSSPVVPLNDPTLLFANAGMNQFKPIFLGTVDPNTA  124

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK +AI+WAWELL
Sbjct  125  MSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKDAIEWAWELL  184

Query  595  TEVYKLPAIR  624
            T+VY LP  R
Sbjct  185  TKVYGLPTER  194



>ref|XP_006347609.1| PREDICTED: alanine--tRNA ligase-like [Solanum tuberosum]
Length=1009

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            L+WP++KVR+TFI FF+ K H  V+SSPVVP NDPTLLFANAGMNQFKPIFLG VDPN+ 
Sbjct  63   LDWPANKVRETFISFFQGKDHKEVQSSPVVPHNDPTLLFANAGMNQFKPIFLGIVDPNSP  122

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  123  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIGWAWELL  182

Query  595  TEVYKLPAIR  624
            T+VY+LP+ R
Sbjct  183  TQVYRLPSER  192



>ref|XP_004235270.1| PREDICTED: alanine--tRNA ligase [Solanum lycopersicum]
Length=1010

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            L+WP++KVR TFI FF+ K H  V+SSPVVP NDPTLLFANAGMNQFKPIFLG VDPN+ 
Sbjct  64   LDWPANKVRQTFISFFQGKDHKEVQSSPVVPHNDPTLLFANAGMNQFKPIFLGIVDPNSP  123

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  124  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIGWAWELL  183

Query  595  TEVYKLPAIR  624
            T+VYKLP+ R
Sbjct  184  TQVYKLPSER  193



>ref|XP_006484668.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Citrus sinensis]
Length=1009

 Score =   241 bits (615),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRAFNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  595  TEVYKLPAIR  624
            T+VY+LPA R
Sbjct  176  TKVYRLPADR  185



>ref|XP_003537781.2| PREDICTED: alanine--tRNA ligase-like isoform X1 [Glycine max]
Length=999

 Score =   241 bits (615),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E   +EWP+ +VRDTFI FF+ K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT D
Sbjct  54   ETHDVEWPAKRVRDTFISFFQDKNHVNWKSSPVVPFNDPTLLFANAGMNQFKPIFLGTAD  113

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PNT LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  114  PNTALSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKVEAISWA  173

Query  583  WELLTEVYKLPAIR  624
            WELLT+VYKLP+ R
Sbjct  174  WELLTKVYKLPSDR  187



>ref|XP_010523577.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010523578.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010523579.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Tarenaya hassleriana]
Length=1003

 Score =   241 bits (615),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E + ++WP+ +VRDTFIKFFE K H   KSSPVVP +DPTLLFANAGMNQFKPIFLGTVD
Sbjct  56   ESSEIQWPARRVRDTFIKFFEGKGHVNWKSSPVVPHSDPTLLFANAGMNQFKPIFLGTVD  115

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PNT LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  116  PNTALSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKQEAIEWA  175

Query  583  WELLTEVYKLPAIR  624
            WELLT+VY LP  R
Sbjct  176  WELLTKVYGLPTDR  189



>emb|CBI27126.3| unnamed protein product [Vitis vinifera]
Length=1026

 Score =   240 bits (613),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 119/134 (89%), Gaps = 4/134 (3%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP++KVRDTFI FFESK H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGT DPNT 
Sbjct  9    VEWPANKVRDTFINFFESKNHVDWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTADPNTA  68

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  69   LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  128

Query  595  TE----VYKLPAIR  624
            T+    VYKLP  R
Sbjct  129  TKAKNLVYKLPTDR  142



>gb|KJB50036.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=1010

 Score =   240 bits (612),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK +AI+WAWELL
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKKDAIEWAWELL  179

Query  595  TEVYKLPAIR  624
            T+VY LP  R
Sbjct  180  TKVYSLPTDR  189



>gb|KJB50037.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=1070

 Score =   240 bits (613),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK +AI+WAWELL
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKKDAIEWAWELL  179

Query  595  TEVYKLPAIR  624
            T+VY LP  R
Sbjct  180  TKVYSLPTDR  189



>gb|KJB50034.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=927

 Score =   239 bits (611),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK +AI+WAWELL
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKKDAIEWAWELL  179

Query  595  TEVYKLPAIR  624
            T+VY LP  R
Sbjct  180  TKVYSLPTDR  189



>gb|KJB50041.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=997

 Score =   240 bits (612),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK +AI+WAWELL
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKKDAIEWAWELL  179

Query  595  TEVYKLPAIR  624
            T+VY LP  R
Sbjct  180  TKVYSLPTDR  189



>gb|KJB50035.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=930

 Score =   239 bits (611),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK +AI+WAWELL
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKKDAIEWAWELL  179

Query  595  TEVYKLPAIR  624
            T+VY LP  R
Sbjct  180  TKVYSLPTDR  189



>gb|KJB50038.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
 gb|KJB50040.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=941

 Score =   239 bits (611),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK +AI+WAWELL
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKKDAIEWAWELL  179

Query  595  TEVYKLPAIR  624
            T+VY LP  R
Sbjct  180  TKVYSLPTDR  189



>gb|KJB50039.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=1001

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK +AI+WAWELL
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKKDAIEWAWELL  179

Query  595  TEVYKLPAIR  624
            T+VY LP  R
Sbjct  180  TKVYSLPTDR  189



>gb|KJB31825.1| hypothetical protein B456_005G210000 [Gossypium raimondii]
Length=1015

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  411
             +EWP+ KVRDTFIKFFE K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGTVDPNT
Sbjct  64   AVEWPAKKVRDTFIKFFEGKNHVYWNSSPVVPHNDPTLLFANAGMNQYKPIFLGTVDPNT  123

Query  412  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWEL  591
             +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWEL
Sbjct  124  AMSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWEL  183

Query  592  LTEVYKLPAIR  624
            LT+VY LP  R
Sbjct  184  LTKVYGLPTDR  194



>gb|KJB31826.1| hypothetical protein B456_005G210000 [Gossypium raimondii]
Length=974

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  232  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  411
             +EWP+ KVRDTFIKFFE K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGTVDPNT
Sbjct  64   AVEWPAKKVRDTFIKFFEGKNHVYWNSSPVVPHNDPTLLFANAGMNQYKPIFLGTVDPNT  123

Query  412  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWEL  591
             +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWEL
Sbjct  124  AMSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWEL  183

Query  592  LTEVYKLPAIR  624
            LT+VY LP  R
Sbjct  184  LTKVYGLPTDR  194



>ref|XP_004297751.1| PREDICTED: alanine--tRNA ligase [Fragaria vesca subsp. vesca]
Length=1002

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = +1

Query  133  VPPLDTLLRRRHFspspstsipsvvsqqqqEMAGLEWPSSKVRDTFIKFFESKAHTCVKS  312
            +PP   L R R  S   +TS    +   + +  G+EWP+++VRDTF  +F  K H   KS
Sbjct  25   LPPPSHLTRNRSLSAIATTSFHPKMPGLESQAVGVEWPANRVRDTFFSYFMEKEHKNYKS  84

Query  313  SPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSKLKRACDTQKCIRAGGKHNDLDDV  492
            SPVVP NDPTLLFANAGMNQFKPIFLGT DPNT+LSKL RAC+TQKCIRAGGKHNDL+DV
Sbjct  85   SPVVPHNDPTLLFANAGMNQFKPIFLGTADPNTDLSKLTRACNTQKCIRAGGKHNDLEDV  144

Query  493  GKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTEVYKLPAIR  624
            GKDTYHHTFFEMLGNWSFGDYFK+EAI+WAW LLT+VYKLP  R
Sbjct  145  GKDTYHHTFFEMLGNWSFGDYFKSEAIEWAWVLLTQVYKLPEDR  188



>ref|XP_007131657.1| hypothetical protein PHAVU_011G031100g [Phaseolus vulgaris]
 gb|ESW03651.1| hypothetical protein PHAVU_011G031100g [Phaseolus vulgaris]
Length=996

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E + +EWP+ +VRDTF+ FFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT D
Sbjct  51   ETSDVEWPAKRVRDTFMSFFEGKNHVNWKSSPVVPFNDPTLLFANAGMNQFKPIFLGTAD  110

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PNT LSKL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  111  PNTGLSKLSRAYNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKPEAISWA  170

Query  583  WELLTEVYKLPAIR  624
            WELLTEVYKLP+ R
Sbjct  171  WELLTEVYKLPSDR  184



>ref|XP_010031895.1| PREDICTED: alanine--tRNA ligase [Eucalyptus grandis]
 gb|KCW51291.1| hypothetical protein EUGRSUZ_J00856 [Eucalyptus grandis]
Length=1046

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP+S+VRDTFIKFFE K H    SSPVVPVNDPTLLFANAGMNQ+KPIFLGTVDP+  L
Sbjct  101  KWPASRVRDTFIKFFEGKRHVNWPSSPVVPVNDPTLLFANAGMNQYKPIFLGTVDPSNPL  160

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             KL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  161  GKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELLT  220

Query  598  EVYKLPAIR  624
            EVYKLP  R
Sbjct  221  EVYKLPKDR  229



>emb|CDP16859.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   222 bits (566),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP+S+VR+TF  FFE K H   KSS VVP+NDPTLLF NAGMNQFKPIFLGTVDPNT L
Sbjct  81   DWPASRVRETFFNFFEGKNHVNWKSSAVVPLNDPTLLFVNAGMNQFKPIFLGTVDPNTPL  140

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAI+WAWELLT
Sbjct  141  SKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIEWAWELLT  200

Query  598  EV  603
            + 
Sbjct  201  KA  202



>ref|XP_008778009.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778010.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778012.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778013.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778014.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
Length=991

 Score =   238 bits (606),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  229  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  408
            A +EWP+SKVR+TFI+FFE K H   +SSPVVP++DPTLLFANAGMNQFKPIFLGTV+P 
Sbjct  45   AAMEWPASKVRETFIRFFEGKGHVNWRSSPVVPLDDPTLLFANAGMNQFKPIFLGTVNPA  104

Query  409  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  588
              L KL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWE
Sbjct  105  NPLGKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKREAISWAWE  164

Query  589  LLTEVYKLPAIR  624
            LLT+VYKLP  R
Sbjct  165  LLTKVYKLPTDR  176



>gb|AAK70626.1|AC091238_4 Putative cytosolic tRNA-Ala synthetase [Oryza sativa Japonica 
Group]
Length=351

 Score =   226 bits (575),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  229  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  408
            A  EWP+S+VR+TFI FFESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+
Sbjct  3    ASTEWPASRVRETFISFFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPD  62

Query  409  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  588
              L +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI +AWE
Sbjct  63   APLGRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGFAWE  122

Query  589  LLTEVYKLPAIR  624
            LLT+VYKLP  R
Sbjct  123  LLTQVYKLPTDR  134



>ref|XP_010541854.1| PREDICTED: alanine--tRNA ligase-like [Tarenaya hassleriana]
Length=1003

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP+ +VRDTFI+FF+ K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT DPNT L
Sbjct  61   QWPARRVRDTFIEFFQGKGHVDWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTADPNTAL  120

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  121  SKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELLT  180

Query  598  EVYKLPAIR  624
            +VY LP  R
Sbjct  181  KVYGLPTDR  189



>ref|XP_009386816.1| PREDICTED: alanine--tRNA ligase {ECO:0000255|HAMAP-Rule:MF_03133} 
[Musa acuminata subsp. malaccensis]
Length=990

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E   +EWP++KVR+TFI+FFE K H   +SSPVVP++DPTLLFANAGMNQFKPIFLGTV+
Sbjct  41   EATPVEWPATKVRETFIRFFEGKEHVDWRSSPVVPLDDPTLLFANAGMNQFKPIFLGTVN  100

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            P T L +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  101  PTTPLGRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKAEAITWA  160

Query  583  WELLTEVYKLPAIR  624
            WELLTEVY+LP  R
Sbjct  161  WELLTEVYELPKDR  174



>emb|CBI26461.3| unnamed protein product [Vitis vinifera]
Length=960

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 117/134 (87%), Gaps = 5/134 (4%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP++KVRDTFI FFE+K H    SSPVVP+NDPTLLFANAGMNQFKPIFLGT DPNT L
Sbjct  10   EWPAAKVRDTFISFFEAKEHVNWVSSPVVPLNDPTLLFANAGMNQFKPIFLGTADPNTPL  69

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  70   SKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKREAIEWAWELLT  129

Query  598  E-----VYKLPAIR  624
            E     VYKLP  R
Sbjct  130  EAICNKVYKLPTDR  143



>ref|XP_006826671.1| hypothetical protein AMTR_s00137p00047050 [Amborella trichopoda]
 gb|ERM93908.1| hypothetical protein AMTR_s00137p00047050 [Amborella trichopoda]
Length=996

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +1

Query  229  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  408
            A ++WP+++VR+TFI FFE K H   KSSPVVPV+DPTLLFANAGMNQFKPIFLGTV P 
Sbjct  49   AAMDWPANRVRETFITFFEQKGHVNWKSSPVVPVDDPTLLFANAGMNQFKPIFLGTVHPG  108

Query  409  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  588
            T L KLKR C+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWE
Sbjct  109  TPLGKLKRVCNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIGWAWE  168

Query  589  LLTEVYKLPAIR  624
            LLT+VYKLP  R
Sbjct  169  LLTQVYKLPTDR  180



>emb|CDY45055.1| BnaA08g02200D [Brassica napus]
Length=993

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +1

Query  160  RRHFspspstsipsvvsqqqqEMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDP  339
            RRHF      S  SV      E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDP
Sbjct  26   RRHFLSHFRFSSSSVAVMPGSEPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDP  85

Query  340  TLLFANAGMNQFKPIFLGTVDPNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTF  519
            TLLFANAGMNQ+KPIFLGT DPNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTF
Sbjct  86   TLLFANAGMNQYKPIFLGTADPNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTF  145

Query  520  FEMLGNWSFGDYFKTEAIQWAWELLTEVYKLPAIR  624
            FEMLGNWSFGDYFK EAI+WAWELLT+VY LP  R
Sbjct  146  FEMLGNWSFGDYFKKEAIEWAWELLTKVYGLPTDR  180



>ref|XP_009107233.1| PREDICTED: alanine--tRNA ligase [Brassica rapa]
Length=997

 Score =   235 bits (600),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +1

Query  160  RRHFspspstsipsvvsqqqqEMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDP  339
            RRHF      S  SV      E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDP
Sbjct  26   RRHFLSHFRFSSSSVAVMPGSEPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDP  85

Query  340  TLLFANAGMNQFKPIFLGTVDPNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTF  519
            TLLFANAGMNQ+KPIFLGT DPNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTF
Sbjct  86   TLLFANAGMNQYKPIFLGTADPNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTF  145

Query  520  FEMLGNWSFGDYFKTEAIQWAWELLTEVYKLPAIR  624
            FEMLGNWSFGDYFK EAI+WAWELLT+VY LP  R
Sbjct  146  FEMLGNWSFGDYFKKEAIEWAWELLTKVYGLPTDR  180



>gb|KHN32273.1| Alanine--tRNA ligase, partial [Glycine soja]
Length=919

 Score =   234 bits (597),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +1

Query  244  PSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSK  423
            P+ +VRDTFI FF+ K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT DPNT LSK
Sbjct  1    PAKRVRDTFISFFQDKNHVNWKSSPVVPFNDPTLLFANAGMNQFKPIFLGTADPNTALSK  60

Query  424  LKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTEV  603
            L RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELLT+V
Sbjct  61   LSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKVEAISWAWELLTKV  120

Query  604  YKLPAIR  624
            YKLP+ R
Sbjct  121  YKLPSDR  127



>ref|XP_010904628.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase-like [Elaeis 
guineensis]
Length=995

 Score =   234 bits (598),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +1

Query  229  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  408
            A +EWP SKVR+TFI FFE K H   +SSPVVP++DPTLLFANAGMNQFKPIFLGTV+P 
Sbjct  49   ATMEWPGSKVRETFISFFEGKEHVNWRSSPVVPLDDPTLLFANAGMNQFKPIFLGTVNPA  108

Query  409  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  588
              L KL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EA+ WAWE
Sbjct  109  NPLGKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKREAVSWAWE  168

Query  589  LLTEVYKLPAIR  624
            LLT+VYKLP  R
Sbjct  169  LLTQVYKLPTDR  180



>gb|KDD75735.1| class II (A) tRNA synthetase, partial [Helicosporidium sp. ATCC 
50920]
Length=721

 Score =   231 bits (590),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  405
            M+  EWP+++VR TF+ FF SK HT V SS VVP+NDPTLLF NAGMNQFKP+FLGT DP
Sbjct  1    MSAAEWPAARVRSTFLDFFRSKEHTIVPSSAVVPLNDPTLLFTNAGMNQFKPLFLGTADP  60

Query  406  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  585
             +++ KLKRA DTQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK EAI WAW
Sbjct  61   KSDMGKLKRAADTQKCIRAGGKHNDLDDVGKDNYHHTFFEMLGNWSFGDYFKEEAISWAW  120

Query  586  ELLTEVYKLPAIR  624
            ELLT+VYKLPA R
Sbjct  121  ELLTQVYKLPADR  133



>ref|XP_001773539.1| predicted protein [Physcomitrella patens]
 gb|EDQ61577.1| predicted protein [Physcomitrella patens]
Length=937

