BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS038G08

Length=604
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009613360.1|  PREDICTED: phospholipase D alpha 1-like            246   9e-73   Nicotiana tomentosiformis
emb|CDP10414.1|  unnamed protein product                                245   2e-72   Coffea canephora [robusta coffee]
ref|XP_009760786.1|  PREDICTED: phospholipase D alpha 1-like            243   8e-72   Nicotiana sylvestris
ref|XP_006367508.1|  PREDICTED: phospholipase D alpha 1-like isof...    241   1e-70   Solanum tuberosum [potatoes]
ref|NP_001289824.1|  uncharacterized protein LOC101257989               240   1e-70   
ref|XP_010325100.1|  PREDICTED: phospholipase D alpha 1-like isof...    240   1e-70   Solanum lycopersicum
ref|NP_001234863.1|  phospholipase PLDa2                                234   3e-68   
ref|XP_006367510.1|  PREDICTED: phospholipase D alpha 1-like            234   4e-68   Solanum tuberosum [potatoes]
ref|XP_011078373.1|  PREDICTED: phospholipase D alpha 1-like            233   7e-68   Sesamum indicum [beniseed]
dbj|BAE79735.1|  phospholipase D alpha 2                                221   2e-63   Arachis hypogaea [goober]
gb|EYU23016.1|  hypothetical protein MIMGU_mgv1a001487mg                216   6e-62   Erythranthe guttata [common monkey flower]
ref|XP_002517625.1|  phopholipase d alpha, putative                     215   2e-61   
sp|Q41142.1|PLDA1_RICCO  RecName: Full=Phospholipase D alpha 1; S...    215   2e-61   Ricinus communis
gb|AAB37305.1|  phospholipase D                                         215   2e-61   Ricinus communis
emb|CAB43063.1|  phospholipase D1                                       213   7e-61   Craterostigma plantagineum
ref|XP_007150746.1|  hypothetical protein PHAVU_005G177300g             213   8e-61   Phaseolus vulgaris [French bean]
ref|XP_010097235.1|  Phospholipase D alpha 1                            213   1e-60   Morus notabilis
ref|XP_004486668.1|  PREDICTED: phospholipase D alpha 1-like isof...    213   1e-60   
ref|XP_011073436.1|  PREDICTED: phospholipase D alpha 1                 211   4e-60   Sesamum indicum [beniseed]
ref|XP_003543677.1|  PREDICTED: phospholipase D alpha 1-like isof...    211   8e-60   Glycine max [soybeans]
gb|EPS65578.1|  hypothetical protein M569_09194                         208   4e-59   Genlisea aurea
emb|CAB43062.1|  phospholipase D2                                       208   4e-59   Craterostigma plantagineum
emb|CDY20148.1|  BnaA01g28540D                                          201   5e-59   Brassica napus [oilseed rape]
ref|XP_008454241.1|  PREDICTED: phospholipase D alpha 1                 207   1e-58   Cucumis melo [Oriental melon]
ref|XP_010254401.1|  PREDICTED: phospholipase D alpha 1-like            207   1e-58   Nelumbo nucifera [Indian lotus]
ref|XP_006385316.1|  phospholipase D family protein                     206   2e-58   
gb|ADA72022.1|  phospholipase D                                         206   2e-58   Jatropha curcas
ref|XP_003597894.1|  Phospholipase D alpha                              206   3e-58   Medicago truncatula
ref|XP_004156800.1|  PREDICTED: phospholipase D alpha 1-like            206   4e-58   
ref|XP_004152203.1|  PREDICTED: phospholipase D alpha 1-like            206   4e-58   Cucumis sativus [cucumbers]
ref|XP_009625689.1|  PREDICTED: phospholipase D alpha 1                 205   5e-58   Nicotiana tomentosiformis
ref|XP_009799916.1|  PREDICTED: phospholipase D alpha 1                 205   5e-58   Nicotiana sylvestris
sp|P93400.2|PLDA1_TOBAC  RecName: Full=Phospholipase D alpha 1; S...    205   5e-58   Nicotiana tabacum [American tobacco]
ref|XP_004506968.1|  PREDICTED: phospholipase D alpha 1-like            204   1e-57   
ref|XP_011081358.1|  PREDICTED: phospholipase D alpha 1                 204   2e-57   Sesamum indicum [beniseed]
ref|XP_009619857.1|  PREDICTED: phospholipase D alpha 1                 204   2e-57   
ref|XP_003604419.1|  Phospholipase D alpha                              202   2e-57   
tpg|DAA53241.1|  TPA: phospholipase D family protein                    191   2e-57   
ref|XP_003528334.1|  PREDICTED: phospholipase D alpha 1-like isof...    204   2e-57   
emb|CDY21865.1|  BnaC01g35830D                                          203   3e-57   Brassica napus [oilseed rape]
sp|P86387.1|PLDA1_CARPA  RecName: Full=Phospholipase D alpha 1; S...    203   3e-57   Carica papaya [mamon]
ref|XP_011008452.1|  PREDICTED: phospholipase D alpha 1-like            203   4e-57   Populus euphratica
sp|Q70EW5.2|PLDA1_CYNCA  RecName: Full=Phospholipase D alpha 1; S...    203   4e-57   Cynara cardunculus [cardoon]
gb|AES86616.2|  phospholipase D alpha 1                                 202   5e-57   Medicago truncatula
gb|AGN71006.1|  phospholipase D2                                        202   7e-57   Brassica napus [oilseed rape]
ref|XP_009115281.1|  PREDICTED: phospholipase D alpha 2                 201   1e-56   Brassica rapa
gb|AGV22364.1|  phospholipase D4                                        201   1e-56   Brassica napus [oilseed rape]
gb|KHN47766.1|  Phospholipase D alpha 1                                 201   2e-56   Glycine soja [wild soybean]
ref|XP_009146200.1|  PREDICTED: phospholipase D alpha 1                 201   2e-56   Brassica rapa
ref|XP_003531710.1|  PREDICTED: phospholipase D alpha 1-like isof...    201   2e-56   
gb|KHN01336.1|  Phospholipase D alpha 1                                 201   2e-56   Glycine soja [wild soybean]
sp|P55939.2|PLDA2_BRAOC  RecName: Full=Phospholipase D alpha 2; S...    201   2e-56   Brassica oleracea var. capitata
tpg|DAA53243.1|  TPA: phospholipase D family protein                    191   3e-56   
tpg|DAA53242.1|  TPA: phospholipase D family protein                    191   3e-56   
gb|AIE90138.1|  phospholipase D1                                        199   6e-56   Brassica napus [oilseed rape]
sp|O82549.1|PLDA1_BRAOC  RecName: Full=Phospholipase D alpha 1; S...    199   6e-56   Brassica oleracea var. capitata
gb|KDO48582.1|  hypothetical protein CISIN_1g004579mg                   198   6e-56   Citrus sinensis [apfelsine]
gb|AAG50297.1|  phospholipase PLDa3                                     198   9e-56   Solanum lycopersicum
gb|AGN71005.1|  phospholipase D1                                        199   1e-55   Brassica napus [oilseed rape]
ref|XP_006465340.1|  PREDICTED: phospholipase D alpha 1                 199   1e-55   Citrus sinensis [apfelsine]
ref|XP_006427267.1|  hypothetical protein CICLE_v10024917mg             199   1e-55   Citrus clementina [clementine]
ref|XP_011012164.1|  PREDICTED: phospholipase D alpha 1                 199   1e-55   Populus euphratica
emb|CBI36314.3|  unnamed protein product                                191   1e-55   Vitis vinifera
gb|KCW70692.1|  hypothetical protein EUGRSUZ_F03862                     197   1e-55   Eucalyptus grandis [rose gum]
ref|NP_001275827.1|  phospholipase D alpha                              198   2e-55   Citrus sinensis [apfelsine]