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            WP+++VR+TF  FFESK HT V SSPVVPV+DPTLLFANAGMNQFKPIFLGTVDP +   
Sbjct  7    WPANRVRETFNSFFESKNHTFVPSSPVVPVDDPTLLFANAGMNQFKPIFLGTVDPRSARG  66

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
             LKRAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELLT 
Sbjct  67   NLKRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIAWAWELLTS  126

Query  601  VYKLPAIR  624
            VYKLP  R
Sbjct  127  VYKLPKDR  134



>ref|XP_010927937.1| PREDICTED: alanine--tRNA ligase-like [Elaeis guineensis]
Length=995

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+SKVR+TF +FFE K H   +SSPVVP++DPTLLFANAGMNQFKPIFLGTV+P   
Sbjct  51   MEWPASKVRETFFRFFEGKEHVNWRSSPVVPLDDPTLLFANAGMNQFKPIFLGTVNPANP  110

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            L KL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  111  LGKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKREAISWAWELL  170

Query  595  TEVYKLPAIR  624
            T+VYKLP  R
Sbjct  171  TKVYKLPTDR  180



>gb|KHN05437.1| Alanine--tRNA ligase [Glycine soja]
Length=324

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E   +EWP+ +VRDTF  FF+ K H   KSSPVVP NDPTLLF N GMNQFKPIFLGT D
Sbjct  5    ETHDVEWPAKRVRDTFFIFFQDKNHVNWKSSPVVPFNDPTLLFVNPGMNQFKPIFLGTAD  64

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PNT LSKL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  65   PNTGLSKLSRAFNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKVEAISWA  124

Query  583  WELLTEVYKLPA  618
            W+LLT+VYKLP+
Sbjct  125  WDLLTKVYKLPS  136



>ref|XP_007225354.1| hypothetical protein PRUPE_ppa000923mg [Prunus persica]
 gb|EMJ26553.1| hypothetical protein PRUPE_ppa000923mg [Prunus persica]
Length=960

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E  G+EWP+ +VRDTF++FFE K+H   KSSPVVP NDPTLLFANAGMNQFKPIFLG  D
Sbjct  5    ESKGVEWPAKRVRDTFMRFFEEKSHVYWKSSPVVPHNDPTLLFANAGMNQFKPIFLGAAD  64

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PNT+LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  65   PNTQLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIGWA  124

Query  583  WELLTEVYKL  612
            WELLT+  + 
Sbjct  125  WELLTQASRF  134



>ref|XP_006305941.1| hypothetical protein CARUB_v10011180mg [Capsella rubella]
 gb|EOA38839.1| hypothetical protein CARUB_v10011180mg [Capsella rubella]
Length=1003

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E + ++WP+ +VRDT+  FF+ K+H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  53   EPSEIQWPAKRVRDTYFDFFKGKSHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  112

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAI WA
Sbjct  113  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIGWA  172

Query  583  WELLTEVYKLPAIR  624
            WELLT+VY LP  R
Sbjct  173  WELLTKVYGLPTDR  186



>ref|XP_008810668.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Phoenix dactylifera]
Length=993

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +1

Query  229  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  408
            A +EW  +KVR+TFI FFE K H   +SSPVVP++DPTLLFANAGMNQFKPIFLGTV+P 
Sbjct  47   AAMEWSGNKVRETFISFFERKEHVNWRSSPVVPLDDPTLLFANAGMNQFKPIFLGTVNPA  106

Query  409  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  588
              L KL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWE
Sbjct  107  NPLGKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKREAISWAWE  166

Query  589  LLTEVYKLPAIR  624
            LLT+VYKLPA R
Sbjct  167  LLTQVYKLPADR  178



>ref|XP_008810673.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Phoenix dactylifera]
Length=983

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +1

Query  229  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  408
            A +EW  +KVR+TFI FFE K H   +SSPVVP++DPTLLFANAGMNQFKPIFLGTV+P 
Sbjct  47   AAMEWSGNKVRETFISFFERKEHVNWRSSPVVPLDDPTLLFANAGMNQFKPIFLGTVNPA  106

Query  409  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  588
              L KL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWE
Sbjct  107  NPLGKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKREAISWAWE  166

Query  589  LLTEVYKLPAIR  624
            LLT+VYKLPA R
Sbjct  167  LLTQVYKLPADR  178



>emb|CAA80381.1| cytosolic tRNA-Ala synthetase [Arabidopsis thaliana]
Length=955

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP+ +VRDT++ FF  K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTEL
Sbjct  10   QWPAKRVRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTEL  69

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  70   SKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELLT  129

Query  598  EVYKLPAIR  624
            +VY LP  R
Sbjct  130  KVYGLPTDR  138



>gb|AAD50044.1|AC007980_9 cytosolic tRNA-Ala synthetase [Arabidopsis thaliana]
 gb|AAO00886.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP68246.1| At1g50200 [Arabidopsis thaliana]
Length=955

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP+ +VRDT++ FF  K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTEL
Sbjct  10   QWPAKRVRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTEL  69

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  70   SKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELLT  129

Query  598  EVYKLPAIR  624
            +VY LP  R
Sbjct  130  KVYGLPTDR  138



>ref|NP_001185186.1| Alanyl-tRNA synthetase [Arabidopsis thaliana]
 gb|AEE32525.1| Alanyl-tRNA synthetase [Arabidopsis thaliana]
Length=963

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP+ +VRDT++ FF  K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTEL
Sbjct  10   QWPAKRVRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTEL  69

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  70   SKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELLT  129

Query  598  EVYKLPAIR  624
            +VY LP  R
Sbjct  130  KVYGLPTDR  138



>ref|XP_002894237.1| cytosolic tRNA-Ala synthetase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70496.1| cytosolic tRNA-Ala synthetase [Arabidopsis lyrata subsp. lyrata]
Length=955

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP+ +VRDT++ FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTEL
Sbjct  10   QWPARRVRDTYVDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTEL  69

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  70   SKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELLT  129

Query  598  EVYKLPAIR  624
            +VY LP  R
Sbjct  130  KVYGLPTDR  138



>pir||S32671 alanine-tRNA ligase (EC 6.1.1.7) - Arabidopsis thaliana  (fragment)
Length=989

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP+ +VRDT++ FF  K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTEL
Sbjct  44   QWPAKRVRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTEL  103

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  104  SKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELLT  163

Query  598  EVYKLPAIR  624
            +VY LP  R
Sbjct  164  KVYGLPTDR  172



>ref|NP_175439.2| Alanyl-tRNA synthetase [Arabidopsis thaliana]
 sp|P36428.3|SYA_ARATH RecName: Full=Alanine--tRNA ligase; AltName: Full=Alanyl-tRNA 
synthetase; Short=AlaRS; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE32524.1| Alanyl-tRNA synthetase [Arabidopsis thaliana]
Length=1003

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP+ +VRDT++ FF  K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTEL
Sbjct  58   QWPAKRVRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTEL  117

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  118  SKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELLT  177

Query  598  EVYKLPAIR  624
            +VY LP  R
Sbjct  178  KVYGLPTDR  186



>emb|CAA80380.1| mitochondrial tRNA-Ala synthetase [Arabidopsis thaliana]
Length=1003

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP+ +VRDT++ FF  K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTEL
Sbjct  58   QWPAKRVRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTEL  117

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  118  SKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELLT  177

Query  598  EVYKLPAIR  624
            +VY LP  R
Sbjct  178  KVYGLPTDR  186



>gb|EEC66648.1| hypothetical protein OsI_32912 [Oryza sativa Indica Group]
Length=953

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  229  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  408
            A  EWP+S+VR+TFI FFESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+
Sbjct  3    ASTEWPASRVRETFISFFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPD  62

Query  409  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  588
              L +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI +AWE
Sbjct  63   APLGRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGFAWE  122

Query  589  LLTEVYKLPAIR  624
            LLT+VYKLP  R
Sbjct  123  LLTQVYKLPTDR  134



>emb|CBK21983.2| unnamed protein product [Blastocystis hominis]
Length=935

 Score =   231 bits (589),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            LEWPS+KVR TFI+FFE + HT VKSSPVVP++DPTLLFANAGMNQ+KPIFLG VDP++ 
Sbjct  7    LEWPSAKVRQTFIEFFEERGHTFVKSSPVVPLDDPTLLFANAGMNQYKPIFLGQVDPSSP  66

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            L+KLKRAC++QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK  AI +AWELL
Sbjct  67   LAKLKRACNSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKEGAINFAWELL  126

Query  595  TEVYKLPAIR  624
            T+VYKL   R
Sbjct  127  TKVYKLDPSR  136



>ref|XP_006393171.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
 gb|ESQ30457.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
Length=994

 Score =   231 bits (590),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  51   EPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  110

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  111  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWA  170

Query  583  WELLTEVYKLPAIR  624
            WELLT+VY LP  R
Sbjct  171  WELLTKVYGLPTDR  184



>ref|XP_006393173.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
 gb|ESQ30459.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
Length=1005

 Score =   231 bits (590),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  51   EPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  110

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  111  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWA  170

Query  583  WELLTEVYKLPAIR  624
            WELLT+VY LP  R
Sbjct  171  WELLTKVYGLPTDR  184



>ref|XP_006393172.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
 gb|ESQ30458.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
Length=1001

 Score =   231 bits (590),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  51   EPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  110

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  111  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWA  170

Query  583  WELLTEVYKLPAIR  624
            WELLT+VY LP  R
Sbjct  171  WELLTKVYGLPTDR  184



>gb|AFW56405.1| hypothetical protein ZEAMMB73_266824 [Zea mays]
Length=399

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            WPS ++R  F+ FFESKAHT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P++ L 
Sbjct  55   WPSRRIRQEFLTFFESKAHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSPLG  114

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            +L RAC+TQKCIRAGGKHNDLDDVG DTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT+
Sbjct  115  RLHRACNTQKCIRAGGKHNDLDDVGNDTYHHTFFEMLGNWSFGDYFKEEAIRWAWELLTQ  174

Query  601  VYKLPAIR  624
            VYKLP  R
Sbjct  175  VYKLPTDR  182



>ref|NP_001064254.1| Os10g0182000 [Oryza sativa Japonica Group]
 gb|ABG65948.1| Alanyl-tRNA synthetase, mitochondrial precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26168.1| Os10g0182000 [Oryza sativa Japonica Group]
 dbj|BAG89937.1| unnamed protein product [Oryza sativa Japonica Group]
Length=999

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP+S+VR+TFI FFESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+  L
Sbjct  52   EWPASRVRETFISFFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDAPL  111

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI +AWELLT
Sbjct  112  GRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGFAWELLT  171

Query  598  EVYKLPAIR  624
            +VYKLP  R
Sbjct  172  QVYKLPTDR  180



>ref|XP_009147848.1| PREDICTED: alanine--tRNA ligase-like [Brassica rapa]
Length=999

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            ++WP+  VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTE
Sbjct  53   IQWPAKTVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTE  112

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  113  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  172

Query  595  TEVYKLPAIR  624
            T+VY LP  R
Sbjct  173  TKVYGLPTDR  182



>emb|CDY22784.1| BnaA06g02930D [Brassica napus]
Length=999

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            ++WP+  VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTE
Sbjct  53   IQWPAKTVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTE  112

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  113  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  172

Query  595  TEVYKLPAIR  624
            T+VY LP  R
Sbjct  173  TKVYGLPTDR  182



>ref|XP_010500574.1| PREDICTED: alanine--tRNA ligase-like [Camelina sativa]
Length=1006

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  56   EPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  115

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  116  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIGWA  175

Query  583  WELLTEVYKLPAIR  624
            WELLT+VY LP  R
Sbjct  176  WELLTKVYGLPTDR  189



>ref|XP_010479473.1| PREDICTED: alanine--tRNA ligase [Camelina sativa]
Length=1006

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  56   EPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  115

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  116  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIGWA  175

Query  583  WELLTEVYKLPAIR  624
            WELLT+VY LP  R
Sbjct  176  WELLTKVYGLPTDR  189



>ref|XP_010463338.1| PREDICTED: alanine--tRNA ligase-like [Camelina sativa]
Length=1050

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  57   EPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  116

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  117  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIGWA  176

Query  583  WELLTEVYKLPAIR  624
            WELLT+VY LP  R
Sbjct  177  WELLTKVYGLPTDR  190



>emb|CDY42520.1| BnaC06g03380D [Brassica napus]
Length=947

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            ++WP+  VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTE
Sbjct  51   IQWPAKTVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTE  110

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  111  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  170

Query  595  TEVYKLPAIR  624
            T+VY LP  R
Sbjct  171  TKVYGLPTDR  180



>ref|XP_004983350.1| PREDICTED: alanine--tRNA ligase-like isoform X3 [Setaria italica]
Length=1005

 Score =   229 bits (584),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP+++VR TF+ +FESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P++ L
Sbjct  57   EWPANRVRKTFVDYFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSPL  116

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELLT
Sbjct  117  GRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGWAWELLT  176

Query  598  EVYKLPAIR  624
            +VYKLP  R
Sbjct  177  KVYKLPTDR  185



>ref|XP_003571715.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase [Brachypodium 
distachyon]
Length=993

 Score =   229 bits (584),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  229  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  408
            A  EWP+ +VR+TFI+++ESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+
Sbjct  40   ASPEWPARRVRETFIQYYESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPD  99

Query  409  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  588
            ++L +L RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI +AWE
Sbjct  100  SQLGRLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGYAWE  159

Query  589  LLTEVYKLPAIR  624
            LLT+VYKLP  R
Sbjct  160  LLTQVYKLPTDR  171



>ref|XP_004983349.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Setaria italica]
Length=1005

 Score =   229 bits (584),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP+++VR TF+ +FESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P++ L
Sbjct  57   EWPANRVRKTFVDYFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSPL  116

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELLT
Sbjct  117  GRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGWAWELLT  176

Query  598  EVYKLPAIR  624
            +VYKLP  R
Sbjct  177  KVYKLPTDR  185



>emb|CDY29328.1| BnaA05g15950D [Brassica napus]
Length=928

 Score =   229 bits (583),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDP+L FANAGMNQ+KPIFLGT D
Sbjct  5    EPSEIKWPAKRVRDTYFDFFKGKGHKFWASSPVVPHNDPSLFFANAGMNQYKPIFLGTAD  64

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  65   PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWA  124

Query  583  WELLTEVYKLPAIR  624
            WELLT+VY LP  R
Sbjct  125  WELLTKVYGLPVDR  138



>ref|XP_004983348.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Setaria italica]
Length=1022

 Score =   229 bits (583),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP+++VR TF+ +FESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P++ L
Sbjct  57   EWPANRVRKTFVDYFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSPL  116

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELLT
Sbjct  117  GRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGWAWELLT  176

Query  598  EVYKLPAIR  624
            +VYKLP  R
Sbjct  177  KVYKLPTDR  185



>ref|XP_011396133.1| Alanine-tRNA ligase [Auxenochlorella protothecoides]
 gb|KFM23263.1| Alanine-tRNA ligase [Auxenochlorella protothecoides]
Length=926

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP S VR TFI FF+SK HT   SSPVVPVNDPTLLF+NAGMNQ+KPIFLGTVDP ++L
Sbjct  6    DWPGSVVRSTFIDFFKSKGHTFNPSSPVVPVNDPTLLFSNAGMNQYKPIFLGTVDPASDL  65

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             KLKRA + QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK EAI WAWELLT
Sbjct  66   GKLKRATNAQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAIGWAWELLT  125

Query  598  EVYKLPAIR  624
            +VY LPA R
Sbjct  126  KVYSLPADR  134



>ref|XP_005849315.1| hypothetical protein CHLNCDRAFT_143654 [Chlorella variabilis]
 gb|EFN57213.1| hypothetical protein CHLNCDRAFT_143654 [Chlorella variabilis]
Length=524

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 108/122 (89%), Gaps = 2/122 (2%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            LEWP ++VR TF++FF  K HT V SSPVVPVNDPTLL  NAGMNQFKPIFLGTVDPN++
Sbjct  11   LEWPVARVRSTFVEFFVGKQHTAVSSSPVVPVNDPTLL--NAGMNQFKPIFLGTVDPNSD  68

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
             +KLKRA ++QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  69   FAKLKRAANSQKCIRAGGKHNDLDDVGKDNYHHTFFEMLGNWSFGDYFKKEAISWAWELL  128

Query  595  TE  600
            TE
Sbjct  129  TE  130



>ref|XP_005645178.1| hypothetical protein COCSUDRAFT_67160 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20634.1| hypothetical protein COCSUDRAFT_67160 [Coccomyxa subellipsoidea 
C-169]
Length=1151

 Score =   227 bits (579),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W   +VR TF++FFE+K HT V SS VVP NDPTLLFANAGMNQFKPIFLGTVDPN++ +
Sbjct  211  WSGDRVRATFVEFFETKGHTAVPSSSVVPHNDPTLLFANAGMNQFKPIFLGTVDPNSDFA  270

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            +L RACD+QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK EAI WAWELLT+
Sbjct  271  RLSRACDSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAIAWAWELLTQ  330

Query  601  VYKLPAIR  624
            VYKL   R
Sbjct  331  VYKLDPAR  338



>ref|XP_008662576.1| PREDICTED: alanine--tRNA ligase [Zea mays]
 gb|AFW56406.1| hypothetical protein ZEAMMB73_266824 [Zea mays]
Length=1002