ref|XP_006356207.1|  PREDICTED: phospholipase D alpha 1-like isof...    198   2e-55   Solanum tuberosum [potatoes]
ref|XP_010063458.1|  PREDICTED: phospholipase D alpha 1                 198   2e-55   Eucalyptus grandis [rose gum]
emb|CDX97705.1|  BnaA05g23740D                                          198   2e-55   
emb|CDO98145.1|  unnamed protein product                                197   3e-55   Coffea canephora [robusta coffee]
ref|XP_004235964.1|  PREDICTED: phospholipase D alpha 1                 196   8e-55   Solanum lycopersicum
ref|XP_006364210.1|  PREDICTED: phospholipase D alpha 1-like isof...    196   8e-55   Solanum tuberosum [potatoes]
ref|XP_007135745.1|  hypothetical protein PHAVU_010G155000g             196   1e-54   Phaseolus vulgaris [French bean]
ref|NP_001234102.1|  phospholipase PLDa1                                196   1e-54   
gb|ABU54776.1|  phospholipase D alpha 1 precursor                       196   1e-54   Helianthus annuus
ref|XP_002299756.1|  phospholipase D family protein                     195   2e-54   Populus trichocarpa [western balsam poplar]
gb|ADP23922.1|  phospholipase D alpha                                   195   2e-54   Litchi chinensis [litchi]
ref|XP_008461111.1|  PREDICTED: phospholipase D alpha 1                 195   3e-54   
ref|XP_008805616.1|  PREDICTED: phospholipase D alpha 1-like            195   3e-54   Phoenix dactylifera
gb|AGV22363.1|  phospholipase D3                                        194   3e-54   Brassica napus [oilseed rape]
ref|XP_008792036.1|  PREDICTED: phospholipase D alpha 1                 194   3e-54   Phoenix dactylifera
gb|EYU21635.1|  hypothetical protein MIMGU_mgv1a001489mg                194   4e-54   Erythranthe guttata [common monkey flower]
gb|AHN53202.1|  phospholipase D alpha 1-like protein                    194   4e-54   Cocos nucifera
ref|XP_010322318.1|  PREDICTED: phospholipase PLDa1 isoform X1          194   5e-54   Solanum lycopersicum
sp|O04865.1|PLDA1_VIGUN  RecName: Full=Phospholipase D alpha 1; S...    194   6e-54   Vigna unguiculata
ref|XP_007150745.1|  hypothetical protein PHAVU_005G177200g             194   6e-54   Phaseolus vulgaris [French bean]
gb|ABB82551.1|  phospholipase D-alpha                                   194   8e-54   Cucumis melo var. inodorus [casaba melon]
ref|XP_010907269.1|  PREDICTED: phospholipase D alpha 1                 194   8e-54   Elaeis guineensis
ref|XP_010250112.1|  PREDICTED: phospholipase D alpha 1                 193   1e-53   
ref|XP_010687988.1|  PREDICTED: phospholipase D alpha 1-like            193   1e-53   
ref|XP_006842069.1|  hypothetical protein AMTR_s00078p00051300          193   2e-53   Amborella trichopoda
gb|KHG06123.1|  Phospholipase D alpha 1                                 192   2e-53   Gossypium arboreum [tree cotton]
ref|XP_002882959.1|  PLDALPHA1                                          192   2e-53   Arabidopsis lyrata subsp. lyrata
ref|NP_001267897.1|  phospholipase D alpha                              192   3e-53   Vitis vinifera
ref|XP_004171103.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    189   3e-53   
ref|NP_188194.1|  phospholipase D alpha 1                               192   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006643814.1|  PREDICTED: phospholipase D alpha 1-like            191   4e-53   Oryza brachyantha
ref|XP_010691149.1|  PREDICTED: phospholipase D alpha 1-like            191   7e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008673445.1|  PREDICTED: phospholipase D alpha 1 isoform X1      191   8e-53   Zea mays [maize]
gb|ACR35730.1|  unknown                                                 191   9e-53   Zea mays [maize]
gb|ACG63794.1|  phospholipase D alpha                                   191   9e-53   Gossypium arboreum [tree cotton]
gb|ACL53693.1|  unknown                                                 190   1e-52   Zea mays [maize]
ref|XP_009381115.1|  PREDICTED: phospholipase D alpha 1                 190   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008654846.1|  PREDICTED: phospholipase D family protein is...    190   1e-52   Zea mays [maize]
gb|ADY75750.1|  phospholipase D alpha                                   190   2e-52   Dimocarpus longan [longan]
ref|XP_006297003.1|  hypothetical protein CARUB_v10012996mg             190   2e-52   Capsella rubella
gb|KJB70611.1|  hypothetical protein B456_011G083000                    189   2e-52   Gossypium raimondii
ref|XP_007023176.1|  Phospholipase D alpha 2 isoform 3                  189   2e-52   
ref|XP_004135845.1|  PREDICTED: phospholipase D alpha 1-like            189   3e-52   
gb|ABN13537.2|  phospholipase D                                         189   3e-52   Cucumis sativus [cucumbers]
ref|XP_006406922.1|  hypothetical protein EUTSA_v10020083mg             189   3e-52   
gb|ACG63795.1|  phospholipase D alpha                                   189   4e-52   Gossypium raimondii
tpg|DAA53239.1|  TPA: phospholipase D family protein                    178   4e-52   
ref|XP_007023174.1|  Phospholipase D alpha 2 isoform 1                  189   4e-52   
ref|NP_001042153.1|  Os01g0172400                                       189   4e-52   
gb|EEC70024.1|  hypothetical protein OsI_00588                          189   4e-52   Oryza sativa Indica Group [Indian rice]
tpg|DAA53240.1|  TPA: phospholipase D family protein                    178   6e-52   
ref|XP_009408983.1|  PREDICTED: phospholipase D alpha 1-like            188   7e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003569355.1|  PREDICTED: phospholipase D alpha 1                 188   7e-52   Brachypodium distachyon [annual false brome]
gb|ACV70146.1|  phospholipase D                                         187   1e-51   Gossypium arboreum [tree cotton]
gb|ABX83202.2|  phospholipase D                                         187   1e-51   Lolium temulentum
ref|XP_010465563.1|  PREDICTED: phospholipase D alpha 1-like            187   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009348321.1|  PREDICTED: phospholipase D alpha 1                 187   1e-51   Pyrus x bretschneideri [bai li]
gb|AGW22212.1|  phospholipase D alpha                                   187   1e-51   Chorispora bungeana
ref|XP_010487412.1|  PREDICTED: phospholipase D alpha 1 isoform X2      187   1e-51   Camelina sativa [gold-of-pleasure]
ref|NP_001105686.1|  phospholipase D alpha 1                            187   2e-51   Zea mays [maize]
ref|XP_006364211.1|  PREDICTED: phospholipase D alpha 1-like isof...    187   2e-51   
gb|EYU24646.1|  hypothetical protein MIMGU_mgv1a001477mg                186   2e-51   Erythranthe guttata [common monkey flower]
ref|XP_010503392.1|  PREDICTED: phospholipase D alpha 1-like            186   5e-51   Camelina sativa [gold-of-pleasure]
dbj|BAA11136.1|  phospholipase D                                        185   7e-51   Oryza sativa Japonica Group [Japonica rice]
gb|EMT03624.1|  Phospholipase D alpha 1                                 185   8e-51   
ref|XP_008373955.1|  PREDICTED: phospholipase D alpha 1                 185   9e-51   
ref|XP_008360327.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    184   2e-50   Malus domestica [apple tree]
ref|XP_007217042.1|  hypothetical protein PRUPE_ppa001519mg             184   3e-50   Prunus persica
ref|XP_008243731.1|  PREDICTED: phospholipase D alpha 1                 184   3e-50   Prunus mume [ume]
gb|ACG80607.1|  phospholipase D alpha                                   183   3e-50   Prunus persica
emb|CDY63527.1|  BnaAnng18990D                                          176   7e-50   Brassica napus [oilseed rape]
ref|XP_009365415.1|  PREDICTED: phospholipase D alpha 1-like            182   8e-50   Pyrus x bretschneideri [bai li]
emb|CDM81985.1|  unnamed protein product                                181   2e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010462102.1|  PREDICTED: phospholipase D alpha 2                 181   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_004303313.1|  PREDICTED: phospholipase D alpha 1                 179   8e-49   Fragaria vesca subsp. vesca
ref|NP_001267764.1|  phospholipase D alpha 1-like                       179   1e-48   Setaria italica
ref|XP_002894388.1|  predicted protein                                  179   1e-48   Arabidopsis lyrata subsp. lyrata
gb|AAW83125.1|  phospholipase D alpha                                   179   1e-48   Fragaria x ananassa
ref|XP_010500864.1|  PREDICTED: phospholipase D alpha 2-like isof...    179   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010500868.1|  PREDICTED: phospholipase D alpha 2-like isof...    179   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006392903.1|  hypothetical protein EUTSA_v10011246mg             179   1e-48   Eutrema salsugineum [saltwater cress]
ref|XP_006306783.1|  hypothetical protein CARUB_v10008323mg             179   2e-48   
ref|XP_002443625.1|  hypothetical protein SORBIDRAFT_08g022520          178   3e-48   Sorghum bicolor [broomcorn]
ref|XP_007204652.1|  hypothetical protein PRUPE_ppa001528mg             178   3e-48   Prunus persica
gb|AAL48261.2|AF451979_1  phospholipase D1                              177   4e-48   Papaver somniferum
ref|XP_010925209.1|  PREDICTED: phospholipase D alpha 1-like            177   5e-48   Elaeis guineensis
gb|EPS60466.1|  hypothetical protein M569_14336                         177   5e-48   Genlisea aurea
ref|XP_008242775.1|  PREDICTED: phospholipase D alpha 1-like            177   8e-48   Prunus mume [ume]
emb|CDX87920.1|  BnaC06g09820D                                          171   1e-47   
gb|AAL48262.2|AF451980_1  phospholipase D2                              176   2e-47   Papaver somniferum
ref|XP_009123823.1|  PREDICTED: phospholipase D alpha 2-like            176   2e-47   Brassica rapa
ref|XP_010479770.1|  PREDICTED: phospholipase D alpha 2-like            176   2e-47   Camelina sativa [gold-of-pleasure]
emb|CDY47540.1|  BnaC03g69220D                                          176   2e-47   Brassica napus [oilseed rape]
ref|NP_175666.1|  phospholipase D alpha 2                               175   3e-47   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA53245.1|  TPA: phospholipase D family protein                    167   1e-46   
sp|O04883.1|PLDA1_PIMBR  RecName: Full=Phospholipase D alpha 1; S...    173   2e-46   Spuriopimpinella brachycarpa
ref|XP_002524502.1|  phopholipase d alpha, putative                     171   5e-46   
emb|CBI28204.3|  unnamed protein product                                170   9e-46   Vitis vinifera
ref|XP_011070230.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    171   1e-45   Sesamum indicum [beniseed]
ref|XP_010545768.1|  PREDICTED: phospholipase D alpha 1                 171   2e-45   Tarenaya hassleriana [spider flower]
tpg|DAA53246.1|  TPA: phospholipase D family protein                    169   2e-45   
ref|XP_010656428.1|  PREDICTED: phospholipase D alpha 1-like            171   2e-45   Vitis vinifera
emb|CBI28205.3|  unnamed protein product                                169   2e-45   Vitis vinifera
ref|XP_011017763.1|  PREDICTED: phospholipase D alpha 1-like            171   2e-45   Populus euphratica
gb|KDP32412.1|  hypothetical protein JCGZ_13337                         170   2e-45   Jatropha curcas
emb|CDY60551.1|  BnaA05g35700D                                          170   2e-45   Brassica napus [oilseed rape]
ref|XP_009144830.1|  PREDICTED: phospholipase D alpha 2                 170   2e-45   Brassica rapa
ref|XP_002325225.2|  hypothetical protein POPTR_0018s13110g             170   2e-45   Populus trichocarpa [western balsam poplar]
ref|XP_009787005.1|  PREDICTED: phospholipase D alpha 1-like isof...    169   4e-45   Nicotiana sylvestris
gb|EYU32345.1|  hypothetical protein MIMGU_mgv1a001383mg                169   6e-45   Erythranthe guttata [common monkey flower]
ref|XP_002282187.3|  PREDICTED: phospholipase D alpha 1-like            169   7e-45   Vitis vinifera
gb|AFW76092.1|  phospholipase D family protein                          166   2e-44   
ref|XP_008673447.1|  PREDICTED: phospholipase D alpha 1 isoform X2      167   3e-44   
ref|XP_008650412.1|  PREDICTED: phospholipase D alpha 1-like            166   3e-44   
ref|XP_006654096.1|  PREDICTED: phospholipase D alpha 1-like            167   4e-44   Oryza brachyantha
ref|XP_002440692.1|  hypothetical protein SORBIDRAFT_09g005220          166   4e-44   
ref|XP_008649399.1|  PREDICTED: phospholipase D alpha 1-like            166   7e-44   Zea mays [maize]
ref|XP_004965943.1|  PREDICTED: phospholipase D alpha 2-like            166   7e-44   Setaria italica
ref|NP_001054773.2|  Os05g0171000                                       164   1e-43   
gb|AFW77332.1|  phospholipase D family protein                          166   1e-43   
ref|XP_006656220.1|  PREDICTED: phospholipase D alpha 2-like            165   1e-43   Oryza brachyantha
gb|AAU44332.1|  hypothetical protein                                    164   3e-43   Oryza sativa Japonica Group [Japonica rice]
gb|EEC80931.1|  hypothetical protein OsI_23625                          164   4e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_008385550.1|  PREDICTED: phospholipase D alpha 1-like            164   5e-43   
ref|NP_001058017.1|  Os06g0604400                                       164   5e-43   
ref|XP_006859166.1|  hypothetical protein AMTR_s00070p00140920          151   7e-43   
gb|KCW70693.1|  hypothetical protein EUGRSUZ_F03862                     162   1e-42   Eucalyptus grandis [rose gum]
gb|KJB68102.1|  hypothetical protein B456_010G225600                    162   1e-42   Gossypium raimondii
ref|XP_003568837.1|  PREDICTED: phospholipase D alpha 1-like            162   2e-42   
ref|XP_009364028.1|  PREDICTED: phospholipase D alpha 1-like            162   3e-42   Pyrus x bretschneideri [bai li]
emb|CAN76339.1|  hypothetical protein VITISV_014670                     161   4e-42   Vitis vinifera