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            WPS ++R  F+ FFESKAHT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P++ L 
Sbjct  55   WPSRRIRQEFLTFFESKAHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSPLG  114

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            +L RAC+TQKCIRAGGKHNDLDDVG DTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT+
Sbjct  115  RLHRACNTQKCIRAGGKHNDLDDVGNDTYHHTFFEMLGNWSFGDYFKEEAIRWAWELLTQ  174

Query  601  VYKLPAIR  624
            VYKLP  R
Sbjct  175  VYKLPTDR  182



>gb|KIH58709.1| alanine--tRNA ligase [Ancylostoma duodenale]
Length=259

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = +1

Query  250  SKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSKL  426
            ++VR TFI+FF + KAHT V SS V+P +DPTLLFANAGMNQFKP+FLG  DPN++L+KL
Sbjct  106  NEVRSTFIEFFKQKKAHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSDLAKL  165

Query  427  KRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTEVY  606
            KRA +TQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK E I WAWELLTEVY
Sbjct  166  KRAVNTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEIITWAWELLTEVY  225

Query  607  KLPAIR  624
             +PA R
Sbjct  226  GIPAER  231



>ref|XP_002504833.1| alanyl-tRNA synthetase [Micromonas sp. RCC299]
 gb|ACO66091.1| alanyl-tRNA synthetase [Micromonas sp. RCC299]
Length=945

 Score =   223 bits (568),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP+ ++R TF+ FFE K HT V SSPVVP +DPTLLFANAGMNQFKP FLGT DP   L
Sbjct  6    EWPAQRIRQTFLDFFEGKEHTVVPSSPVVPHDDPTLLFANAGMNQFKPCFLGTADPKGPL  65

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            +KLKRA DTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGD+FK EAI WAWELLT
Sbjct  66   AKLKRATDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDFFKEEAIGWAWELLT  125

Query  598  EVYKLPAIR  624
            +VY LP  R
Sbjct  126  KVYMLPEDR  134



>gb|KIY74247.1| hypothetical protein CYLTODRAFT_427840 [Cylindrobasidium torrendii 
FP15055 ss-10]
Length=953

 Score =   223 bits (567),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            WPS+ VRD F KFF+SK HT V SSP +P  DPTLLFANAGMNQ+K IFLGTVDP++E++
Sbjct  10   WPSATVRDEFFKFFKSKGHTYVASSPTIPYEDPTLLFANAGMNQYKSIFLGTVDPHSEMA  69

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            KLKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLTE
Sbjct  70   KLKRAFNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIGYSWELLTE  129

Query  601  VYKLPAIR  624
            VYKLP  R
Sbjct  130  VYKLPKDR  137



>ref|XP_005537171.1| alanine--tRNA ligase cytoplasmic [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81135.1| alanine--tRNA ligase cytoplasmic [Cyanidioschyzon merolae strain 
10D]
Length=1061

 Score =   223 bits (568),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 95/124 (77%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            WPSS+VR TFI +F  + HT V+SSPVVP +DPTLLF NAGMNQFKP+FLG VDP + L 
Sbjct  23   WPSSRVRQTFIDYFIDRGHTFVESSPVVPFDDPTLLFTNAGMNQFKPLFLGRVDPTSPLF  82

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
             LKRAC+TQKC+RAGGKHNDLDDVG+DTYHHTFFEMLGNWSFGDYF  EAI WAW+LLT 
Sbjct  83   GLKRACNTQKCVRAGGKHNDLDDVGRDTYHHTFFEMLGNWSFGDYFNAEAINWAWDLLTR  142

Query  601  VYKL  612
            VY L
Sbjct  143  VYGL  146



>gb|EPX70595.1| cytoplasmic alanine-tRNA ligase Ala1 [Schizosaccharomyces octosporus 
yFS286]
Length=1019

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            L+WP+SKVR TF+KFFE + HT V SS VVP +DP+LLFANAGMNQFKPIFLGTVDP+ E
Sbjct  68   LKWPASKVRSTFLKFFEERGHTIVPSSSVVPYDDPSLLFANAGMNQFKPIFLGTVDPSHE  127

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
             SKLKRA D+QKCIRAGGKHNDL+DVG+D YHHT FEMLGNWSFGDYFK EAIQ AWELL
Sbjct  128  YSKLKRAVDSQKCIRAGGKHNDLEDVGRDNYHHTMFEMLGNWSFGDYFKKEAIQMAWELL  187

Query  595  TEVYKL  612
            TEVY L
Sbjct  188  TEVYGL  193



>gb|KIZ04229.1| alanyl-tRNA synthetase [Monoraphidium neglectum]
Length=965

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP + VR  F  FF SK HT   S+ VVP+NDPTLLF NAGMNQFKP+FLGTVDPN+E+
Sbjct  4    EWPGAVVRKAFNDFFVSKGHTYWPSNAVVPLNDPTLLFTNAGMNQFKPVFLGTVDPNSEM  63

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             +LK AC++QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK EAI WAWELLT
Sbjct  64   GRLKSACNSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKEEAISWAWELLT  123

Query  598  EVYKLPAIR  624
            +VYKLP  R
Sbjct  124  QVYKLPGER  132



>emb|CEL61027.1| alanyl-tRNA synthetase [Rhizoctonia solani AG-1 IB]
Length=991

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP+++VR  FI FFE++ H    SS  +P +DPTLLFANAGMNQ+K IFLGTVDPN+EL
Sbjct  44   EWPANRVRKEFIDFFEARGHKFWASSSTIPYDDPTLLFANAGMNQYKAIFLGTVDPNSEL  103

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKLKRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK EAI WAWELLT
Sbjct  104  SKLKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGEYFKKEAITWAWELLT  163

Query  598  EVYKLPAIR  624
            EVYKLP  R
Sbjct  164  EVYKLPKDR  172



>gb|KEP53395.1| alanyl-tRNA synthetase [Rhizoctonia solani 123E]
Length=953

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP+ +VR  FI FFE++ H    SS  +P +DPTLLFANAGMNQ+K IFLGTVDPN+EL
Sbjct  7    EWPAQRVRKEFIDFFEARGHKFWPSSSTIPYDDPTLLFANAGMNQYKAIFLGTVDPNSEL  66

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKLKRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK EAI WAWELLT
Sbjct  67   SKLKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGEYFKKEAITWAWELLT  126

Query  598  EVYKLPAIR  624
            EVYKLP  R
Sbjct  127  EVYKLPKDR  135



>gb|KDQ21195.1| hypothetical protein BOTBODRAFT_25615 [Botryobasidium botryosum 
FD-172 SS1]
Length=956

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP++KVR  FI FF++K HT V SS  +P  DPTLLFANAGMNQ+K IFLGTVDPN++ 
Sbjct  8    EWPAAKVRQVFIDFFKNKGHTFVPSSSTIPYEDPTLLFANAGMNQYKSIFLGTVDPNSDF  67

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            +KLKRA ++QKCIRAGGKHNDL+DVGKDTYHHT FEMLGNWSFGDYFK EAI WAWELLT
Sbjct  68   AKLKRAVNSQKCIRAGGKHNDLEDVGKDTYHHTMFEMLGNWSFGDYFKKEAILWAWELLT  127

Query  598  EVYKLPAIR  624
            EVYKLP  R
Sbjct  128  EVYKLPKDR  136



>gb|EUC64360.1| alanyl-tRNA synthetase, partial [Rhizoctonia solani AG-3 Rhs1AP]
Length=934

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP+ +VR  FI FFE++ H    SS  +P +DPTLLFANAGMNQ+K IFLGTVDPN+EL
Sbjct  7    EWPAQRVRKEFIDFFEARGHKFWPSSSTIPYDDPTLLFANAGMNQYKAIFLGTVDPNSEL  66

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKLKRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK EAI WAWELLT
Sbjct  67   SKLKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGEYFKKEAITWAWELLT  126

Query  598  EVYKLPAIR  624
            EVYKLP  R
Sbjct  127  EVYKLPKDR  135



>dbj|BAJ98134.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1004

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = +1

Query  223  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            E A  +WPS+ VR  FI FF S+AHT   SSPVVP  DPTLLFANAGMNQ+KP+FLG  D
Sbjct  49   EEAAPDWPSALVRQVFIDFFRSRAHTPWPSSPVVPFEDPTLLFANAGMNQYKPVFLGAAD  108

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            P++ L +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK +AI +A
Sbjct  109  PDSPLGRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKDQAIAYA  168

Query  583  WELLTEVYKLPAIR  624
            WELLT+VYKLP  R
Sbjct  169  WELLTQVYKLPTDR  182



>emb|CEG77795.1| Putative Alanyl-tRNA synthetase [Rhizopus microsporus]
Length=401

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  405
            M   EWP +KVR TFIKFFE   HT V SS  +P +DPTLLFANAGMNQFKP+FLGT+DP
Sbjct  1    MTEQEWPVNKVRSTFIKFFEENGHTFVPSSSTIPHDDPTLLFANAGMNQFKPMFLGTLDP  60

Query  406  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  585
            N+ L+ +KRAC++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EA + AW
Sbjct  61   NSPLANVKRACNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEATKLAW  120

Query  586  ELLTEVYKLPAIR  624
            E LT+V  LP  R
Sbjct  121  EFLTKVISLPEDR  133



>emb|CDK27200.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=989

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W ++KVR TF+KFFES+ HT V SS V+P +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  39   DWTAAKVRSTFLKFFESRGHTFVPSSSVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSDF  98

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            + LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAIQW+WELLT
Sbjct  99   ATLKRAVNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIQWSWELLT  158

Query  598  EVYKLPAIR  624
             VY +PA R
Sbjct  159  VVYGIPADR  167



>ref|XP_002443089.1| hypothetical protein SORBIDRAFT_08g008230 [Sorghum bicolor]
 gb|EES16927.1| hypothetical protein SORBIDRAFT_08g008230 [Sorghum bicolor]
Length=1006

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EW + +VR+ +I FF SK HT   SSPVVPV+DPTLLFANAGMNQ+KP+FLGT  P++ L
Sbjct  58   EWTARRVREQYISFFVSKEHTRWPSSPVVPVDDPTLLFANAGMNQYKPVFLGTAAPDSPL  117

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELLT
Sbjct  118  GRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGWAWELLT  177

Query  598  EVYKLPAIR  624
            +VYKLP  R
Sbjct  178  QVYKLPTDR  186



>ref|XP_001731546.1| hypothetical protein MGL_1729 [Malassezia globosa CBS 7966]
 gb|EDP44332.1| hypothetical protein MGL_1729 [Malassezia globosa CBS 7966]
Length=963

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP++KVR TF+ FF  K HT V SS  VP +DPTLLFANAGMNQ+K IFLGTVDP++E 
Sbjct  11   EWPAAKVRSTFLDFFREKEHTFVPSSSTVPYDDPTLLFANAGMNQYKSIFLGTVDPSSEF  70

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKL+RA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI +AW+LLT
Sbjct  71   SKLRRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAISFAWKLLT  130

Query  598  EVYKLPAIR  624
            EVY LP+ R
Sbjct  131  EVYGLPSDR  139



>dbj|BAJ96541.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1008

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W +++VR+ FI FF+SK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+++L
Sbjct  58   DWTAARVREVFIDFFKSKSHTPWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTASPDSQL  117

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             +L RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK  AI +AWELLT
Sbjct  118  GRLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEGAIGYAWELLT  177

Query  598  EVYKLPAIR  624
            +VYKLP  R
Sbjct  178  QVYKLPTDR  186



>gb|EJU04465.1| hypothetical protein DACRYDRAFT_20988 [Dacryopinax sp. DJM-731 
SS1]
Length=960

 Score =   220 bits (560),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            WP+ KVR TFI +F+++ HT   SS  +P  DPTLLFANAGMNQ+K IFLGTVDP +EL+
Sbjct  14   WPADKVRQTFIDYFKARGHTFWPSSSTIPYEDPTLLFANAGMNQYKAIFLGTVDPQSELA  73

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            KLKRA ++QKCIRAGGKHNDL+DVGKDTYHHTFFEMLGNWSFGDYFK EAIQW+WELLTE
Sbjct  74   KLKRAVNSQKCIRAGGKHNDLEDVGKDTYHHTFFEMLGNWSFGDYFKKEAIQWSWELLTE  133

Query  601  VYKLPAIR  624
            VYKLP  R
Sbjct  134  VYKLPKDR  141



>gb|EPY51753.1| cytoplasmic alanine-tRNA ligase Ala1 [Schizosaccharomyces cryophilus 
OY26]
Length=1019

 Score =   220 bits (561),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP++KVR TF+KFFE + HT V SS VVP +DPTLLFANAGMNQFKPIFLGTVDP+ E
Sbjct  68   IEWPANKVRSTFLKFFEERGHTVVPSSSVVPYDDPTLLFANAGMNQFKPIFLGTVDPSHE  127

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
             SKLKRA D+QKCIRAGGKHNDL+DVG+D YHHT FEMLGNWSFGDYFK EAIQ AW LL
Sbjct  128  YSKLKRAVDSQKCIRAGGKHNDLEDVGRDNYHHTMFEMLGNWSFGDYFKKEAIQMAWVLL  187

Query  595  TEVYKL  612
            TEVY L
Sbjct  188  TEVYGL  193



>gb|EMT18589.1| Alanyl-tRNA synthetase, mitochondrial [Aegilops tauschii]
Length=1012

 Score =   220 bits (560),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W +++VR+ FI FF+SK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+++L
Sbjct  6    DWTAARVREVFIDFFKSKSHTPWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSQL  65

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             +L RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK  AI +AWELLT
Sbjct  66   GRLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEGAIGYAWELLT  125

Query  598  EVYKLPAIR  624
            +VYKLP  R
Sbjct  126  QVYKLPTDR  134



>gb|KIM31429.1| hypothetical protein M408DRAFT_327641 [Serendipita vermifera 
MAFF 305830]
Length=960

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W +SKVR+T+I FF+SK HT   SS  +P  DPTLLFANAGMNQ+K +FLGTVDPN+++S
Sbjct  10   WTASKVRETYIDFFKSKGHTFWPSSSTIPYEDPTLLFANAGMNQYKAVFLGTVDPNSDMS  69

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EA+ WAWELLTE
Sbjct  70   KLKRAVNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKREALSWAWELLTE  129

Query  601  VYKLPAIR  624
            VYKLPA R
Sbjct  130  VYKLPADR  137



>gb|EKF39507.1| alanyl-tRNA synthetase, putative, partial [Trypanosoma cruzi 
marinkellei]
Length=1007

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP ++VR  F+KFFE + H  V SSPVVP NDPTLLF NAGMNQFK IFLGT DPNTE 
Sbjct  51   EWPVNRVRQEFLKFFEQRGHKFVPSSPVVPNNDPTLLFINAGMNQFKNIFLGTADPNTEF  110

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             +L RA ++Q CIRAGGKHNDLDDVG+DTYHHTFFEMLG+WSFGDYFK +AI+WAWELLT
Sbjct  111  GRLTRAANSQLCIRAGGKHNDLDDVGRDTYHHTFFEMLGSWSFGDYFKRDAIRWAWELLT  170

Query  598  EVYKLPAIR  624
            EVYKLP  R
Sbjct  171  EVYKLPKDR  179



>ref|XP_816499.1| alanyl-tRNA synthetase [Trypanosoma cruzi strain CL Brener]
 gb|EAN94648.1| alanyl-tRNA synthetase, putative [Trypanosoma cruzi]
Length=959

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP ++VR  F+KFFE + H  V SSPVVP NDPTLLF NAGMNQFK +FLGT DPNTE 
Sbjct  3    EWPVNRVRQEFLKFFEQRGHKFVPSSPVVPNNDPTLLFINAGMNQFKNLFLGTADPNTEF  62

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             +L RA ++Q CIRAGGKHNDLDDVG+DTYHHTFFEMLG+WSFGDYFK +AI+WAWELLT
Sbjct  63   GRLTRAANSQLCIRAGGKHNDLDDVGRDTYHHTFFEMLGSWSFGDYFKRDAIRWAWELLT  122

Query  598  EVYKLPAIR  624
            EVYKLP  R
Sbjct  123  EVYKLPKDR  131



>emb|CCV00729.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=966

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  229  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  408
            A   WP++KVR TF+ FF+ +AHT V SS  VP +DPTLLFANAGMNQ+K IFLGTVDP+
Sbjct  8    ASTAWPAAKVRSTFLDFFKEQAHTNVPSSSTVPYDDPTLLFANAGMNQYKSIFLGTVDPS  67

Query  409  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  588
            ++ SKL+RA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK EAI +AW+
Sbjct  68   SDFSKLRRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKEEAISYAWK  127

Query  589  LLTEVYKLPAIR  624
            LLTEVY LPA R
Sbjct  128  LLTEVYGLPADR  139



>ref|XP_810193.1| alanyl-tRNA synthetase [Trypanosoma cruzi strain CL Brener]
 gb|EAN88342.1| alanyl-tRNA synthetase, putative [Trypanosoma cruzi]
Length=959

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP ++VR  F+KFFE + H  V SSPVVP NDPTLLF NAGMNQFK +FLGT DPNTE 
Sbjct  3    EWPVNRVRQEFLKFFEQRGHKFVPSSPVVPNNDPTLLFINAGMNQFKNLFLGTADPNTEF  62

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             +L RA ++Q CIRAGGKHNDLDDVG+DTYHHTFFEMLG+WSFGDYFK +AI+WAWELLT
Sbjct  63   GRLTRAANSQLCIRAGGKHNDLDDVGRDTYHHTFFEMLGSWSFGDYFKRDAIRWAWELLT  122

Query  598  EVYKLPAIR  624
            EVYKLP  R
Sbjct  123  EVYKLPKDR  131



>gb|EKG06983.1| alanyl-tRNA synthetase, putative [Trypanosoma cruzi]
Length=959

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP ++VR  F+KFFE + H  V SSPVVP NDPTLLF NAGMNQFK +FLGT DPNTE 
Sbjct  3    EWPVNRVRQEFLKFFEQRGHKFVPSSPVVPNNDPTLLFINAGMNQFKNLFLGTADPNTEF  62

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             +L RA ++Q CIRAGGKHNDLDDVG+DTYHHTFFEMLG+WSFGDYFK +AI+WAWELLT
Sbjct  63   GRLTRAANSQLCIRAGGKHNDLDDVGRDTYHHTFFEMLGSWSFGDYFKRDAIRWAWELLT  122

Query  598  EVYKLPAIR  624
            EVYKLP  R
Sbjct  123  EVYKLPKDR  131



>gb|ESS63542.1| alanyl-tRNA synthetase [Trypanosoma cruzi Dm28c]
Length=900

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP ++VR  F+KFFE + H  V SSPVVP NDPTLLF NAGMNQFK +FLGT DPNTE 
Sbjct  3    EWPVNRVRQEFLKFFEQRGHKFVPSSPVVPNNDPTLLFINAGMNQFKNLFLGTADPNTEF  62

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             +L RA ++Q CIRAGGKHNDLDDVG+DTYHHTFFEMLG+WSFGDYFK +AI+WAWELLT
Sbjct  63   GRLTRAANSQLCIRAGGKHNDLDDVGRDTYHHTFFEMLGSWSFGDYFKRDAIRWAWELLT  122

Query  598  EVYKLPAIR  624
            EVYKLP  R
Sbjct  123  EVYKLPKDR  131



>gb|KFH15707.1| cytosolic tRNA-Ala synthetase, partial [Toxoplasma gondii MAS]
Length=151

 Score =   201 bits (512),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W    VR  +++FFE++ H    SSPV+P  D TLLF NAGMNQFKPIFLG +D ++ LS
Sbjct  24   WSGEAVRGAYLEFFEAQGHLIYPSSPVIPRGDNTLLFINAGMNQFKPIFLGQIDRSSPLS  83

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            KL+R  DTQKCIRAGGKHNDL+DVGKD YHHTFFEMLGNWSFGDYFK EAI WAW+LLTE
Sbjct  84   KLRRVADTQKCIRAGGKHNDLEDVGKDVYHHTFFEMLGNWSFGDYFKREAIAWAWQLLTE  143

Query  601  VYKLPAIR  624
            VY++P  R
Sbjct  144  VYRIPKDR  151



>gb|AAA84420.1| AlaRS A [Caenorhabditis elegans]
Length=272

 Score =   206 bits (523),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 108/127 (85%), Gaps = 1/127 (1%)
 Frame = +1

Query  247  SSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSK  423
            +S+VR TFI FF E K HT V SS V+P +DPTLLFANAGMNQFKP+FLG  DPN++L+K
Sbjct  6    ASEVRSTFINFFREKKEHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSDLAK  65

Query  424  LKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTEV  603
            LKRA +TQKCIRAGGKHNDLDDVGKD YHHT+FEMLGNWSFGDYFK E I WAWELLT V
Sbjct  66   LKRAVNTQKCIRAGGKHNDLDDVGKDVYHHTYFEMLGNWSFGDYFKKEIITWAWELLTTV  125

Query  604  YKLPAIR  624
            Y +PA R
Sbjct  126  YGIPAER  132



>ref|XP_003030369.1| hypothetical protein SCHCODRAFT_82606 [Schizophyllum commune 
H4-8]
 gb|EFI95466.1| hypothetical protein SCHCODRAFT_82606 [Schizophyllum commune 
H4-8]
Length=949

 Score =   217 bits (553),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 116/134 (87%), Gaps = 1/134 (1%)
 Frame = +1

Query  226  MAGLEWPSSK-VRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            MA +   SS+ VR  F  +F+SK HT V+SSP VP +DPTLLFANAGMNQFKP+FLGTVD
Sbjct  1    MAAIPHRSSRQVRQDFFDYFQSKGHTFVRSSPTVPYDDPTLLFANAGMNQFKPLFLGTVD  60

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            P+++LSKLKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI ++
Sbjct  61   PHSDLSKLKRAYNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIAYS  120

Query  583  WELLTEVYKLPAIR  624
            WELLTEVYKLP  R
Sbjct  121  WELLTEVYKLPKDR  134



>emb|CEI92968.1| Putative Alanyl-tRNA synthetase [Rhizopus microsporus]
Length=956

 Score =   217 bits (553),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  405
            M   EWP +KVR TFIKFFE   HT V SS  +P +DPTLLFANAGMNQFKP+FLGT+DP
Sbjct  1    MTEQEWPVNKVRSTFIKFFEENGHTFVPSSSTIPHDDPTLLFANAGMNQFKPMFLGTLDP  60

Query  406  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  585
            N+ L+ +KRAC++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EA + AW
Sbjct  61   NSPLANVKRACNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEATKLAW  120

Query  586  ELLTEVYKLPAIR  624
            E LT+V +LP  R
Sbjct  121  EFLTKVIRLPEDR  133



>gb|EPS99866.1| hypothetical protein FOMPIDRAFT_1024013 [Fomitopsis pinicola 
FP-58527 SS1]
Length=958

 Score =   217 bits (553),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            L WP++KVR  F  +F+SK HT V SS  +P +DPTLLFANAGMNQFK IFLGTVDP ++
Sbjct  7    LNWPAAKVRQEFFNYFQSKGHTLVPSSSTIPHDDPTLLFANAGMNQFKAIFLGTVDPQSD  66

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            L++L RA +TQKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELL
Sbjct  67   LARLNRAFNTQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKEEAIAYSWELL  126

Query  595  TEVYKLP  615
            TEVYKLP
Sbjct  127  TEVYKLP  133



>ref|XP_011111424.1| hypothetical protein H072_5555 [Dactylellina haptotyla CBS 200.50]
 gb|EPS40594.1| hypothetical protein H072_5555 [Dactylellina haptotyla CBS 200.50]
Length=1063

 Score =   218 bits (555),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP++KVR+TF K+FESK H  VKSSP VPV+D TLLFANAGMNQ+K IFLGTVDPN++ 
Sbjct  106  EWPAAKVRETFFKYFESKGHEYVKSSPCVPVDDKTLLFANAGMNQYKSIFLGTVDPNSKF  165

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             KLKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLT
Sbjct  166  GKLKRAHNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIAYSWELLT  225

Query  598  EVYKL  612
            +V+KL
Sbjct  226  QVFKL  230



>gb|KHJ91121.1| alanine--tRNA ligase [Oesophagostomum dentatum]
Length=519

 Score =   212 bits (539),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +1

Query  253  KVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSKLK  429
            KVR TFI+FF + KAHT V SS V+P +DPTLLFANAGMNQFKP+FLG  DPN++L+KLK
Sbjct  117  KVRSTFIEFFRQKKAHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGVADPNSDLAKLK  176

Query  430  RACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTEVYK  609
            RA +TQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK E I WAWELLTEVY 
Sbjct  177  RAVNTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKREIITWAWELLTEVYG  236

Query  610  LPAIR  624
            +PA R
Sbjct  237  IPADR  241



>gb|KIW00804.1| alanine-tRNA ligase [Verruconis gallopava]
Length=998

 Score =   217 bits (553),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EW ++ VR  FI +FE + HT V SSPVVP+NDPTLLF NAGMNQFK IFLGTVDPN+  
Sbjct  49   EWTANSVRKQFIDYFEQRGHTYVPSSPVVPLNDPTLLFTNAGMNQFKSIFLGTVDPNSNF  108

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            +KLKRA +TQKCIRAGGKHNDLDDVGKD+YHHT+FEMLGNWSFGDYFK EAI W+WELLT
Sbjct  109  AKLKRAVNTQKCIRAGGKHNDLDDVGKDSYHHTYFEMLGNWSFGDYFKKEAIAWSWELLT  168

Query  598  EVYKLPAIR  624
            +VY L   R
Sbjct  169  KVYGLEPDR  177



>gb|AFR32145.1| alanyl-tRNA synthetase, partial [Galactomyces candidum]
Length=971

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            WP+SKVR+TF+ +F+SK HT V SS V+P +DPTLLFANAGMNQ+KPIFLGTVDP++ L 
Sbjct  21   WPASKVRNTFLDYFKSKEHTFVPSSSVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSPLF  80

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI + WELLT+
Sbjct  81   KLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIAFGWELLTK  140

Query  601  VYKLPAIR  624
            VY +PA R
Sbjct  141  VYGIPADR  148



>gb|AFR32153.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32155.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32157.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32161.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32162.1| alanyl-tRNA synthetase [Galactomyces candidum]
Length=979

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            WP+SKVR+TF+ +F+SK HT V SS V+P +DPTLLFANAGMNQ+KPIFLGTVDP++ L 
Sbjct  29   WPASKVRNTFLDYFKSKEHTFVPSSSVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSPLF  88

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI + WELLT+
Sbjct  89   KLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIAFGWELLTK  148

Query  601  VYKLPAIR  624
            VY +PA R
Sbjct  149  VYGIPADR  156



>ref|XP_003079014.1| SYA_ARATH Alanyl-tRNA synthetase, mitochondrial precursor (ISS) 
[Ostreococcus tauri]
Length=1170

 Score =   218 bits (555),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 110/130 (85%), Gaps = 1/130 (1%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            EWPS +VRDTFI +F E + HT   SSP VPV+DPTLLFANAGMNQ+KPIFLG  DP T 
Sbjct  243  EWPSKRVRDTFINYFIEKQNHTPWPSSPAVPVDDPTLLFANAGMNQYKPIFLGKADPKTA  302

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            L+KL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  303  LAKLSRATNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGWAWELL  362

Query  595  TEVYKLPAIR  624
            T+VY LP  R
Sbjct  363  TKVYCLPEDR  372



>emb|CEF97732.1| Thioredoxin-like fold [Ostreococcus tauri]
Length=1183

 Score =   218 bits (555),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 110/130 (85%), Gaps = 1/130 (1%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            EWPS +VRDTFI +F E + HT   SSP VPV+DPTLLFANAGMNQ+KPIFLG  DP T 
Sbjct  243  EWPSKRVRDTFINYFIEKQNHTPWPSSPAVPVDDPTLLFANAGMNQYKPIFLGKADPKTA  302

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            L+KL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  303  LAKLSRATNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGWAWELL  362

Query  595  TEVYKLPAIR  624
            T+VY LP  R
Sbjct  363  TKVYCLPEDR  372



>emb|CEG71324.1| Putative Alanyl-tRNA synthetase [Rhizopus microsporus]
Length=956

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  405
            M   EWP +KVR TFIKFFE   HT V SS  +P +DPTLLFANAGMNQFKP+FLGT+DP
Sbjct  1    MTEQEWPVNKVRSTFIKFFEENGHTFVPSSSTIPHDDPTLLFANAGMNQFKPMFLGTLDP  60

Query  406  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  585
            N+ L+ +KRAC++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EA + AW
Sbjct  61   NSPLANVKRACNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEATKLAW  120

Query  586  ELLTEVYKLPAIR  624
            E LT+V  LP  R
Sbjct  121  EFLTKVISLPKDR  133



>ref|XP_011121665.1| hypothetical protein AOL_s00078g100 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX49611.1| hypothetical protein AOL_s00078g100 [Arthrobotrys oligospora 
ATCC 24927]
Length=940

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP++KVR TFI+FFE K H   KSSP VP++D TLLFANAGMNQFKPIFLGTVD  ++ 
Sbjct  21   KWPATKVRQTFIEFFEKKGHVFYKSSPCVPLDDKTLLFANAGMNQFKPIFLGTVDETSDF  80

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             KLKRAC+TQKCIRAGGKHNDL+DVG D+YHHTFFEMLGNWSFGDYFKTEA+ ++WELLT
Sbjct  81   GKLKRACNTQKCIRAGGKHNDLEDVGSDSYHHTFFEMLGNWSFGDYFKTEAVAYSWELLT  140

Query  598  EVYKLPAIR  624
            +VY L   R
Sbjct  141  KVYGLDPAR  149



>emb|CBQ72435.1| probable ALA1-alanyl-tRNA synthetase, cytosolic [Sporisorium 
reilianum SRZ2]
Length=990

 Score =   216 bits (551),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP++KVR+TF  +FE +AHT V SS  +P +DPTLLFANAGMNQ+KPIFLG  DPN+  
Sbjct  21   DWPATKVRNTFTGYFEERAHTFVPSSSTIPYDDPTLLFANAGMNQYKPIFLGIADPNSSF  80

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
              +KRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAIQ AWELLT
Sbjct  81   GSMKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIQMAWELLT  140

Query  598  EVYKLPAIR  624
            +VY LP  R
Sbjct  141  KVYGLPKDR  149



>ref|XP_001524092.1| alanyl-tRNA synthetase [Lodderomyces elongisporus NRRL YB-4239]
 gb|EDK46724.1| alanyl-tRNA synthetase [Lodderomyces elongisporus NRRL YB-4239]
Length=436

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = +1

Query  232  GLEWPSSKVRDTFIKFFESKA-HTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  408
            G +W +S VR TF+ +F+SK  HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP+
Sbjct  19   GQKWTASTVRSTFLDYFKSKRDHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPS  78

Query  409  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  588
            ++ +KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI W+WE
Sbjct  79   SDFAKLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIGWSWE  138

Query  589  LLTEVYKLPAIR  624
            LLTEVY L   R
Sbjct  139  LLTEVYGLEKDR  150



>gb|EFW22234.1| alanyl-tRNA synthetase [Coccidioides posadasii str. Silveira]
Length=964

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+ KVRDTF+ FF+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  13   VEWPAIKVRDTFLDFFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  72

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI+++WELL
Sbjct  73   FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIEYSWELL  132

Query  595  TEVYKLPAIR  624
            T+VY L   R
Sbjct  133  TKVYGLEPDR  142



>ref|XP_007847723.1| alanyl-trna synthetase [Moniliophthora roreri MCA 2997]
 gb|ESK92985.1| alanyl-trna synthetase [Moniliophthora roreri MCA 2997]
Length=946

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W +SKVRD F  +F S+ HT V SS  +P +DPTLLFANAGMNQ+K IFLGTVDPN++L+
Sbjct  5    WTASKVRDEFFNYFRSREHTFVPSSSTIPYDDPTLLFANAGMNQYKAIFLGTVDPNSDLA  64

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            KLKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLT+
Sbjct  65   KLKRAFNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIAYSWELLTQ  124

Query  601  VYKLPAIR  624
            VYKLP  R
Sbjct  125  VYKLPQDR  132



>gb|EMS67609.1| Alanyl-tRNA synthetase [Triticum urartu]
Length=1858

 Score =   218 bits (556),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W +++VR+ FI FF+SK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+++L
Sbjct  6    DWTAARVREVFIDFFKSKSHTPWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSQL  65

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             +L RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK  AI +AWELLT
Sbjct  66   GRLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEGAIGYAWELLT  125

Query  598  EVYKLPAIR  624
            +VYKLP  R
Sbjct  126  QVYKLPTDR  134



>emb|CDJ84213.1| Alanyl-tRNA synthetase and Threonyl alanyl tRNA synthetase and 
Phosphoesterase domain containing protein [Haemonchus contortus]
Length=934

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +  +++VR TFI+FF + KAHT V SS V+P +DPTLLFANAGMNQFKP+FLG  DPN++
Sbjct  20   QLTANEVRSTFIEFFKQKKAHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSD  79

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            L+KLKRA +TQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK E I WAWELL
Sbjct  80   LAKLKRAVNTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEVITWAWELL  139

Query  595  TEVYKLPAIR  624
            TEVY++PA R
Sbjct  140  TEVYEIPADR  149



>emb|CEP13586.1| hypothetical protein [Parasitella parasitica]
Length=959

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP++KVR TFIK+FE   H  V SS  +P +DPTLLFANAGMNQ+KPIFLGTVDPN+ L
Sbjct  7    EWPANKVRSTFIKYFEDNGHVFVPSSSTIPHDDPTLLFANAGMNQYKPIFLGTVDPNSPL  66

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            + +KRAC++QKCIRAGGKHNDLDDVG+DTYHHTFFEMLGNWSFGDYFK EA ++ WE LT
Sbjct  67   ANVKRACNSQKCIRAGGKHNDLDDVGRDTYHHTFFEMLGNWSFGDYFKLEATKFGWEFLT  126

Query  598  EVYKLPAIR  624
            +V KLP  R
Sbjct  127  KVIKLPEDR  135



>ref|XP_001248510.1| alanyl-tRNA synthetase, cytoplasmic [Coccidioides immitis RS]
 gb|EAS36927.3| alanine-tRNA ligase [Coccidioides immitis RS]
Length=1023

 Score =   216 bits (549),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+ KVRDTF+ FF+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  72   VEWPAIKVRDTFLDFFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  131

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI+++WELL
Sbjct  132  FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIEYSWELL  191