ref|XP_003563661.1|  PREDICTED: phospholipase D alpha 2-like            160   1e-41   Brachypodium distachyon [annual false brome]
dbj|BAA19466.1|  phospholipase D                                        159   2e-41   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85695.1|  predicted protein                                      159   2e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94103.1|  predicted protein                                      159   2e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT32202.1|  Phospholipase D alpha 2                                 159   3e-41   
gb|KJB70612.1|  hypothetical protein B456_011G083000                    158   4e-41   Gossypium raimondii
ref|XP_004287315.1|  PREDICTED: phospholipase D alpha 1-like            158   7e-41   Fragaria vesca subsp. vesca
emb|CDP13512.1|  unnamed protein product                                157   1e-40   Coffea canephora [robusta coffee]
emb|CDP13510.1|  unnamed protein product                                156   3e-40   Coffea canephora [robusta coffee]
ref|XP_002437251.1|  hypothetical protein SORBIDRAFT_10g023630          155   4e-40   Sorghum bicolor [broomcorn]
ref|XP_009368855.1|  PREDICTED: phospholipase D alpha 1-like            155   4e-40   Pyrus x bretschneideri [bai li]
ref|XP_010090252.1|  Phospholipase D alpha 1                            155   5e-40   
ref|NP_001146242.1|  uncharacterized protein LOC100279815               155   7e-40   Zea mays [maize]
ref|XP_002515518.1|  phopholipase d alpha, putative                     155   7e-40   Ricinus communis
dbj|BAJ93878.1|  predicted protein                                      154   8e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT24153.1|  Phospholipase D alpha 1                                 155   8e-40   
ref|XP_009407292.1|  PREDICTED: phospholipase D alpha 1-like            154   9e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009787006.1|  PREDICTED: phospholipase D alpha 1-like isof...    154   1e-39   Nicotiana sylvestris
gb|KHN22449.1|  Phospholipase D alpha 1                                 147   2e-39   Glycine soja [wild soybean]
ref|XP_009614730.1|  PREDICTED: phospholipase D alpha 1 {ECO:0000...    150   4e-38   Nicotiana tomentosiformis
ref|XP_011459180.1|  PREDICTED: phospholipase D alpha 1-like            150   4e-38   Fragaria vesca subsp. vesca
gb|KHN07080.1|  Phospholipase D alpha 1                                 150   4e-38   Glycine soja [wild soybean]
ref|XP_009758055.1|  PREDICTED: phospholipase D alpha 1-like            149   6e-38   Nicotiana sylvestris
ref|XP_004251821.1|  PREDICTED: phospholipase D alpha 1-like            149   8e-38   Solanum lycopersicum
ref|XP_006350007.1|  PREDICTED: phospholipase D alpha 1-like            149   9e-38   Solanum tuberosum [potatoes]
ref|XP_007013459.1|  Phospholipase D alpha 1                            149   1e-37   
ref|XP_010923204.1|  PREDICTED: phospholipase D alpha 1-like            149   1e-37   Elaeis guineensis
ref|XP_004984143.1|  PREDICTED: phospholipase D alpha 1-like isof...    149   2e-37   Setaria italica
ref|XP_008219493.1|  PREDICTED: phospholipase D alpha 1-like            148   2e-37   Prunus mume [ume]
ref|XP_004984141.1|  PREDICTED: phospholipase D alpha 1-like isof...    148   3e-37   Setaria italica
gb|AAC49274.1|  phospholipase D                                         147   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010648662.1|  PREDICTED: phospholipase D alpha 1-like            147   3e-37   Vitis vinifera
dbj|BAK02630.1|  predicted protein                                      147   4e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004984142.1|  PREDICTED: phospholipase D alpha 1-like isof...    147   4e-37   Setaria italica
ref|XP_004984144.1|  PREDICTED: phospholipase D alpha 1-like isof...    147   5e-37   Setaria italica
ref|XP_006656219.1|  PREDICTED: phospholipase D alpha 2-like            147   6e-37   Oryza brachyantha
ref|XP_008394091.1|  PREDICTED: phospholipase D alpha 1-like isof...    145   1e-36   
ref|XP_011039694.1|  PREDICTED: phospholipase D alpha 1-like            145   2e-36   Populus euphratica
ref|XP_006581357.1|  PREDICTED: phospholipase D alpha 1-like            145   2e-36   Glycine max [soybeans]
ref|XP_010228542.1|  PREDICTED: phospholipase D alpha 1-like isof...    145   2e-36   Brachypodium distachyon [annual false brome]
ref|XP_008394090.1|  PREDICTED: phospholipase D alpha 1-like isof...    145   3e-36   
gb|EPS71739.1|  hypothetical protein M569_03019                         144   3e-36   Genlisea aurea
gb|EMS46811.1|  Phospholipase D alpha 2                                 143   5e-36   Triticum urartu
tpg|DAA45660.1|  TPA: phospholipase D family protein                    142   2e-35   
ref|XP_010228543.1|  PREDICTED: phospholipase D alpha 1-like isof...    142   2e-35   
ref|XP_008673230.1|  PREDICTED: phospholipase D family protein is...    142   2e-35   
gb|KDO48581.1|  hypothetical protein CISIN_1g004579mg                   140   3e-35   Citrus sinensis [apfelsine]
ref|XP_008673211.1|  PREDICTED: phospholipase D family protein is...    142   4e-35   Zea mays [maize]
gb|EMT15739.1|  Phospholipase D alpha 2                                 141   4e-35   
ref|XP_007137028.1|  hypothetical protein PHAVU_009G093500g             142   4e-35   Phaseolus vulgaris [French bean]
gb|KDO48580.1|  hypothetical protein CISIN_1g004579mg                   140   9e-35   Citrus sinensis [apfelsine]
gb|EEE65981.1|  hypothetical protein OsJ_21905                          140   1e-34   Oryza sativa Japonica Group [Japonica rice]
emb|CAN81667.1|  hypothetical protein VITISV_017804                     139   2e-34   Vitis vinifera
ref|NP_001058015.1|  Os06g0604200                                       139   2e-34   
gb|KDP33596.1|  hypothetical protein JCGZ_07167                         138   7e-34   Jatropha curcas
ref|XP_007011867.1|  Phospholipase D alpha 1                            138   7e-34   
ref|XP_004138856.1|  PREDICTED: phospholipase D alpha 2-like            138   7e-34   
ref|XP_004501328.1|  PREDICTED: phospholipase D alpha 1-like isof...    137   1e-33   Cicer arietinum [garbanzo]
gb|AAF78754.1|AF271356_1  phospholipase D                               137   2e-33   Oryza sativa Indica Group [Indian rice]
ref|NP_001058016.1|  Os06g0604300                                       137   2e-33   
gb|AAF78755.1|AF271357_1  phospholipase D                               137   2e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_004160794.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    137   2e-33   
ref|XP_002964421.1|  hypothetical protein SELMODRAFT_82084              137   2e-33   Selaginella moellendorffii
ref|XP_002974536.1|  hypothetical protein SELMODRAFT_267774             136   3e-33   Selaginella moellendorffii
ref|XP_002963233.1|  hypothetical protein SELMODRAFT_165923             136   3e-33   Selaginella moellendorffii