Query  595  TEVYKLPAIR  624
            T+VY L   R
Sbjct  192  TKVYGLEPDR  201



>ref|XP_004335848.1| alanine-tRNA ligase [Acanthamoeba castellanii str. Neff]
 gb|ELR13835.1| alanine-tRNA ligase [Acanthamoeba castellanii str. Neff]
Length=954

 Score =   215 bits (548),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 111/133 (83%), Gaps = 1/133 (1%)
 Frame = +1

Query  229  AGLEWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  405
            A +EWP S+VR TF+ +F E + H  V+SS VVP +DPTLLFANAGMNQFKPIFLG VDP
Sbjct  8    ASIEWPVSRVRQTFVDYFVEKQQHLHVRSSSVVPHDDPTLLFANAGMNQFKPIFLGQVDP  67

Query  406  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  585
             +E +  KRA ++QKCIRAGGKHNDL+DVGKDTYHHTFFEMLGNWSFGDYFK EAI WAW
Sbjct  68   KSEQATWKRAANSQKCIRAGGKHNDLEDVGKDTYHHTFFEMLGNWSFGDYFKEEAISWAW  127

Query  586  ELLTEVYKLPAIR  624
            +LLT VY LPA R
Sbjct  128  DLLTNVYGLPAER  140



>ref|XP_001877691.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR11794.1| predicted protein [Laccaria bicolor S238N-H82]
Length=955

 Score =   215 bits (548),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            + W S++VR+ F  FF SK HT V SSP +P +DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  8    VSWSSARVREEFFNFFRSKNHTFVPSSPTIPFDDPTLLFANAGMNQYKSIFLGTVDPNSD  67

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            +S+LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELL
Sbjct  68   MSRLKRAFNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIAYSWELL  127

Query  595  TEVYKLPAIR  624
            T+VYKLP  R
Sbjct  128  TDVYKLPKDR  137



>ref|XP_001683305.1| putative alanyl-tRNA synthetase [Leishmania major strain Friedlin]
 emb|CAJ04856.1| putative alanyl-tRNA synthetase [Leishmania major strain Friedlin]
Length=962

 Score =   215 bits (548),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  226  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  405
            M+  EWP S+VR  F+ +F+ + HT V SSPV P +DPTLLF NAGMNQFK +FLGT DP
Sbjct  1    MSFTEWPVSRVRQEFVDYFKKQGHTFVPSSPVCPHDDPTLLFINAGMNQFKALFLGTADP  60

Query  406  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  585
            NT+  +LKRA ++Q CIRAGGKHNDL+DVG+DTYHHTFFEMLG+WSFGDYFK EAIQWAW
Sbjct  61   NTDFGRLKRAANSQMCIRAGGKHNDLEDVGRDTYHHTFFEMLGSWSFGDYFKKEAIQWAW  120

Query  586  ELLTEVYKLP  615
            ELLTEVYKLP
Sbjct  121  ELLTEVYKLP  130



>ref|XP_003070819.1| Alanyl-tRNA synthetase, cytoplasmic , putative [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EER28674.1| Alanyl-tRNA synthetase, cytoplasmic , putative [Coccidioides 
posadasii C735 delta SOWgp]
Length=1023

 Score =   216 bits (549),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+ KVRDTF+ FF+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  72   VEWPAIKVRDTFLDFFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  131

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI+++WELL
Sbjct  132  FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIEYSWELL  191

Query  595  TEVYKLPAIR  624
            T+VY L   R
Sbjct  192  TKVYGLEPDR  201



>ref|XP_008720639.1| alanyl-tRNA synthetase [Cyphellophora europaea CBS 101466]
 gb|ETN37107.1| alanyl-tRNA synthetase [Cyphellophora europaea CBS 101466]
Length=963

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EW + +VRDTF+K+FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP+++ 
Sbjct  11   EWSAQQVRDTFLKYFEERGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPSSKE  70

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             + KRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLT
Sbjct  71   GQWKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAINYSWELLT  130

Query  598  EVYKL  612
            +V+ L
Sbjct  131  KVFGL  135



>ref|XP_001465654.1| putative alanyl-tRNA synthetase [Leishmania infantum JPCM5]
 ref|XP_003860885.1| alanyl-tRNA synthetase, putative [Leishmania donovani]
 emb|CAM68079.1| putative alanyl-tRNA synthetase [Leishmania infantum JPCM5]
 emb|CBZ34180.1| alanyl-tRNA synthetase, putative [Leishmania donovani]
Length=962

 Score =   215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  226  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  405
            M+  EWP S+VR  F+ +F+ + HT V SSPV P +DPTLLF NAGMNQFK +FLGT DP
Sbjct  1    MSFTEWPVSRVRQEFVDYFKKQGHTFVPSSPVCPHDDPTLLFINAGMNQFKALFLGTADP  60

Query  406  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  585
            NT+  +LKRA ++Q CIRAGGKHNDL+DVG+DTYHHTFFEMLG+WSFGDYFK EAIQWAW
Sbjct  61   NTDFGRLKRAANSQMCIRAGGKHNDLEDVGRDTYHHTFFEMLGSWSFGDYFKKEAIQWAW  120

Query  586  ELLTEVYKLP  615
            ELLTEVYKLP
Sbjct  121  ELLTEVYKLP  130



>emb|CDJ87289.1| Alanyl-tRNA synthetase and Threonyl alanyl tRNA synthetase and 
Phosphoesterase domain containing protein [Haemonchus contortus]
Length=986

 Score =   215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +  +++VR TFI+FF + KAHT V SS V+P +DPTLLFANAGMNQFKP+FLG  DPN++
Sbjct  21   QLTANEVRSTFIEFFKQKKAHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSD  80

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            L+KLKRA +TQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK E I WAWELL
Sbjct  81   LAKLKRAVNTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEVITWAWELL  140

Query  595  TEVYKLPAIR  624
            TEVY++PA R
Sbjct  141  TEVYEIPADR  150



>gb|AFR32146.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32147.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32148.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32149.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32150.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32151.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32152.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32154.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32156.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32158.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32159.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32160.1| alanyl-tRNA synthetase [Galactomyces candidum]
Length=979

 Score =   215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            WP+SKVR+TF+ +F+S  HT V SS V+P +DPTLLFANAGMNQ+KPIFLGTVDP++ L 
Sbjct  29   WPASKVRNTFLDYFKSNEHTFVPSSSVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSPLF  88

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI + WELLT+
Sbjct  89   KLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIAFGWELLTK  148

Query  601  VYKLPAIR  624
            VY +PA R
Sbjct  149  VYGIPADR  156



>ref|XP_009547440.1| hypothetical protein HETIRDRAFT_476425 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW80724.1| hypothetical protein HETIRDRAFT_476425 [Heterobasidion irregulare 
TC 32-1]
Length=959

 Score =   215 bits (547),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W +S++R  F  +F++K HT V SS  +P  DPTLLFANAGMNQ+KPIFLGTVDP+++LS
Sbjct  13   WTASRIRQEFFDYFQAKEHTFVPSSSTIPYEDPTLLFANAGMNQYKPIFLGTVDPHSDLS  72

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            KLKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EA+ ++WELLTE
Sbjct  73   KLKRAYNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAVHYSWELLTE  132

Query  601  VYKLPAIR  624
            VYKLP  R
Sbjct  133  VYKLPKDR  140



>emb|CDO95315.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=956

 Score =   214 bits (545),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W ++ VR TF+ FF+SK HT V SSPV+P  DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTATNVRTTFLDFFKSKGHTFVPSSPVIPYEDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI+++WELLT
Sbjct  68   YKLKRATNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIEYSWELLT  127

Query  598  EVYKLPAIR  624
            +VY +P  R
Sbjct  128  KVYGIPGDR  136



>emb|CDO74931.1| hypothetical protein BN946_scf184945.g3 [Trametes cinnabarina]
Length=956

 Score =   214 bits (545),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            WP++KVR+ F  +F+SK HT V SS  +P  DPTLLFANAGMNQFK IFLGTVDP +EL+
Sbjct  7    WPAAKVREEFFNYFKSKDHTYVPSSSTIPYEDPTLLFANAGMNQFKSIFLGTVDPQSELA  66

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            +LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLTE
Sbjct  67   RLKRAFNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIVYSWELLTE  126

Query  601  VYKLP  615
            VYKLP
Sbjct  127  VYKLP  131



>gb|EYB99703.1| hypothetical protein Y032_0120g894 [Ancylostoma ceylanicum]
Length=968

 Score =   214 bits (545),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 112/130 (86%), Gaps = 1/130 (1%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +  +++VR TFI+FF + KAHT V SS V+P +DPTLLFANAGMNQFKP+FLG  DPN++
Sbjct  3    QLTANEVRSTFIEFFKQKKAHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSD  62

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            L+KLKRA +TQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK E I WAWELL
Sbjct  63   LAKLKRAVNTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEIITWAWELL  122

Query  595  TEVYKLPAIR  624
            TEVY +PA R
Sbjct  123  TEVYGIPAER  132



>ref|XP_009493046.1| alanyl-tRNA synthetase [Fonticula alba]
 gb|KCV73345.1| alanyl-tRNA synthetase [Fonticula alba]
Length=957

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W   KVR TFI FFE + H+ V SS  +P +DPTLLF NAGMNQFKPIF GTVDPN+E S
Sbjct  11   WTGDKVRQTFISFFEERGHSFVPSSSTIPHDDPTLLFTNAGMNQFKPIFQGTVDPNSEFS  70

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            +LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK +AI WAWELLTE
Sbjct  71   RLKRAANSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKVDAINWAWELLTE  130

Query  601  VYKL  612
            V+ L
Sbjct  131  VFGL  134



>gb|EGD95966.1| alanyl-tRNA synthetase [Trichophyton tonsurans CBS 112818]
Length=963

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+ +VRDTF+ +F+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  16   VEWPALRVRDTFLDYFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  75

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAIQ++WELL
Sbjct  76   FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIQFSWELL  135

Query  595  TEVYKL  612
            T+VY L
Sbjct  136  TKVYGL  141



>gb|KIP06586.1| hypothetical protein PHLGIDRAFT_128168 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=951

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W S+KVR+ F  FF  + HT V SS  +P  DPTLLFANAGMNQFKPIFLG VDPN+ELS
Sbjct  5    WSSAKVREEFFNFFRERHHTFVPSSATIPYEDPTLLFANAGMNQFKPIFLGNVDPNSELS  64

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            KLKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI+++W LLT+
Sbjct  65   KLKRAFNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIEYSWALLTD  124

Query  601  VYKLP  615
            VYKLP
Sbjct  125  VYKLP  129



>gb|EGE01186.1| alanyl-tRNA synthetase [Trichophyton equinum CBS 127.97]
Length=963

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+ +VRDTF+ +F+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  16   VEWPALRVRDTFLDYFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  75

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAIQ++WELL
Sbjct  76   FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIQFSWELL  135

Query  595  TEVYKL  612
            T+VY L
Sbjct  136  TKVYGL  141



>dbj|BAP72231.1| alanyl-tRNA synthetase [Kluyveromyces marxianus]
Length=956

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W ++ VR TF+ +F+SK HT V SSPV+P +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTATNVRSTFLDYFKSKGHTFVPSSPVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI+++WELLT
Sbjct  68   YKLKRATNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIEYSWELLT  127

Query  598  EVYKLPAIR  624
            +VY +P  R
Sbjct  128  KVYGIPGDR  136



>dbj|BAO40758.1| alanyl-tRNA synthetase [Kluyveromyces marxianus DMKU3-1042]
Length=956

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W ++ VR TF+ +F+SK HT V SSPV+P +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTATNVRSTFLDYFKSKGHTFVPSSPVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI+++WELLT
Sbjct  68   YKLKRATNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIEYSWELLT  127

Query  598  EVYKLPAIR  624
            +VY +P  R
Sbjct  128  KVYGIPGDR  136



>gb|EZF33517.1| alanyl-tRNA synthetase [Trichophyton interdigitale H6]
 gb|KDB23468.1| alanyl-tRNA synthetase [Trichophyton interdigitale MR816]
Length=963

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+ +VRDTF+ +F+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  16   VEWPALRVRDTFLDYFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  75

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAIQ++WELL
Sbjct  76   FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIQFSWELL  135

Query  595  TEVYKL  612
            T+VY L
Sbjct  136  TKVYGL  141



>ref|XP_455190.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAG97897.1| KLLA0F02431p [Kluyveromyces lactis]
Length=956

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W ++ VR TF+ +F+SK HT V SSPV+P +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTAANVRSTFLDYFKSKGHTFVPSSPVIPFDDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI+++WELLT
Sbjct  68   YKLKRATNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIEYSWELLT  127

Query  598  EVYKLPAIR  624
            +VY +P  R
Sbjct  128  KVYGIPGDR  136



>gb|EIE82853.1| alanyl-tRNA synthetase [Rhizopus delemar RA 99-880]
Length=955

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP++KVR TF+KFFE   H  V SS  +P +DPTLLFANAGMNQFKP+FLGT+DPN+ L
Sbjct  3    EWPANKVRSTFVKFFEDNGHVFVPSSSTIPHDDPTLLFANAGMNQFKPMFLGTLDPNSPL  62

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            + +KRAC++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EA ++ WE LT
Sbjct  63   ANVKRACNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEATKFGWEFLT  122

Query  598  EVYKLPAIR  624
            +V  LP  R
Sbjct  123  KVINLPEDR  131



>ref|XP_007317881.1| hypothetical protein SERLADRAFT_361256 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO00200.1| hypothetical protein SERLA73DRAFT_107224 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO25759.1| hypothetical protein SERLADRAFT_361256 [Serpula lacrymans var. 
lacrymans S7.9]
Length=956

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W + KVRD F  +F SK HT V SS  +P  DPTLLFANAGMNQ+K IFLGTVDPN++++
Sbjct  9    WTAHKVRDEFFNYFRSKGHTFVPSSATIPYEDPTLLFANAGMNQYKSIFLGTVDPNSDMA  68

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            KLKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI+++WELLTE
Sbjct  69   KLKRAFNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIEYSWELLTE  128

Query  601  VYKLPAIR  624
            VY LP  R
Sbjct  129  VYGLPKDR  136



>ref|XP_004198838.1| Piso0_002228 [Millerozyma farinosa CBS 7064]
 emb|CCE82501.1| Piso0_002228 [Millerozyma farinosa CBS 7064]
Length=960

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W +SKVR TF+ FF++K HT V SS VVP NDP+LLFANAGMNQ+KPIFLGTVDP +E +
Sbjct  18   WTASKVRSTFLDFFKNKNHTFVPSSSVVPHNDPSLLFANAGMNQYKPIFLGTVDPGSEFA  77

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK +AI WAWELLTE
Sbjct  78   TLKRAVNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKDAIAWAWELLTE  137

Query  601  VYKLPAIR  624
             YKL   R
Sbjct  138  EYKLEKDR  145



>gb|EST08427.1| alanyl-tRNA synthetase [Pseudozyma brasiliensis GHG001]
Length=986

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP++KVRDTF  +F+ +AHT V SS  +P +DPTLLFANAGMNQ+KPIFLG  DPN+  
Sbjct  17   DWPATKVRDTFTGYFKERAHTFVPSSSTIPYDDPTLLFANAGMNQYKPIFLGVADPNSSF  76

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
              +KRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+ AWELLT
Sbjct  77   GSMKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEMAWELLT  136

Query  598  EVYKLPAIR  624
             VY LP  R
Sbjct  137  VVYGLPKDR  145



>ref|XP_002843973.1| alanyl-tRNA synthetase [Arthroderma otae CBS 113480]
 gb|EEQ34937.1| alanyl-tRNA synthetase [Arthroderma otae CBS 113480]
Length=963

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+ +VRDTF+ +F+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGT+DPN++
Sbjct  16   VEWPALRVRDTFLDYFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTIDPNSD  75

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAIQ++WELL
Sbjct  76   FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIQFSWELL  135

Query  595  TEVYKL  612
            T+VY L
Sbjct  136  TKVYGL  141



>ref|XP_003875608.1| putative alanyl-tRNA synthetase [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ27119.1| putative alanyl-tRNA synthetase [Leishmania mexicana MHOM/GT/2001/U1103]
Length=962

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  226  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  405
            M+  EWP S+VR  F+ +F+ + HT V  SPV P +DPTLLF NAGMNQFK +FLGT DP
Sbjct  1    MSFTEWPVSRVRQEFVDYFKKQGHTFVPGSPVCPHDDPTLLFINAGMNQFKALFLGTADP  60

Query  406  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  585
            NT+  +LKRA ++Q CIRAGGKHNDL+DVG+DTYHHTFFEMLG+WSFGDYFK EAIQWAW
Sbjct  61   NTDFGRLKRAANSQMCIRAGGKHNDLEDVGRDTYHHTFFEMLGSWSFGDYFKKEAIQWAW  120

Query  586  ELLTEVYKLP  615
            ELLTEVYKLP
Sbjct  121  ELLTEVYKLP  130



>ref|XP_006676752.1| hypothetical protein BATDEDRAFT_32863 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82402.1| hypothetical protein BATDEDRAFT_32863 [Batrachochytrium dendrobatidis 
JAM81]
Length=965

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP SKVR TFI +FE   HT V SS  +P  DPTL+FAN+GMNQFKPIFLGTVDPN++L
Sbjct  4    KWPLSKVRKTFIDYFEQHGHTHVVSSSTIPHGDPTLMFANSGMNQFKPIFLGTVDPNSDL  63

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            ++L RA ++QKCIRAGGKHNDL+DVG+DTYHHTFFEMLGNWSFG+YFKTEAI+ AWE+LT
Sbjct  64   ARLSRAANSQKCIRAGGKHNDLEDVGRDTYHHTFFEMLGNWSFGNYFKTEAIEMAWEILT  123

Query  598  EVYKLPAIR  624
            +VY LP  R
Sbjct  124  KVYGLPKDR  132



>ref|XP_003172403.1| alanyl-tRNA synthetase [Microsporum gypseum CBS 118893]
 gb|EFR01992.1| alanyl-tRNA synthetase [Microsporum gypseum CBS 118893]
Length=970

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP+ +VRDTF+ +F+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  16   VEWPALRVRDTFLDYFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  75

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAIQ++WELL
Sbjct  76   FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIQFSWELL  135

Query  595  TEVYKL  612
            T+VY L
Sbjct  136  TKVYGL  141



>gb|ESL08568.1| alanyl-tRNA synthetase [Trypanosoma rangeli SC58]
Length=959

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP  +VR  F+ FFE + HT V SS VVP NDPTLLF NAGMNQFK IFLGT DPNT+ 
Sbjct  3    EWPVGRVRREFLNFFEQRGHTFVPSSSVVPQNDPTLLFINAGMNQFKNIFLGTADPNTDF  62

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             +L R  ++Q CIRAGGKHNDLDDVG+DTYHHTFFEMLG+WSFGDYFK EAI+WAWELLT
Sbjct  63   GRLTRVVNSQLCIRAGGKHNDLDDVGRDTYHHTFFEMLGSWSFGDYFKREAIRWAWELLT  122

Query  598  EVYKLP  615
            EVYKLP
Sbjct  123  EVYKLP  128



>ref|XP_002615762.1| hypothetical protein CLUG_04644 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ40516.1| hypothetical protein CLUG_04644 [Clavispora lusitaniae ATCC 42720]
Length=964

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W +S VR TF+ +F++K+HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP +E +
Sbjct  18   WSASTVRSTFLDYFKNKSHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPTSEFA  77

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI ++WELLTE
Sbjct  78   TLKRAVNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIAYSWELLTE  137

Query  601  VYKLPAIR  624
            VYKL   R
Sbjct  138  VYKLDKDR  145



>ref|XP_001643652.1| hypothetical protein Kpol_1040p7 [Vanderwaltozyma polyspora DSM 
70294]
 gb|EDO15794.1| hypothetical protein Kpol_1040p7 [Vanderwaltozyma polyspora DSM 
70294]
Length=956

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W ++ VR+TF+ +F+SK H  V+SSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP++E  
Sbjct  9    WTAAVVRNTFLDYFKSKEHKFVRSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPSSEFY  68

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EA++++WELLT+
Sbjct  69   TLKRAYNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAVEYSWELLTQ  128

Query  601  VYKLPAIR  624
            VY +PA R
Sbjct  129  VYSIPADR  136



>gb|KGK39868.1| hypothetical protein JL09_g980 [Pichia kudriavzevii]
Length=1474

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP++KVRDTF+ +F+SK HT V SS V+P +DPTLLFANAGMNQ+KPIFLGTVDP++  
Sbjct  15   EWPAAKVRDTFLNYFKSKGHTFVPSSSVIPHDDPTLLFANAGMNQYKPIFLGTVDPSSSF  74

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            + LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK  AI+++WELLT
Sbjct  75   ANLKRAVNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKEGAIKYSWELLT  134

Query  598  EVYKLPAIR  624
            EVY +P  R
Sbjct  135  EVYGIPKDR  143



>ref|XP_011388270.1| putative alanine--tRNA ligase [Ustilago maydis 521]
 gb|KIS70162.1| putative alanine--tRNA ligase [Ustilago maydis 521]
Length=990

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP++KVRDTF  +F+ + HT V SS  +P +DPTLLFANAGMNQ+KPIFLG  DPN+  
Sbjct  21   DWPATKVRDTFTGYFQERKHTFVPSSSTIPYDDPTLLFANAGMNQYKPIFLGIADPNSSF  80

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
              +KRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+ AWELLT
Sbjct  81   GSMKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEMAWELLT  140

Query  598  EVYKLPAIR  624
            +VY LP  R
Sbjct  141  KVYGLPKDR  149



>gb|KDQ57564.1| hypothetical protein JAAARDRAFT_35260 [Jaapia argillacea MUCL 
33604]
Length=957

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W + KVRD F  +F SK HT V SSP +P  DPTLLFANAGMNQ+K IFLGTVDP++E++
Sbjct  10   WSARKVRDEFFNYFRSKDHTFVPSSPTIPYEDPTLLFANAGMNQYKAIFLGTVDPHSEMA  69

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            K KRA +TQKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAIQ++WELLTE
Sbjct  70   KWKRAFNTQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIQYSWELLTE  129

Query  601  VYKLPAIR  624
            VY LP  R
Sbjct  130  VYHLPKDR  137



>gb|KHN71931.1| Alanine--tRNA ligase, cytoplasmic [Toxocara canis]
Length=246

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  247  SSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSKL  426
            + +VR TFI+FF  + HT V SS V+P  DPTLLFANAGMNQFKPIFLGTV+P +EL++L
Sbjct  7    ADEVRSTFIRFFAEREHTYVHSSSVIPFEDPTLLFANAGMNQFKPIFLGTVEPCSELARL  66

Query  427  KRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTEVY  606
            +RA +TQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK E   WAWELLT+  
Sbjct  67   RRAVNTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEVCSWAWELLTKEL  126

Query  607  KLPA  618
             +PA
Sbjct  127  SIPA  130



>ref|XP_845193.1| alanyl-tRNA synthetase [Trypanosoma brucei brucei TREU927]
 gb|AAX80474.1| alanyl-tRNA synthetase, putative [Trypanosoma brucei]
 gb|AAZ11634.1| alanyl-tRNA synthetase, putative [Trypanosoma brucei brucei TREU927]
 emb|CBH11559.1| alanyl-tRNA synthetase, putative [Trypanosoma brucei gambiense 
DAL972]
Length=966

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP ++VR  F+ FFE + HT V SS VVP NDPTLLF NAGMNQFK +FLGT DPNT+ 
Sbjct  7    EWPVNRVRQEFVSFFEQRGHTFVPSSAVVPHNDPTLLFTNAGMNQFKNLFLGTADPNTDF  66

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             +L RA ++Q CIRAGGKHNDLDDVG+DTYHHTFFEMLG+WSFGDYFK EAI W+WELLT
Sbjct  67   GRLTRAVNSQLCIRAGGKHNDLDDVGRDTYHHTFFEMLGSWSFGDYFKREAILWSWELLT  126

Query  598  EVYKLPAIR  624
            EVYKLP  R
Sbjct  127  EVYKLPKDR  135



>gb|KIW56168.1| alanine-tRNA ligase [Exophiala xenobiotica]
Length=1051

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W +  VRDTF+K+FE + HT VKSSPVVPV+DPTLLF NAGMNQFKPIFLGTVDP ++ 
Sbjct  100  KWSAPVVRDTFLKYFEDRGHTFVKSSPVVPVSDPTLLFTNAGMNQFKPIFLGTVDPTSKE  159

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             + KRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFKTEAI ++WELLT
Sbjct  160  GQYKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKTEAITYSWELLT  219

Query  598  EVYKLPAIR  624
            +V+ L   R
Sbjct  220  KVFGLEPDR  228



>gb|KIV89764.1| alanine-tRNA ligase [Exophiala mesophila]
Length=1064

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W + +VRDTF+ FF+ + H  VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++ 
Sbjct  113  QWTAQEVRDTFLNFFQERGHAFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKE  172

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             + KRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI W+WELLT
Sbjct  173  GQYKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAINWSWELLT  232

Query  598  EVYKL  612
            +VY L
Sbjct  233  KVYGL  237



>emb|CCC48230.1| putative alanyl-tRNA synthetase [Trypanosoma vivax Y486]
Length=960

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +EWP S+VR  F+ FFE + HT V SS VVP +DPTLLFANAGMNQFK IFLG  DPNT+
Sbjct  1    MEWPVSRVRQEFVTFFEQRCHTFVPSSSVVPHDDPTLLFANAGMNQFKNIFLGAADPNTD  60

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
              +L RA ++Q CIRAGGKHNDLDDVG+DTYHHTFFEMLG+WSFGDYFK EAI+WAWELL
Sbjct  61   FGRLTRAVNSQMCIRAGGKHNDLDDVGRDTYHHTFFEMLGSWSFGDYFKREAIKWAWELL  120

Query  595  TEVYKLP  615
            TEV+K+P
Sbjct  121  TEVFKIP  127



>gb|KIV89765.1| alanine-tRNA ligase, variant 1 [Exophiala mesophila]
Length=1024

 Score =   213 bits (543),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W + +VRDTF+ FF+ + H  VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++ 
Sbjct  113  QWTAQEVRDTFLNFFQERGHAFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKE  172

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             + KRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI W+WELLT
Sbjct  173  GQYKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAINWSWELLT  232

Query  598  EVYKL  612
            +VY L
Sbjct  233  KVYGL  237



>ref|NP_593640.1| mitochondrial and cytoplasmic alanine-tRNA ligase Ala1 (predicted) 
[Schizosaccharomyces pombe 972h-]
 sp|O13914.1|SYA_SCHPO RecName: Full=Alanine--tRNA ligase; AltName: Full=Alanyl-tRNA 
synthetase; Short=AlaRS [Schizosaccharomyces pombe 972h-]
 emb|CAB11162.1| mitochondrial and cytoplasmic alanine-tRNA ligase Ala1 (predicted) 
[Schizosaccharomyces pombe]
Length=959

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            + WP++++R TF+K+FE   HT V SS V+P +DPTLLFANAGMNQFKPIFLGTVDP+++
Sbjct  8    VNWPANEIRRTFLKYFEDHGHTIVPSSSVIPYDDPTLLFANAGMNQFKPIFLGTVDPSSD  67

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
             +KLKRACD+QKCIRAGGKHNDL+DVGKD YHHT FEMLGNWSFGDYFK EAI  AW+LL
Sbjct  68   FAKLKRACDSQKCIRAGGKHNDLEDVGKDNYHHTMFEMLGNWSFGDYFKKEAIAMAWDLL  127

Query  595  TEVYKL  612
            T VY L
Sbjct  128  TNVYGL  133



>dbj|GAN03494.1| alanyl-tRNA synthetase [Mucor ambiguus]
Length=958

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 112/134 (84%), Gaps = 1/134 (1%)
 Frame = +1

Query  226  MAGL-EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            MAG  EWP++KVR TFIK+FE   H  V SS  +P +DPTLLFANAGMNQ+KPIFLGT+D
Sbjct  1    MAGQSEWPANKVRATFIKYFEDNGHVFVPSSSTIPHDDPTLLFANAGMNQYKPIFLGTLD  60

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PN+ L+ +KRAC++QKCIRAGGKHNDLDDVG+DTYHHTFFEMLGNWSFGDYFK EA ++ 
Sbjct  61   PNSPLANVKRACNSQKCIRAGGKHNDLDDVGRDTYHHTFFEMLGNWSFGDYFKLEATKFG  120

Query  583  WELLTEVYKLPAIR  624
            WE LT+V  LP  R
Sbjct  121  WEFLTKVINLPEDR  134



>ref|XP_002173036.1| cytoplasmic alanine-tRNA ligase Ala1 [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB06743.1| cytoplasmic alanine-tRNA ligase Ala1 [Schizosaccharomyces japonicus 
yFS275]
Length=961

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            LEWP++KVR TFI +F+   HT V SS V+P  DPTLLFANAGMNQ+KPIFLGTVDP++ 
Sbjct  7    LEWPANKVRSTFIDYFKEHGHTFVPSSSVIPFEDPTLLFANAGMNQYKPIFLGTVDPSSS  66

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
             +KLKRAC++QKCIRAGGKHNDL+DVGKD YHHT FEMLGNWSFGDYFK EAI  AW+LL
Sbjct  67   FAKLKRACNSQKCIRAGGKHNDLEDVGKDNYHHTMFEMLGNWSFGDYFKKEAIPLAWKLL  126

Query  595  TEVYKL  612
            TEV+KL
Sbjct  127  TEVFKL  132



>gb|EPB88726.1| alanyl-tRNA synthetase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=958

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 112/134 (84%), Gaps = 1/134 (1%)
 Frame = +1

Query  226  MAG-LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  402
            MAG  EWP++KVR TF+K+FE   H  V SS  +P +DPTLLFANAGMNQ+KPIFLGT+D
Sbjct  1    MAGQTEWPANKVRSTFVKYFEDNGHVFVPSSSTIPHDDPTLLFANAGMNQYKPIFLGTLD  60

Query  403  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  582
            PN+ L+ +KRAC++QKCIRAGGKHNDLDDVG+DTYHHTFFEMLGNWSFGDYFK EA ++ 
Sbjct  61   PNSPLANVKRACNSQKCIRAGGKHNDLDDVGRDTYHHTFFEMLGNWSFGDYFKLEATKFG  120

Query  583  WELLTEVYKLPAIR  624
            WE LT+V  LP  R
Sbjct  121  WEFLTKVINLPEDR  134



>ref|XP_007724363.1| alanyl-tRNA synthetase [Capronia coronata CBS 617.96]
 gb|EXJ88357.1| alanyl-tRNA synthetase [Capronia coronata CBS 617.96]
Length=962

 Score =   213 bits (541),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W ++KVRDTF+++FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++ 
Sbjct  11   QWTATKVRDTFLQYFEDRGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKE  70

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             +LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLT
Sbjct  71   GQLKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWELLT  130

Query  598  EVYKL  612
            + + L
Sbjct  131  KEFGL  135



>ref|XP_456501.2| DEHA2A03652p [Debaryomyces hansenii CBS767]
 emb|CAG84453.2| DEHA2A03652p [Debaryomyces hansenii CBS767]
Length=1021

 Score =   213 bits (542),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKA-HTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            WP+S+VR TF+ +F+ K  HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  77   WPASRVRSTFLDYFKVKQNHTFVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDF  136

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            S LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI W+WELLT
Sbjct  137  STLKRAVNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAISWSWELLT  196

Query  598  EVYKLPAIR  624
            EVYKL   R
Sbjct  197  EVYKLEQDR  205



>gb|KIW20001.1| alanine-tRNA ligase [Exophiala spinifera]
Length=962

 Score =   213 bits (541),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EW +  VRDTF+K+FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++ 
Sbjct  11   EWSAPVVRDTFLKYFEERGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKE  70

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             + KRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLT
Sbjct  71   GQYKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWELLT  130

Query  598  EVYKLPAIR  624
            +V+ L   R
Sbjct  131  KVFGLEPDR  139



>ref|XP_010699144.1| alanyl-tRNA synthetase, putative [Leishmania panamensis]
 gb|AIN98437.1| alanyl-tRNA synthetase, putative [Leishmania panamensis]
Length=962

 Score =   213 bits (541),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  226  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  405
            M+ +EWP S+VR  F+ +F+ + HT V  SPV P +DPTLLF NAGMNQFK +FLGT DP
Sbjct  1    MSFIEWPVSRVRQKFVDYFKKQGHTFVPGSPVCPHDDPTLLFINAGMNQFKTLFLGTADP  60

Query  406  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  585
            NT+  +LKR  ++Q CIRAGGKHNDL+DVG+DTYHHTFFEMLG+WSFGDYFK EAIQWAW
Sbjct  61   NTDFGRLKRVANSQMCIRAGGKHNDLEDVGRDTYHHTFFEMLGSWSFGDYFKKEAIQWAW  120

Query  586  ELLTEVYKLP  615
            ELLTEVYKLP
Sbjct  121  ELLTEVYKLP  130



>ref|XP_001565061.2| putative alanyl-tRNA synthetase [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CAM45216.2| putative alanyl-tRNA synthetase [Leishmania braziliensis MHOM/BR/75/M2904]
Length=962

 Score =   213 bits (541),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  226  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  405
            M+ +EWP S+VR  F+ +F+ + HT V  SPV P +DPTLLF NAGMNQFK +FLGT DP
Sbjct  1    MSFIEWPVSRVRQKFVDYFKKQGHTFVPGSPVCPHDDPTLLFINAGMNQFKTLFLGTADP  60

Query  406  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  585
            NT+  +LKR  ++Q CIRAGGKHNDL+DVG+DTYHHTFFEMLG+WSFGDYFK EAIQWAW
Sbjct  61   NTDFGRLKRVANSQMCIRAGGKHNDLEDVGRDTYHHTFFEMLGSWSFGDYFKKEAIQWAW  120

Query  586  ELLTEVYKLP  615
            ELLTEVYKLP
Sbjct  121  ELLTEVYKLP  130



>ref|XP_002839828.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ84019.1| unnamed protein product [Tuber melanosporum]
Length=959

 Score =   212 bits (540),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  226  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  405
            ++ +EWP+S VR TFI +F++  HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDP
Sbjct  5    LSTVEWPASLVRKTFIDYFKNNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDP  64

Query  406  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  585
            +++ + LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EA++++W
Sbjct  65   SSDFASLKRAANSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAVEYSW  124