ref|XP_009355736.1|  PREDICTED: phospholipase D alpha 1-like            136   3e-33   
ref|XP_008777837.1|  PREDICTED: phospholipase D alpha 1-like            136   4e-33   Phoenix dactylifera
ref|XP_003603407.1|  Phospholipase D alpha                              135   5e-33   Medicago truncatula
ref|XP_006657112.1|  PREDICTED: phospholipase D alpha 2-like            135   5e-33   
gb|KJB07619.1|  hypothetical protein B456_001G0333002                   135   8e-33   Gossypium raimondii
ref|XP_010050012.1|  PREDICTED: phospholipase D alpha 1-like            135   9e-33   
ref|XP_004501331.1|  PREDICTED: phospholipase D alpha 1-like isof...    135   1e-32   Cicer arietinum [garbanzo]
gb|KCW82853.1|  hypothetical protein EUGRSUZ_C04222                     134   1e-32   Eucalyptus grandis [rose gum]
emb|CBI21040.3|  unnamed protein product                                134   1e-32   Vitis vinifera
gb|KGN62948.1|  hypothetical protein Csa_2G381740                       134   2e-32   Cucumis sativus [cucumbers]
tpg|DAA45665.1|  TPA: phospholipase D family protein                    134   2e-32   
ref|XP_004501330.1|  PREDICTED: phospholipase D alpha 1-like isof...    134   3e-32   Cicer arietinum [garbanzo]
ref|XP_007225238.1|  hypothetical protein PRUPE_ppa001818mg             133   3e-32   
ref|XP_006650158.1|  PREDICTED: phospholipase D alpha 1-like            132   7e-32   Oryza brachyantha
ref|XP_003603403.1|  Phospholipase D alpha                              132   9e-32   Medicago truncatula
ref|XP_002967619.1|  hypothetical protein SELMODRAFT_231070             132   9e-32   Selaginella moellendorffii
ref|XP_008445210.1|  PREDICTED: phospholipase D alpha 1-like            132   9e-32   Cucumis melo [Oriental melon]
ref|XP_008660012.1|  PREDICTED: phospholipase D alpha 1-like            132   1e-31   
ref|XP_009151064.1|  PREDICTED: phospholipase D zeta                    130   4e-31   
ref|XP_002308663.2|  hypothetical protein POPTR_0006s27000g             130   5e-31   
ref|XP_006287080.1|  hypothetical protein CARUB_v10000238mg             129   8e-31   
ref|XP_006657113.1|  PREDICTED: phospholipase D alpha 2-like            129   8e-31   
gb|AAR87276.1|  putative phospholipase D                                129   1e-30   
ref|XP_004979743.1|  PREDICTED: phospholipase D alpha 2-like            129   1e-30   
ref|XP_007137027.1|  hypothetical protein PHAVU_009G093400g             129   2e-30   
ref|XP_006394788.1|  hypothetical protein EUTSA_v10003659mg             128   2e-30   
ref|XP_006581358.1|  PREDICTED: phospholipase D alpha 1-like            128   3e-30   
ref|NP_197919.1|  phospholipase D alpha 3                               127   3e-30   
ref|XP_010493792.1|  PREDICTED: phospholipase D zeta                    126   8e-30   
ref|XP_006394787.1|  hypothetical protein EUTSA_v10003665mg             126   1e-29   
ref|XP_010454864.1|  PREDICTED: phospholipase D zeta-like               126   1e-29   
ref|NP_001146559.1|  phospholipase D family protein                     125   1e-29   
ref|XP_010424312.1|  PREDICTED: phospholipase D zeta-like               125   1e-29   
ref|XP_009129965.1|  PREDICTED: phospholipase D zeta-like               125   2e-29   
emb|CDY05351.1|  BnaC02g40590D                                          125   2e-29   
emb|CDY05490.1|  BnaA02g32010D                                          125   2e-29   
gb|ACL53520.1|  unknown                                                 125   2e-29   
ref|XP_002874254.1|  predicted protein                                  125   3e-29   
gb|EEE59186.1|  hypothetical protein OsJ_11122                          124   8e-29   
ref|XP_010048204.1|  PREDICTED: phospholipase D alpha 1-like            123   1e-28   
ref|XP_010541603.1|  PREDICTED: phospholipase D zeta                    123   1e-28   
gb|EAY90307.1|  hypothetical protein OsI_11882                          122   2e-28   
ref|XP_010101275.1|  Phospholipase D alpha 1                            121   5e-28   
ref|XP_002451299.1|  hypothetical protein SORBIDRAFT_05g027210          120   2e-27   
ref|XP_009401714.1|  PREDICTED: phospholipase D alpha 1-like isof...    118   7e-27   
ref|XP_002992572.1|  hypothetical protein SELMODRAFT_186850             117   1e-26   
ref|XP_002972515.1|  hypothetical protein SELMODRAFT_441825             117   1e-26   
emb|CDX80505.1|  BnaC07g29390D                                          117   2e-26   
ref|XP_009401723.1|  PREDICTED: phospholipase D alpha 1-like isof...    116   2e-26   
gb|KDO61728.1|  hypothetical protein CISIN_1g003523mg                   114   2e-25   
ref|XP_006450437.1|  hypothetical protein CICLE_v10010712mg             114   2e-25   
ref|XP_007011868.1|  Phospholipase D alpha 2 isoform 1                  111   2e-24   
ref|XP_010696306.1|  PREDICTED: phospholipase D alpha 1-like            111   2e-24   
gb|KJB55001.1|  hypothetical protein B456_009G057800                    111   2e-24   
ref|XP_006483709.1|  PREDICTED: phospholipase D alpha 1-like            111   2e-24   
gb|EYU23014.1|  hypothetical protein MIMGU_mgv1a0192722mg               108   4e-24   
ref|XP_010942074.1|  PREDICTED: phospholipase D alpha 1-like            108   1e-23   
ref|XP_008810306.1|  PREDICTED: phospholipase D alpha 1-like            108   3e-23   
ref|XP_007011869.1|  Phospholipase D alpha 2 isoform 2                  107   3e-23   
ref|XP_001753756.1|  predicted protein                                  107   5e-23   
ref|XP_010325101.1|  PREDICTED: phospholipase D alpha 1-like isof...    106   8e-23   
ref|XP_001762942.1|  predicted protein                                  105   3e-22   
gb|KHN08131.1|  Phospholipase D alpha 1                               98.2    5e-22   
gb|ACN85289.1|  unknown                                                 101   1e-21   
emb|CDX88175.1|  BnaA06g27660D                                          102   2e-21   
ref|XP_001767482.1|  predicted protein                                  101   5e-21   
ref|XP_001753255.1|  predicted protein                                  100   1e-20   
gb|EEC83543.1|  hypothetical protein OsI_29158                        99.0    4e-20   
dbj|BAC98682.1|  putative phospholipase D alpha 1                     98.6    4e-20   
ref|NP_001061758.2|  Os08g0401800                                     98.6    5e-20   
gb|EEE68649.1|  hypothetical protein OsJ_27225                        98.6    5e-20   
gb|EMS68436.1|  Phospholipase D alpha 2                               98.2    7e-20   
gb|ACI96319.1|  putative phospholipase D alpha 1 precursor            92.8    2e-18   
gb|ACI96318.1|  putative phospholipase D alpha 1 precursor            92.4    3e-18   
gb|ACI96316.1|  putative phospholipase D alpha 1 precursor            92.4    3e-18   
gb|EMT22155.1|  Phospholipase D alpha 2                               93.2    4e-18   
gb|ACI96317.1|  putative phospholipase D alpha 1 precursor            92.0    5e-18   
gb|AFK37230.1|  unknown                                               86.7    7e-18   