Query  586  ELLTEVYKL  612
            ELLTE+Y L
Sbjct  125  ELLTEIYGL  133



>dbj|GAC93028.1| alanyl-tRNA synthetase [Pseudozyma hubeiensis SY62]
Length=1296

 Score =   214 bits (545),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP++KVRDTF  +F+ +AHT V SS  +P +DPTLLFANAGMNQ+KPIFLG  DPN+  
Sbjct  327  DWPATKVRDTFTGYFKERAHTFVPSSSTIPYDDPTLLFANAGMNQYKPIFLGIADPNSSF  386

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
              +KRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+ AWELLT
Sbjct  387  GSMKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEMAWELLT  446

Query  598  EVYKLPAIR  624
            +VY LP  R
Sbjct  447  KVYGLPKDR  455



>ref|XP_009159895.1| alanyl-tRNA synthetase [Exophiala dermatitidis NIH/UT8656]
 gb|EHY59434.1| alanyl-tRNA synthetase [Exophiala dermatitidis NIH/UT8656]
Length=1107

 Score =   213 bits (543),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EW + KVR+TF+K+FE + HT V+SSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++ 
Sbjct  153  EWTAPKVRETFLKYFEERGHTFVRSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKE  212

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             +LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLT
Sbjct  213  GQLKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIGYSWELLT  272

Query  598  EVYKL  612
            +V+ L
Sbjct  273  KVFGL  277



>ref|XP_004199688.1| Piso0_002228 [Millerozyma farinosa CBS 7064]
 emb|CCE81569.1| Piso0_002228 [Millerozyma farinosa CBS 7064]
Length=960

 Score =   212 bits (540),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W +SKVR TF+ FF++K HT V SS VVP NDP+LLFANAGMNQ+KPIFLGTVDP++E +
Sbjct  18   WTASKVRSTFLDFFKNKNHTFVPSSSVVPHNDPSLLFANAGMNQYKPIFLGTVDPSSEFA  77

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK +AI WAW+LLTE
Sbjct  78   TLKRAVNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKDAIAWAWKLLTE  137

Query  601  VYKLPAIR  624
             YKL   R
Sbjct  138  EYKLEKDR  145



>ref|XP_002552804.1| KLTH0D01848p [Lachancea thermotolerans]
 emb|CAR22366.1| KLTH0D01848p [Lachancea thermotolerans CBS 6340]
Length=955

 Score =   212 bits (539),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W +S VR TF++FF+ + HT V SSPV+P +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTASNVRSTFMEFFKQREHTFVASSPVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSDY  67

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
              LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK +AIQ++WELLT
Sbjct  68   YSLKRAMNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKDAIQYSWELLT  127

Query  598  EVYKLPAIR  624
            +VY +P+ R
Sbjct  128  KVYGIPSER  136



>gb|KIW23162.1| alanine-tRNA ligase [Cladophialophora immunda]
Length=1064

 Score =   213 bits (542),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EW + KVRDTF+K+FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP+++ 
Sbjct  113  EWSAPKVRDTFLKYFEDRGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPSSKE  172

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             + KR  ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLT
Sbjct  173  GQYKRVVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIIFSWELLT  232

Query  598  EVYKLPAIR  624
            +V+ L   R
Sbjct  233  QVFGLEPDR  241



>ref|XP_003676658.1| hypothetical protein NCAS_0E02290 [Naumovozyma castellii CBS 
4309]
 emb|CCC70299.1| hypothetical protein NCAS_0E02290 [Naumovozyma castellii CBS 
4309]
Length=956

 Score =   212 bits (539),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W +  VR+TF+ +F+SK HT V SSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTAQNVRNTFLDYFKSKEHTFVPSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
              LKRA ++QKC+RAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI +AWELLT
Sbjct  68   YTLKRAYNSQKCVRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIHYAWELLT  127

Query  598  EVYKLPAIR  624
             VY +PA R
Sbjct  128  VVYGIPADR  136



>ref|XP_500483.1| YALI0B04180p [Yarrowia lipolytica]
 emb|CAG82710.1| YALI0B04180p [Yarrowia lipolytica CLIB122]
Length=960

 Score =   212 bits (539),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = +1

Query  241  WPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            WP++KVR TF+ +F E +AH+ V SS V+P +DPTLLFANAGMNQ+KPIFLGT DP++ L
Sbjct  8    WPATKVRKTFLDYFGEKRAHSFVPSSSVIPYDDPTLLFANAGMNQYKPIFLGTCDPSSPL  67

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKL RA ++QKCIRAGGKHNDLDDVG+D+YHHTFFEMLGNWSFGDYFK EA  WAWELLT
Sbjct  68   SKLNRAANSQKCIRAGGKHNDLDDVGRDSYHHTFFEMLGNWSFGDYFKAEACAWAWELLT  127

Query  598  EVYKLPAIR  624
            +VY L A R
Sbjct  128  QVYGLDADR  136



>gb|KDR75441.1| hypothetical protein GALMADRAFT_249500 [Galerina marginata CBS 
339.88]
Length=956

 Score =   212 bits (539),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W +++VR  F  FF SK H  V SSP +P +DPTLLFANAGMNQ+K IFLGTVDP++++S
Sbjct  10   WTAARVRQQFFDFFRSKNHVFVPSSPTIPFDDPTLLFANAGMNQYKSIFLGTVDPHSDMS  69

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI ++WELLT+
Sbjct  70   KLKRAFNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKNEAIGYSWELLTQ  129

Query  601  VYKLPAIR  624
            VYKLPA R
Sbjct  130  VYKLPADR  137



>ref|XP_627438.1| alanyl-tRNA synthetase (with HxxxH domain) [Cryptosporidium parvum 
Iowa II]
 gb|EAK90114.1| alanyl-tRNA synthetase (with HxxxH domain) [Cryptosporidium parvum 
Iowa II]
Length=1003

 Score =   212 bits (540),  Expect = 7e-60, Method: Composition-based stats.
 Identities = 91/128 (71%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W   +VR  F+K+FE   HT  +SSPV+P+NDPT+LF NAGMNQFK IFLGTV+PN+ELS
Sbjct  21   WTGDEVRRQFVKYFEGLDHTFYRSSPVIPLNDPTILFINAGMNQFKSIFLGTVEPNSELS  80

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            KL R  ++QKCIRAGGKHNDLDDVGKD YHHTFFEMLG+WSFGDYFK EAI+WA++LLT+
Sbjct  81   KLVRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKEEAIEWAFKLLTQ  140

Query  601  VYKLPAIR  624
            VY +P  R
Sbjct  141  VYGIPKDR  148



>emb|CCF49697.1| probable ALA1-alanyl-tRNA synthetase, cytosolic [Ustilago hordei]
Length=985

 Score =   212 bits (539),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP++KVRDTF  +F+ +AHT V SS  +P +DP+LLFANAGMNQ+KPIFL   DPN+  
Sbjct  16   DWPATKVRDTFTGYFQKRAHTFVPSSSTIPYDDPSLLFANAGMNQYKPIFLSIADPNSSF  75

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
              +KRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+ AWELLT
Sbjct  76   GSMKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEMAWELLT  135

Query  598  EVYKLPAIR  624
             VY+LP  R
Sbjct  136  VVYRLPKDR  144



>gb|KIW83490.1| alanine-tRNA ligase [Fonsecaea pedrosoi CBS 271.37]
Length=963

 Score =   211 bits (538),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EW + KVRDTFIK+FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP+++ 
Sbjct  12   EWTAPKVRDTFIKYFEDRGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPSSKE  71

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             + +R  ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLT
Sbjct  72   GQYRRVVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAILFSWELLT  131

Query  598  EVYKLPAIR  624
             V+ L   R
Sbjct  132  GVFGLEPDR  140



>gb|KIK03536.1| hypothetical protein K443DRAFT_676709 [Laccaria amethystina LaAM-08-1]
Length=955

 Score =   211 bits (538),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            + W S +VR+ F  FF SK HT V SSP +P +DPTLLFANAGMNQ+K IFLGTVDP+++
Sbjct  8    VSWSSVRVREEFFNFFRSKNHTFVPSSPTIPFDDPTLLFANAGMNQYKSIFLGTVDPHSD  67

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            +S+LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELL
Sbjct  68   MSRLKRAFNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIAYSWELL  127

Query  595  TEVYKLPAIR  624
            T+VYKLP  R
Sbjct  128  TDVYKLPKDR  137



>ref|XP_665905.1| cytosolic tRNA-Ala synthetase [Cryptosporidium hominis TU502]
Length=989

 Score =   212 bits (539),  Expect = 9e-60, Method: Composition-based stats.
 Identities = 91/128 (71%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W   +VR  F+K+FE   HT  +SSPV+P+NDPT+LF NAGMNQFK IFLGTV+PN+ELS
Sbjct  9    WTGDEVRRQFVKYFEGLDHTFYRSSPVIPLNDPTILFINAGMNQFKSIFLGTVEPNSELS  68

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            KL R  ++QKCIRAGGKHNDLDDVGKD YHHTFFEMLG+WSFGDYFK EAI+WA++LLT+
Sbjct  69   KLVRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKEEAIEWAFKLLTQ  128

Query  601  VYKLPAIR  624
            VY +P  R
Sbjct  129  VYGIPKDR  136



>sp|Q5AQL1.2|SYA_EMENI RecName: Full=Alanine--tRNA ligase; AltName: Full=Alanyl-tRNA 
synthetase; Short=AlaRS [Aspergillus nidulans FGSC A4]
 tpe|CBF84773.1| TPA: alanyl-tRNA synthetase, putative (AFU_orthologue; AFUA_8G03880) 
[Aspergillus nidulans FGSC A4]
Length=961

 Score =   211 bits (538),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W S  VRDTF+++F+ K HT V SSPV P++DPTLLF NAGMNQFK IFLGTV+PN++ 
Sbjct  10   KWTSKLVRDTFLQYFQGKGHTFVASSPVAPLSDPTLLFTNAGMNQFKSIFLGTVNPNSDF  69

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            ++LK A ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAIQ++WELLT
Sbjct  70   AQLKSAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIQYSWELLT  129

Query  598  EVYKL  612
            +VY L
Sbjct  130  QVYGL  134



>ref|XP_001486846.1| hypothetical protein PGUG_00223 [Meyerozyma guilliermondii ATCC 
6260]
 gb|EDK36125.1| hypothetical protein PGUG_00223 [Meyerozyma guilliermondii ATCC 
6260]
Length=964

 Score =   211 bits (538),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESK-AHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            WP+SKVR TF+ +F+ K  H  V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP +E+
Sbjct  20   WPASKVRSTFLDYFKEKHGHQFVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASEM  79

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            S  KRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  80   STWKRAVNSQKCIRAGGKHNDLEDVGQDSYHHTFFEMLGNWSFGDYFKKEAIEWAWELLT  139

Query  598  EVYKLPAIR  624
            +VYKL   R
Sbjct  140  DVYKLDPDR  148



>emb|CDI53029.1| probable ALA1-alanyl-tRNA synthetase, cytosolic [Melanopsichium 
pennsylvanicum 4]
Length=985

 Score =   211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP++KVRDTF  +F+ + HT V SS  +P +DPTLLFANAGMNQ+KPIFLG  DPN+  
Sbjct  16   DWPATKVRDTFTGYFKQRQHTFVPSSSTIPYDDPTLLFANAGMNQYKPIFLGIADPNSAF  75

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
              +KRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+ AWELLT
Sbjct  76   GSMKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEMAWELLT  135

Query  598  EVYKLPAIR  624
             VY LP  R
Sbjct  136  VVYGLPKDR  144



>ref|XP_003957527.1| hypothetical protein KAFR_0E02390 [Kazachstania africana CBS 
2517]
 emb|CCF58392.1| hypothetical protein KAFR_0E02390 [Kazachstania africana CBS 
2517]
Length=956

 Score =   211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W ++ VR+TF+ +F SK H  +KSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP +E 
Sbjct  8    KWTATNVRNTFLNYFNSKEHKFIKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASEF  67

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
              LKRA ++QKC+RAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFKT+AI +AW+LLT
Sbjct  68   YTLKRAYNSQKCVRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKTDAIHYAWDLLT  127

Query  598  EVYKLPAIR  624
             VY +P  R
Sbjct  128  NVYGIPKDR  136



>ref|XP_007582290.1| putative alanyl-trna synthetase protein [Neofusicoccum parvum 
UCRNP2]
 gb|EOD50240.1| putative alanyl-trna synthetase protein [Neofusicoccum parvum 
UCRNP2]
Length=962

 Score =   211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP+ +VR TF+ FF+   HT V SS VVP++DPTLLF NAGMNQ+K IFLGTVDPN++ 
Sbjct  10   EWPAQRVRQTFLDFFKKNGHTFVPSSSVVPLSDPTLLFTNAGMNQYKSIFLGTVDPNSDF  69

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            + LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI+++WELLT
Sbjct  70   ATLKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIEYSWELLT  129

Query  598  EVYKL  612
            +VY L
Sbjct  130  KVYGL  134



>dbj|GAA89407.1| alanyl-tRNA synthetase [Aspergillus kawachii IFO 4308]
Length=961

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            LEW S +VRDTF+++F+   HT V SSPVVP +DPTLLF NAGMNQFK IFLGTVDP+++
Sbjct  9    LEWTSKRVRDTFLQYFKENGHTFVASSPVVPHSDPTLLFTNAGMNQFKSIFLGTVDPHSD  68

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
             + LK A +TQKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI+++WELL
Sbjct  69   FANLKSAVNTQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKEEAIRYSWELL  128

Query  595  TEVYKL  612
            T++Y L
Sbjct  129  TKIYGL  134



>gb|KIX01548.1| alanine-tRNA ligase [Rhinocladiella mackenziei CBS 650.93]
Length=962

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W +S VRDTF+KFFE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++  
Sbjct  12   WSASLVRDTFLKFFEERGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKEG  71

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            + +R  ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLT+
Sbjct  72   QYQRVVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWELLTK  131

Query  601  VYKLPAIR  624
            V+ L   R
Sbjct  132  VFGLEPDR  139



>ref|XP_002646367.1| C. briggsae CBR-ARS-2 protein [Caenorhabditis briggsae]
 emb|CAP31121.1| Protein CBR-AARS-2 [Caenorhabditis briggsae]
Length=967

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 109/127 (86%), Gaps = 1/127 (1%)
 Frame = +1

Query  247  SSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSK  423
            +S+VR TFI+FF E K HT V SS V+P +DPTLLFANAGMNQFKP+FLG  DPN++L+K
Sbjct  6    ASEVRSTFIEFFREKKNHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSDLAK  65

Query  424  LKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTEV  603
            LKRA +TQKCIRAGGKHNDLDDVGKD YHHT+FEMLGNWSFGDYFK E I WAWELLT V
Sbjct  66   LKRAVNTQKCIRAGGKHNDLDDVGKDVYHHTYFEMLGNWSFGDYFKKEIITWAWELLTTV  125

Query  604  YKLPAIR  624
            Y +PA R
Sbjct  126  YGIPAER  132



>gb|KIL68962.1| hypothetical protein M378DRAFT_71103 [Amanita muscaria Koide 
BX008]
Length=950

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  226  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  405
            M+ L W S +VR  F  +F S+ HT V SS  +P  DPTLLFANAGMNQFK IFLGTVDP
Sbjct  1    MSSLSWSSVRVRQEFFDYFRSRNHTHVPSSSTIPYEDPTLLFANAGMNQFKSIFLGTVDP  60

Query  406  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  585
            N++L+KLKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK +AI ++W
Sbjct  61   NSDLAKLKRAFNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKDAIAYSW  120

Query  586  ELLTEVYKLP  615
            ELLTEVY LP
Sbjct  121  ELLTEVYGLP  130



>gb|EGT52396.1| hypothetical protein CAEBREN_18885 [Caenorhabditis brenneri]
Length=966

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +  +S+VR TFI FF E K HT V SS V+P +DPTLLFANAGMNQFKP+FLG  DPN++
Sbjct  3    QLTASEVRSTFINFFREKKEHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSD  62

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            L+KLKRA +TQKCIRAGGKHNDLDDVGKD YHHT+FEMLGNWSFGDYFK E I WAWELL
Sbjct  63   LAKLKRAVNTQKCIRAGGKHNDLDDVGKDVYHHTYFEMLGNWSFGDYFKKEIITWAWELL  122

Query  595  TEVYKLPAIR  624
            T VY +PA R
Sbjct  123  TTVYGIPAER  132



>ref|XP_005709097.1| alanyl-tRNA synthetase [Galdieria sulphuraria]
 gb|EME32577.1| alanyl-tRNA synthetase [Galdieria sulphuraria]
Length=961

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W S +VR +FI FF  K H    SSPV+P  DPTLLF NAGMNQFKP+FLGTVDP + LS
Sbjct  2    WSSVQVRRSFIDFFVQKEHVFYPSSPVIPFEDPTLLFINAGMNQFKPVFLGTVDPTSPLS  61

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            KLKRAC++QKCIRAGGKHNDL+DVGKDTYHHTFFEMLGNWSFGDYFK EAI WA ELLT+
Sbjct  62   KLKRACNSQKCIRAGGKHNDLEDVGKDTYHHTFFEMLGNWSFGDYFKEEAIAWAMELLTQ  121

Query  601  VYKLPAIR  624
            V+ LP  R
Sbjct  122  VFGLPKER  129



>gb|EGT32559.1| hypothetical protein CAEBREN_22812 [Caenorhabditis brenneri]
Length=983