gb|EAZ44767.1|  hypothetical protein OsJ_29399                        91.7    1e-17   
ref|NP_001234108.1|  phospholipase PLDb2                              91.3    2e-17   
ref|XP_003576533.1|  PREDICTED: phospholipase D alpha 1-like          90.9    2e-17   
ref|XP_004956847.1|  PREDICTED: phospholipase D alpha 1-like          90.9    2e-17   
ref|XP_007137026.1|  hypothetical protein PHAVU_009G093400g           90.5    2e-17   
ref|XP_010323957.1|  PREDICTED: phospholipase PLDb2 isoform X1        90.1    4e-17   
ref|XP_006339497.1|  PREDICTED: phospholipase D beta 1-like           89.4    9e-17   
gb|EYU36813.1|  hypothetical protein MIMGU_mgv1a001300mg              87.0    5e-16   
gb|EMS68435.1|  Phospholipase D alpha 2                               86.7    5e-16   
ref|NP_001063203.1|  Os09g0421300                                     86.7    5e-16   
ref|XP_010666738.1|  PREDICTED: phospholipase D delta-like            86.3    7e-16   
ref|XP_002320087.2|  hypothetical protein POPTR_0014s07070g           86.3    9e-16   
gb|EAZ09131.1|  hypothetical protein OsI_31401                        85.9    9e-16   
gb|EMT19808.1|  Phospholipase D alpha 2                               85.9    1e-15   
dbj|BAE79734.1|  phospholipase D alpha 1                              85.5    1e-15   
gb|AAP50498.1|  phospholipase D                                       85.5    1e-15   
ref|XP_011463800.1|  PREDICTED: uncharacterized protein LOC101313411  85.9    1e-15   
gb|KEH18997.1|  phospholipase D alpha 1                               85.1    2e-15   
ref|XP_011074721.1|  PREDICTED: phospholipase D delta-like            85.1    2e-15   
gb|ABR17779.1|  unknown                                               84.7    2e-15   
gb|KEH18998.1|  phospholipase D alpha 1                               84.7    2e-15   
gb|EMT21985.1|  Phospholipase D beta 1                                84.3    3e-15   
ref|XP_002462392.1|  hypothetical protein SORBIDRAFT_02g024910        84.0    5e-15   
ref|XP_006341798.1|  PREDICTED: phospholipase D beta 1-like           83.6    6e-15   
gb|KDP43704.1|  hypothetical protein JCGZ_22331                       83.6    6e-15   
ref|XP_008445312.1|  PREDICTED: phospholipase D delta-like            83.6    6e-15   
gb|EMS46791.1|  Phospholipase D beta 1                                83.2    7e-15   
ref|XP_006590738.1|  PREDICTED: phospholipase D delta-like            83.2    7e-15   
ref|XP_009381793.1|  PREDICTED: phospholipase D alpha 1-like          83.2    8e-15   
gb|EPS73398.1|  hypothetical protein M569_01343                       82.8    9e-15   
ref|XP_004143075.1|  PREDICTED: phospholipase D delta-like            82.8    1e-14   
ref|XP_002301317.2|  PHOSPHOLIPASE D BETA 1 family protein            82.8    1e-14   
gb|KGN62275.1|  hypothetical protein Csa_2G347140                     82.8    1e-14   
gb|EMS45543.1|  Phospholipase D beta 1                                82.4    1e-14   
ref|XP_004248573.2|  PREDICTED: phospholipase D gamma 1-like          82.4    2e-14   
ref|XP_009762579.1|  PREDICTED: phospholipase D beta 1-like           82.4    2e-14   
emb|CDP08909.1|  unnamed protein product                              82.4    2e-14   
ref|XP_009604374.1|  PREDICTED: phospholipase D beta 1-like           82.0    2e-14   
ref|XP_001755745.1|  predicted protein                                81.6    2e-14   
gb|KDO43384.1|  hypothetical protein CISIN_1g0011262mg                80.1    3e-14   
ref|XP_006396843.1|  hypothetical protein EUTSA_v10028422mg           81.3    3e-14   
ref|XP_002510602.1|  phospholipase d delta, putative                  80.9    4e-14   
ref|XP_009410696.1|  PREDICTED: phospholipase D delta-like            80.9    5e-14   
ref|XP_006341817.1|  PREDICTED: phospholipase D delta-like isofor...  80.9    5e-14   
ref|XP_011023457.1|  PREDICTED: phospholipase D beta 2-like isofo...  80.9    6e-14   
ref|XP_006341816.1|  PREDICTED: phospholipase D delta-like isofor...  80.5    6e-14   
ref|XP_011023456.1|  PREDICTED: phospholipase D beta 2-like isofo...  80.9    6e-14   
dbj|BAK05371.1|  predicted protein                                    80.5    6e-14   
ref|XP_010540447.1|  PREDICTED: phospholipase D gamma 1-like          80.5    6e-14   
ref|XP_003611170.1|  Phospholipase D                                  80.5    6e-14   
emb|CDP07340.1|  unnamed protein product                              78.2    1e-13   
ref|XP_004298731.1|  PREDICTED: phospholipase D beta 1-like           79.7    1e-13   
ref|XP_006573536.1|  PREDICTED: phospholipase D delta-like isofor...  79.3    1e-13   
ref|XP_010113283.1|  Phospholipase D delta                            79.7    1e-13   
ref|XP_010272594.1|  PREDICTED: phospholipase D beta 1-like           79.3    1e-13   
gb|EAZ03622.1|  hypothetical protein OsI_25760                        73.2    1e-13   
ref|XP_009766427.1|  PREDICTED: phospholipase D beta 1-like           79.3    1e-13   
ref|XP_002509685.1|  phospholipase d beta, putative                   79.3    2e-13   
ref|XP_008670197.1|  PREDICTED: phospholipase D alpha 1-like isof...  79.3    2e-13   
gb|KFK31940.1|  hypothetical protein AALP_AA6G179600                  79.3    2e-13   
ref|XP_003516537.1|  PREDICTED: phospholipase D delta-like isofor...  79.3    2e-13   
emb|CDY13284.1|  BnaC09g23720D                                        78.2    2e-13   
ref|XP_011083418.1|  PREDICTED: phospholipase D delta-like isofor...  79.0    2e-13   
ref|XP_011083417.1|  PREDICTED: phospholipase D delta-like isofor...  79.0    2e-13   
gb|EYU17554.1|  hypothetical protein MIMGU_mgv1a025612mg              79.0    2e-13   
ref|XP_009593225.1|  PREDICTED: phospholipase D beta 1-like           78.6    3e-13   
ref|XP_010068155.1|  PREDICTED: phospholipase D delta-like            77.0    3e-13   
ref|XP_011035015.1|  PREDICTED: phospholipase D beta 2-like           78.6    3e-13   
ref|XP_006287264.1|  hypothetical protein CARUB_v10000454mg           78.2    3e-13   
ref|XP_009796632.1|  PREDICTED: phospholipase D delta-like            78.2    3e-13   
ref|XP_010234931.1|  PREDICTED: phospholipase D beta 1-like           78.2    4e-13   
gb|KJB48276.1|  hypothetical protein B456_008G061600                  78.2    4e-13   
gb|AAN05432.1|  phospholipase D delta isoform 1b                      78.2    4e-13   
gb|EMT00669.1|  Phospholipase D beta 1                                78.2    4e-13   
gb|AAN34820.1|  phospholipase D delta isoform                         78.2    4e-13   
tpg|DAA39787.1|  TPA: phospholipase D family protein                  75.9    4e-13   
gb|KJB14350.1|  hypothetical protein B456_002G120800                  77.8    4e-13   
gb|KJB14349.1|  hypothetical protein B456_002G120800                  77.8    5e-13   
gb|ACB98704.1|  phospholipase D gamma 1                               77.8    5e-13   
ref|XP_011463799.1|  PREDICTED: phospholipase D gamma 1-like          77.8    5e-13   
ref|NP_192921.1|  phospholipase D gamma 3                             77.8    5e-13   
ref|NP_192922.1|  phospholipase D gamma 1                             77.4    6e-13   
gb|EMT16220.1|  Phospholipase D beta 1                                77.4    6e-13   
ref|XP_006435265.1|  hypothetical protein CICLE_v10000269mg           77.4    6e-13   
gb|KCW72878.1|  hypothetical protein EUGRSUZ_E01326                   77.4    6e-13   
ref|XP_009102711.1|  PREDICTED: phospholipase D gamma 1               77.4    7e-13   
gb|KDP36869.1|  hypothetical protein JCGZ_08160                       77.4    7e-13   
ref|XP_004248600.1|  PREDICTED: phospholipase D delta-like            77.4    7e-13   
emb|CDX86742.1|  BnaA09g21320D                                        77.4    7e-13   
ref|XP_010422137.1|  PREDICTED: phospholipase D gamma 1-like          77.4    7e-13   
ref|XP_002299568.2|  hypothetical protein POPTR_0001s08560g           76.6    7e-13   
ref|XP_010434095.1|  PREDICTED: phospholipase D gamma 1               77.0    8e-13   
ref|XP_010266912.1|  PREDICTED: phospholipase D delta                 77.0    8e-13   
gb|AES94127.2|  phospholipase D alpha 1                               77.0    8e-13   
ref|XP_003611169.1|  Phospholipase D                                  77.0    8e-13   
ref|XP_010455598.1|  PREDICTED: phospholipase D gamma 1-like          77.0    8e-13   
ref|XP_009600603.1|  PREDICTED: phospholipase D delta-like            77.0    8e-13   
gb|KDO43378.1|  hypothetical protein CISIN_1g0011262mg                77.0    9e-13   
ref|XP_010058437.1|  PREDICTED: phospholipase D gamma 1               77.0    9e-13   
ref|XP_006441123.1|  hypothetical protein CICLE_v10018583mg           77.0    9e-13   
ref|XP_006858490.1|  hypothetical protein AMTR_s00071p00126030        76.6    1e-12   
ref|XP_006491998.1|  PREDICTED: phospholipase D beta 1-like isofo...  77.0    1e-12   
ref|XP_004292929.1|  PREDICTED: phospholipase D delta-like            76.6    1e-12   
ref|XP_007134946.1|  hypothetical protein PHAVU_010G088900g           76.6    1e-12   
ref|XP_010272593.1|  PREDICTED: phospholipase D beta 1-like isofo...  76.3    1e-12   
gb|AER41636.1|  phospholipase+D                                       76.3    1e-12   
ref|XP_011029151.1|  PREDICTED: phospholipase D beta 1-like           76.3    1e-12   
ref|XP_010272589.1|  PREDICTED: phospholipase D beta 1-like isofo...  76.3    1e-12   
gb|KJB25734.1|  hypothetical protein B456_004G206700                  76.3    1e-12   
ref|XP_010272591.1|  PREDICTED: phospholipase D beta 1-like isofo...  76.3    1e-12   
ref|XP_004510892.1|  PREDICTED: phospholipase D beta 1-like           76.3    2e-12   
ref|XP_002874728.1|  PLDGAMMA1                                        76.3    2e-12   
gb|AER41602.1|  phospholipase+D                                       76.3    2e-12   
gb|AER41632.1|  phospholipase+D                                       76.3    2e-12   
gb|EEC81825.1|  hypothetical protein OsI_25571                        76.3    2e-12   
ref|NP_001059324.1|  Os07g0260400                                     76.3    2e-12   
gb|KJB25732.1|  hypothetical protein B456_004G206700                  75.9    2e-12   
gb|KJB25733.1|  hypothetical protein B456_004G206700                  75.9    2e-12   
ref|XP_010255577.1|  PREDICTED: phospholipase D beta 2-like isofo...  76.3    2e-12   
ref|XP_006285074.1|  hypothetical protein CARUB_v10006387mg           75.9    2e-12   
ref|XP_010255578.1|  PREDICTED: phospholipase D beta 2-like isofo...  76.3    2e-12   
gb|KEH36266.1|  phospholipase D alpha 1                               75.9    2e-12   
ref|XP_003603842.1|  Phospholipase D delta                            75.9    2e-12   
ref|XP_007051966.1|  Phospholipase D beta 1 isoform 2                 75.9    2e-12   
ref|XP_007046580.1|  Phospholipase D delta isoform 2                  75.9    2e-12   
ref|XP_007051965.1|  Phospholipase D beta 1 isoform 1                 75.9    2e-12   
gb|AEF58504.1|  phospholipase D delta                                 75.9    2e-12   
ref|XP_010446878.1|  PREDICTED: phospholipase D delta                 75.9    2e-12   
ref|XP_007046579.1|  Phospholipase D delta isoform 1                  75.9    2e-12   
ref|XP_009772650.1|  PREDICTED: phospholipase D beta 2-like           75.9    2e-12   
ref|XP_010526824.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...  75.9    2e-12   
ref|XP_002301946.1|  hypothetical protein POPTR_0002s01750g           75.5    2e-12   
gb|AER41647.1|  phospholipase+D                                       75.5    2e-12   
ref|XP_008670092.1|  PREDICTED: phospholipase D delta-like isofor...  75.5    3e-12   
gb|AAB87672.1|  phospholipase D-gamma                                 75.5    3e-12   
ref|XP_004500904.1|  PREDICTED: phospholipase D delta-like isofor...  75.5    3e-12   
ref|XP_002874727.1|  PLDGAMMA1                                        75.5    3e-12   
ref|XP_010108055.1|  Phospholipase D beta 1                           75.5    3e-12   
ref|XP_006581145.1|  PREDICTED: phospholipase D delta-like            75.5    3e-12   
ref|XP_008670089.1|  PREDICTED: phospholipase D delta-like isofor...  75.1    3e-12   
ref|XP_004500903.1|  PREDICTED: phospholipase D delta-like isofor...  75.1    3e-12   
ref|XP_011003096.1|  PREDICTED: phospholipase D delta-like            75.1    3e-12   
ref|XP_002306960.2|  hypothetical protein POPTR_0005s26730g           75.1    3e-12   
ref|XP_004956880.1|  PREDICTED: phospholipase D delta-like isofor...  75.1    4e-12   
ref|XP_010646652.1|  PREDICTED: phospholipase D delta-like            72.8    4e-12   
ref|XP_008221197.1|  PREDICTED: phospholipase D delta-like            75.1    4e-12   
gb|KHN04601.1|  Phospholipase D beta 1                                75.1    4e-12   
ref|XP_003529972.1|  PREDICTED: phospholipase D beta 1-like           75.1    4e-12   
ref|XP_002270350.2|  PREDICTED: phospholipase D delta-like            75.1    4e-12   
ref|XP_010529524.1|  PREDICTED: phospholipase D gamma 1               74.7    4e-12   
ref|XP_003612259.1|  Phospholipase D delta isoform                    75.1    4e-12   
gb|AES95217.2|  phospholipase D alpha 1                               74.7    5e-12   
ref|XP_003523254.1|  PREDICTED: phospholipase D delta-like            74.7    5e-12   
ref|XP_001773645.1|  predicted protein                                74.7    5e-12   
ref|XP_010244835.1|  PREDICTED: phospholipase D delta-like isofor...  74.7    5e-12   
ref|XP_010244834.1|  PREDICTED: phospholipase D delta-like isofor...  74.7    5e-12   
ref|XP_010244833.1|  PREDICTED: phospholipase D delta-like isofor...  74.7    5e-12   
ref|XP_010244830.1|  PREDICTED: phospholipase D delta-like isofor...  74.7    5e-12   
ref|XP_010053353.1|  PREDICTED: phospholipase D beta 1-like           74.7    5e-12   
ref|XP_009627346.1|  PREDICTED: phospholipase D gamma 1-like          74.7    5e-12   
gb|KHG08188.1|  Phospholipase D beta 1 -like protein                  74.7    5e-12   