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            +  +S+VR TFI FF E K HT V SS V+P +DPTLLFANAGMNQFKP+FLG  DPN++
Sbjct  3    QLTASEVRSTFINFFREKKEHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSD  62

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
            L+KLKRA +TQKCIRAGGKHNDLDDVGKD YHHT+FEMLGNWSFGDYFK E I WAWELL
Sbjct  63   LAKLKRAVNTQKCIRAGGKHNDLDDVGKDVYHHTYFEMLGNWSFGDYFKKEIITWAWELL  122

Query  595  TEVYKLPAIR  624
            T VY +PA R
Sbjct  123  TTVYGIPAER  132



>ref|NP_491281.1| Protein AARS-2 [Caenorhabditis elegans]
 sp|O01541.1|SYAC_CAEEL RecName: Full=Alanine--tRNA ligase, cytoplasmic; AltName: Full=AlaRS 
A; AltName: Full=Alanyl-tRNA synthetase [Caenorhabditis 
elegans]
 emb|CCD70212.1| AARS-2 [Caenorhabditis elegans]
Length=968

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 108/127 (85%), Gaps = 1/127 (1%)
 Frame = +1

Query  247  SSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSK  423
            +S+VR TFI FF E K HT V SS V+P +DPTLLFANAGMNQFKP+FLG  DPN++L+K
Sbjct  6    ASEVRSTFINFFREKKEHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSDLAK  65

Query  424  LKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTEV  603
            LKRA +TQKCIRAGGKHNDLDDVGKD YHHT+FEMLGNWSFGDYFK E I WAWELLT V
Sbjct  66   LKRAVNTQKCIRAGGKHNDLDDVGKDVYHHTYFEMLGNWSFGDYFKKEIITWAWELLTTV  125

Query  604  YKLPAIR  624
            Y +PA R
Sbjct  126  YGIPAER  132



>ref|XP_007353910.1| hypothetical protein AURDEDRAFT_116636 [Auricularia delicata 
TFB-10046 SS5]
 gb|EJD37949.1| hypothetical protein AURDEDRAFT_116636 [Auricularia delicata 
TFB-10046 SS5]
Length=954

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EW +  VR  F  FFE   HT V+SS  +P  DPTLLFANAGMNQ+K IFLGTVDP ++L
Sbjct  9    EWSAKNVRKAFFDFFEKNGHTFVRSSSTIPHEDPTLLFANAGMNQYKSIFLGTVDPKSDL  68

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            +KLKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI W+W+LLT
Sbjct  69   AKLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITWSWQLLT  128

Query  598  EVYKLPAIR  624
            EVYKLP  R
Sbjct  129  EVYKLPKDR  137



>emb|CCW61998.1| unnamed protein product [Phytomonas sp. isolate EM1]
Length=964

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            LEW ++++R  FI FF  + HT V  S VVP+NDPTLLF NAGMNQFK IFLGT+DPNT+
Sbjct  6    LEWSAARIRQQFIDFFTERGHTFVPGSSVVPLNDPTLLFINAGMNQFKSIFLGTIDPNTD  65

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
              +L RA ++Q CIRAGGKHNDLDDVG DTYHHTFFEMLG+WSFGDYFK +AI WAWELL
Sbjct  66   FGRLTRAVNSQMCIRAGGKHNDLDDVGNDTYHHTFFEMLGSWSFGDYFKRDAIYWAWELL  125

Query  595  TEVYKLPAIR  624
            T+VYKLP  R
Sbjct  126  TDVYKLPKDR  135



>emb|CDH13133.1| probable ALA1-Alanyl-tRNA synthetase,cytosolic [Zygosaccharomyces 
bailii ISA1307]
Length=954

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W +  VRDT++ +F+SK HT V SSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  6    KWTAKNVRDTYLNYFKSKGHTFVPSSPVVPYDDPTLLFANAGMNQYKPIFLGTVDPSSDF  65

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK +AI +AW+LLT
Sbjct  66   YNLKRAHNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKDAIAYAWDLLT  125

Query  598  EVYKLPAIR  624
            +VY LP  R
Sbjct  126  KVYGLPEDR  134



>ref|XP_007291338.1| tRNA synthetase class II [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD18456.1| tRNA synthetase class II [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=949

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  405
            MA  +W +  VR TF++FFE+K HT V SS VVP NDPTLLF NAGMNQFKPIFLGTV  
Sbjct  1    MAQEKWTAPVVRKTFLEFFEAKGHTIVPSSSVVPHNDPTLLFTNAGMNQFKPIFLGTVGQ  60

Query  406  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  585
              +L++LKRA DTQKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI+ +W
Sbjct  61   TDDLAQLKRAVDTQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKQEAIEMSW  120

Query  586  ELLTEVYKLPAIR  624
            ELLT+VY L   R
Sbjct  121  ELLTKVYGLDPDR  133



>ref|XP_007759596.1| alanyl-tRNA synthetase [Cladophialophora yegresii CBS 114405]
 gb|EXJ57062.1| alanyl-tRNA synthetase [Cladophialophora yegresii CBS 114405]
Length=962

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W + KVRDTF+K+FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++  
Sbjct  12   WTAPKVRDTFLKYFEERGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKEG  71

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            + KR  ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLT+
Sbjct  72   QYKRVVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAITFSWELLTK  131

Query  601  VYKLPAIR  624
            V+ L   R
Sbjct  132  VFGLEPDR  139



>gb|KIX98796.1| alanine-tRNA ligase [Fonsecaea multimorphosa CBS 102226]
Length=959

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EW + KVR+TF+K+FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++ 
Sbjct  8    EWSAPKVRETFLKYFEDRGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKE  67

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             + KR  ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLT
Sbjct  68   GQYKRVVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAILFSWELLT  127

Query  598  EVYKLPAIR  624
            +V+ L   R
Sbjct  128  DVFGLEPDR  136



>gb|EGA72819.1| Ala1p [Saccharomyces cerevisiae AWRI796]
Length=648

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  598  EVYKLPAIR  624
            EVY +P  R
Sbjct  128  EVYGIPKDR  136



>ref|XP_007833565.1| Alanine--tRNA ligase [Pestalotiopsis fici W106-1]
 gb|ETS81791.1| Alanine--tRNA ligase [Pestalotiopsis fici W106-1]
Length=957

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EW   KVR TF  FF  + HT V S  VVP NDPTLLF NAGMNQFKPIFLGTV    +L
Sbjct  6    EWTGLKVRQTFFDFFAERGHTIVPSGSVVPHNDPTLLFTNAGMNQFKPIFLGTVASTDDL  65

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            SKLKRA DTQKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI W+WELLT
Sbjct  66   SKLKRAVDTQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAITWSWELLT  125

Query  598  EVYKLPAIR  624
            +VY L   R
Sbjct  126  KVYGLDPSR  134



>emb|CDH15032.1| probable ALA1-Alanyl-tRNA synthetase,cytosolic [Zygosaccharomyces 
bailii ISA1307]
Length=956

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W +  VRDT++ +F+SK HT V SSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTAKNVRDTYLNYFKSKGHTFVPSSPVVPYDDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK +AI +AW+LLT
Sbjct  68   YNLKRAHNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKDAIAYAWDLLT  127

Query  598  EVYKLPAIR  624
            +VY LP  R
Sbjct  128  KVYGLPEDR  136



>emb|CDF90599.1| ZYBA0S07-04786g1_1 [Zygosaccharomyces bailii CLIB 213]
Length=956

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W +  VRDT++ +F+SK HT V SSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTAKNVRDTYLNYFKSKGHTFVPSSPVVPYDDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK +AI +AW+LLT
Sbjct  68   YNLKRAHNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKDAIAYAWDLLT  127

Query  598  EVYKLPAIR  624
            +VY LP  R
Sbjct  128  KVYGLPEDR  136



>gb|EKG22385.1| Alanyl-tRNA synthetase class IIc [Macrophomina phaseolina MS6]
Length=963

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EW + +VRDTF+ +F+   HT V SS VVP++DPTLLF NAGMNQ+K IFLGTVDPN++ 
Sbjct  11   EWSAQRVRDTFLDYFKKNGHTFVPSSSVVPLSDPTLLFTNAGMNQYKSIFLGTVDPNSDF  70

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            + LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI+++WELLT
Sbjct  71   ATLKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIEYSWELLT  130

Query  598  EVYKL  612
            +VY L
Sbjct  131  KVYGL  135



>emb|CCW66342.1| unnamed protein product [Phytomonas sp. isolate Hart1]
Length=1002

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  235  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            LEWP+ ++R  FI FF  K H  V  SPV+P+NDP+LLF NAGMNQ+K IFLGT DPNT+
Sbjct  6    LEWPAVRIRRQFIDFFTEKVHDFVPGSPVIPLNDPSLLFINAGMNQYKSIFLGTADPNTD  65

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
              +LKRA ++Q CIRAGGKHNDLDDVG DTYHHTFFEMLG+WSFGDYFK  AI W+WELL
Sbjct  66   FGRLKRAVNSQMCIRAGGKHNDLDDVGNDTYHHTFFEMLGSWSFGDYFKRNAIYWSWELL  125

Query  595  TEVYKLPAIR  624
            TE+YKLP  R
Sbjct  126  TEIYKLPKER  135



>gb|KDQ33558.1| hypothetical protein PLEOSDRAFT_1091537 [Pleurotus ostreatus 
PC15]
Length=951

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W +  VR+ F +FF SK HT V SS  +P +DPTLLFANAGMNQ+K IFLGTVDP++++S
Sbjct  7    WTAPVVREAFFEFFRSKDHTFVPSSSTIPYDDPTLLFANAGMNQYKSIFLGTVDPHSDMS  66

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
            KLKRA +TQKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAIQ++WELLT+
Sbjct  67   KLKRAFNTQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIQYSWELLTD  126

Query  601  VYKLPAIR  624
            V+KLP  R
Sbjct  127  VFKLPKDR  134



>ref|XP_007803265.1| Alanine--tRNA ligase [Endocarpon pusillum Z07020]
 gb|ERF71107.1| Alanine--tRNA ligase [Endocarpon pusillum Z07020]
Length=962

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EW + +VR TF+ +F+ + HT V SS VVP++DPTLLF NAGMNQ+K IFLGTVDPN++ 
Sbjct  12   EWSAQRVRSTFLDYFKQRGHTFVPSSSVVPLSDPTLLFTNAGMNQYKSIFLGTVDPNSDF  71

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            + LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAIQ++WELLT
Sbjct  72   AHLKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIQYSWELLT  131

Query  598  EVYKL  612
            EVY L
Sbjct  132  EVYGL  136



>gb|EJK71470.1| hypothetical protein THAOC_07085 [Thalassiosira oceanica]
Length=1072

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            EWP  KVR TFI FFE   HT  +SSP VP +DPTLLF NAGMNQ+KP+FLGTVDPN E+
Sbjct  118  EWPMDKVRSTFISFFERNGHTFWRSSPCVPYDDPTLLFTNAGMNQYKPLFLGTVDPNVEM  177

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
            + LKRAC++QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK EAI+ AW+ LT
Sbjct  178  AGLKRACNSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAIEMAWKCLT  237

Query  598  EVYKL  612
            E + L
Sbjct  238  EEFGL  242



>gb|KIY44323.1| hypothetical protein FISHEDRAFT_77527 [Fistulina hepatica ATCC 
64428]
Length=949

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  247  SSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSKL  426
            S +VR  F  +F+++ H+ V+SSP +P +DPTLLFANAGMNQ+KP+FLGTVDPN++++KL
Sbjct  9    SREVRQKFFDYFQARGHSFVRSSPTIPYDDPTLLFANAGMNQYKPLFLGTVDPNSDMAKL  68

Query  427  KRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTEVY  606
            KRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLT+VY
Sbjct  69   KRAFNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIHYSWELLTDVY  128

Query  607  KLPAIR  624
            KLP  R
Sbjct  129  KLPKDR  134



>ref|XP_008725247.1| alanyl-tRNA synthetase [Cladophialophora carrionii CBS 160.54]
 gb|ETI25902.1| alanyl-tRNA synthetase [Cladophialophora carrionii CBS 160.54]
Length=962

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W + KVR+TF+K+FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP+++ 
Sbjct  11   QWTAPKVRETFLKYFEERGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPSSKE  70

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             + KR  ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLT
Sbjct  71   GQYKRVVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAITFSWELLT  130

Query  598  EVYKLPAIR  624
            +V+ L   R
Sbjct  131  KVFGLEPDR  139



>dbj|GAK63909.1| alanyl-tRNA synthetase [Pseudozyma antarctica]
Length=1050

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +WP++KVRDTF  +F+ + HT V SS  +P +DPTLLFANAGMNQ+KPIFLG  DPN+  
Sbjct  81   DWPATKVRDTFTAYFKERQHTFVPSSSTIPYDDPTLLFANAGMNQYKPIFLGIADPNSAF  140

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
              +KRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI  AWELLT
Sbjct  141  GSMKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKPEAIAMAWELLT  200

Query  598  EVYKLPAIR  624
            +VY LP  R
Sbjct  201  KVYGLPKDR  209



>ref|XP_001642960.1| hypothetical protein Kpol_1071p9 [Vanderwaltozyma polyspora DSM 
70294]
 gb|EDO15102.1| hypothetical protein Kpol_1071p9 [Vanderwaltozyma polyspora DSM 
70294]
Length=957

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  420
            W ++KVRDTF  +F+SK HT + SSPVVP +DPTLLFANAGMNQFK IFLGTVDP ++L 
Sbjct  11   WNANKVRDTFYDYFKSKNHTFISSSPVVPYDDPTLLFANAGMNQFKSIFLGTVDPTSKLY  70

Query  421  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  600
             LKRA ++QKCIRAGGKHNDL+DVGKD+YHHT+FEMLGNWSFGDYFK +AI ++W+LLT 
Sbjct  71   DLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTYFEMLGNWSFGDYFKNDAIVYSWDLLTN  130

Query  601  VYKLPAIR  624
            VYK+P  R
Sbjct  131  VYKIPKDR  138



>gb|KIW48370.1| alanine-tRNA ligase [Exophiala oligosperma]
Length=1047

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W +  VRDTF+K+FE + HT VKSSPVVP++DPTLLF NAGMNQFKPIFLGTVDP ++ 
Sbjct  96   KWSAPVVRDTFLKYFEDRGHTFVKSSPVVPLSDPTLLFTNAGMNQFKPIFLGTVDPTSKE  155

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
             + KRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLT
Sbjct  156  GQYKRAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWELLT  215

Query  598  EVYKLPAIR  624
            +V+ L   R
Sbjct  216  QVFGLEPDR  224



>ref|XP_007377582.1| alanyl-tRNA synthetase, cytoplasmic [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW30611.1| alanyl-tRNA synthetase, cytoplasmic [Spathaspora passalidarum 
NRRL Y-27907]
Length=959

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 110/130 (85%), Gaps = 1/130 (1%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            EW +SKVR TF+ FF + K HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++
Sbjct  13   EWTASKVRSTFLDFFTKKKGHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASD  72

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
             + LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI W+WELL
Sbjct  73   FASLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIDWSWELL  132

Query  595  TEVYKLPAIR  624
            T+VY L   R
Sbjct  133  TQVYGLDKDR  142



>emb|CCA72755.1| probable ALA1-alanyl-tRNA synthetase, cytosolic [Piriformospora 
indica DSM 11827]
Length=967

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 112/135 (83%), Gaps = 7/135 (5%)
 Frame = +1

Query  241  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQ-------FKPIFLGTV  399
            W ++KVR T+I+FFE K HT   SS  +P  DPTLLFANAGMNQ       +K +FLGTV
Sbjct  10   WTANKVRKTYIEFFEGKGHTFWPSSSTIPFEDPTLLFANAGMNQACLSRPIYKAVFLGTV  69

Query  400  DPNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQW  579
            DPN+++SKLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EA+ W
Sbjct  70   DPNSDMSKLKRAVNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKREALSW  129

Query  580  AWELLTEVYKLPAIR  624
            AWELLTEVYKLPA R
Sbjct  130  AWELLTEVYKLPADR  144



>ref|XP_445923.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG58842.1| unnamed protein product [Candida glabrata]
Length=956

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  417
            +W +  VR TF+ +FE K H  VKSSPVVP +DPTLLF NAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTAHNVRKTFMDYFEEKNHKYVKSSPVVPFDDPTLLFTNAGMNQYKPIFLGTVDPSSDF  67

Query  418  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  597
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI +AW+LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIDYAWKLLT  127

Query  598  EVYKLPAIR  624
            EVY +PA R
Sbjct  128  EVYGIPADR  136



>ref|XP_001417607.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95900.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=967

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 106/130 (82%), Gaps = 1/130 (1%)
 Frame = +1

Query  238  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  414
            EWPSS+VRDTF+ +F E + H    SSP VPVNDPTLLFANAGMNQ+KPIFLG  DP T 
Sbjct  27   EWPSSRVRDTFVNYFIEKQGHVNWPSSPAVPVNDPTLLFANAGMNQYKPIFLGKADPKTA  86

Query  415  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  594
             +KL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI  AW+LL
Sbjct  87   FAKLTRATNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGMAWDLL  146

Query  595  TEVYKLPAIR  624
            T VY L   R
Sbjct  147  TNVYGLAPDR  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380