>ref|XP_009613360.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana tomentosiformis]
Length=807

 Score =   246 bits (628),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LH  ++EVDKI T+    LF+K+V G E  +GFNKTASRLYATIDL+KARV
Sbjct  1    MAQILLHGTLHATIFEVDKIHTNFGKELFNKVVHGIEGAIGFNKTASRLYATIDLQKARV  60

Query  329  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  508
            GRTRLLDEHKNPRWYESFHIYCAHMA++V+F+VKVDNPIGAELIGRAY+P + LL GEEV
Sbjct  61   GRTRLLDEHKNPRWYESFHIYCAHMAADVIFTVKVDNPIGAELIGRAYLPVQELLDGEEV  120

Query  509  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            D+WL +LD +R P+H HSKIHVKLQF DV RE
Sbjct  121  DKWLEILDTERKPVHGHSKIHVKLQFFDVTRE  152



>emb|CDP10414.1| unnamed protein product [Coffea canephora]
Length=807

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LH  +YE+DK+K     NL HKIVEG ERVVGFN TASRLYAT+DLEKARV
Sbjct  1    MAQILLHGTLHATIYEIDKLKGGFGQNLLHKIVEGIERVVGFNNTASRLYATVDLEKARV  60

Query  329  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  508
            GRTRLL+   NPRWYESFHIYCAHMASNV+F+VKVDNPIGAELIGRAY+P + LLG EE+
Sbjct  61   GRTRLLEGDSNPRWYESFHIYCAHMASNVIFTVKVDNPIGAELIGRAYLPVQELLGEEEI  120

Query  509  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            D WLP+L +D  PIH HSKIHVK+Q+ DV RE
Sbjct  121  DRWLPILGDDHKPIHGHSKIHVKVQYFDVTRE  152



>ref|XP_009760786.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana sylvestris]
Length=807

 Score =   243 bits (621),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LH  ++EVDKI T+    LF+K+V G E  +GF+KTASRLYATIDL+KARV
Sbjct  1    MAQILLHGTLHATIFEVDKIHTNFGKELFNKVVHGIEGAIGFSKTASRLYATIDLQKARV  60

Query  329  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  508
            GRTRLL+EHKNPRWYESFHIYCAHMA++V+F+VK+DNPIGAELIGRAY+P R LL GEEV
Sbjct  61   GRTRLLNEHKNPRWYESFHIYCAHMAADVIFTVKIDNPIGAELIGRAYLPVRELLDGEEV  120

Query  509  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            D+WL +LD +R P+H HSKIHVKLQF DV RE
Sbjct  121  DKWLEILDTERKPVHGHSKIHVKLQFFDVTRE  152



>ref|XP_006367508.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006367509.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum tuberosum]
Length=807

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LHV ++EVDK++T+   ++F+K+V+G E  +GFNKTAS LYATIDL KARV
Sbjct  1    MAQILLHGTLHVTIFEVDKLRTNFGRDIFNKVVQGIEGAIGFNKTASTLYATIDLGKARV  60

Query  329  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  508
            GRTRLLDEHKNPRWYESFHIYCAHMAS+V+F+VK DNPIGAELIGRAY+P  RL+ GE V
Sbjct  61   GRTRLLDEHKNPRWYESFHIYCAHMASDVIFTVKADNPIGAELIGRAYLPVERLIDGEVV  120

Query  509  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            DEWL +LD +R P+  HSKIHVKLQ+ DV RE
Sbjct  121  DEWLEILDTERKPVQGHSKIHVKLQYFDVTRE  152



>ref|NP_001289824.1| uncharacterized protein LOC101257989 [Solanum lycopersicum]
 gb|AAG48162.1|AF154425_1 phospholipase D [Solanum lycopersicum]
Length=807

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LHV ++EVDK++T+    +F+K+V+G E  +GFNKTAS LYATIDL KARV
Sbjct  1    MAQILLHGTLHVTIFEVDKLRTNFGREIFNKVVQGIEGAIGFNKTASTLYATIDLGKARV  60

Query  329  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  508
            GRTRLLDEHKNPRWYESFHIYCAHMAS+VVF+VK DNPIGAELIGRAY+P  +L+ GE V
Sbjct  61   GRTRLLDEHKNPRWYESFHIYCAHMASDVVFTVKADNPIGAELIGRAYLPVEQLIVGEVV  120

Query  509  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            DEWL +LD +R P+H HSKIHVKLQ+ DV RE
Sbjct  121  DEWLEILDTERKPVHGHSKIHVKLQYFDVTRE  152



>ref|XP_010325100.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum lycopersicum]
Length=807

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LHV ++EVDK++T+    +F+K+V+G E  +GFNKTAS LYATIDL KARV
Sbjct  1    MAQILLHGTLHVTIFEVDKLRTNFGREIFNKVVQGIEGAIGFNKTASTLYATIDLGKARV  60

Query  329  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  508
            GRTRLLDEHKNPRWYESFHIYCAHMAS+VVF+VK DNPIGAELIGRAY+P  +L+ GE V
Sbjct  61   GRTRLLDEHKNPRWYESFHIYCAHMASDVVFTVKADNPIGAELIGRAYLPVEQLIVGEVV  120

Query  509  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            DEWL +LD +R P+H HSKIHVKLQ+ DV RE
Sbjct  121  DEWLEILDTERKPVHGHSKIHVKLQYFDVTRE  152



>ref|NP_001234863.1| phospholipase PLDa2 [Solanum lycopersicum]
 gb|AAG45486.1| phospholipase PLDa2 [Solanum lycopersicum]
Length=806

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ LLHG+LHV ++EVD++ T+   + F+K+V+G E  +GFNK ASRLYATIDL KARV
Sbjct  1    MAQFLLHGTLHVTIFEVDRLHTNFGRDFFNKVVQGIEGAIGFNKAASRLYATIDLGKARV  60

Query  329  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  508
            GRTRLLD+HKNPRWYESFHIYCAHMA+NV+ +VK DNPIGAE+IGRAY P ++LL GEEV
Sbjct  61   GRTRLLDDHKNPRWYESFHIYCAHMAANVIITVKFDNPIGAEVIGRAYFPVQQLLDGEEV  120

Query  509  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            DEWL +L+ +R P+H HSKIHVKLQ+ DV R+
Sbjct  121  DEWLEILNTERKPLHGHSKIHVKLQYFDVTRD  152



>ref|XP_006367510.1| PREDICTED: phospholipase D alpha 1-like [Solanum tuberosum]
Length=807

 Score =   234 bits (596),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ LLHG+LHV ++EVD++ T+   + F+K+V+G E  +GFNK ASRLYATIDL KARV
Sbjct  1    MAQFLLHGTLHVTIFEVDRLHTNFGRDFFNKVVQGIEGAIGFNKAASRLYATIDLGKARV  60

Query  329  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  508
            GRTRLLD+HKNPRWYESFHIYCAHMA+NV+ +VK DNPIGAE+IGRAY P ++LL GEEV
Sbjct  61   GRTRLLDDHKNPRWYESFHIYCAHMAANVIITVKFDNPIGAEVIGRAYFPVQQLLDGEEV  120

Query  509  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            DEWL +L+ ++ P+H HSKIHVKLQ+ DV RE
Sbjct  121  DEWLEILNTEQKPVHGHSKIHVKLQYFDVTRE  152



>ref|XP_011078373.1| PREDICTED: phospholipase D alpha 1-like [Sesamum indicum]
Length=808

 Score =   233 bits (594),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG LH  +YE+DK+ T  L   FHK+VEG E V+GF  TAS+LYATIDL KARV
Sbjct  1    MAQILLHGDLHATIYEIDKLHTGTLTKFFHKVVEGIEEVLGFGDTASKLYATIDLGKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTRLL  +H NPRWYESFHIYCAHMAS VVF+VKVDNPIGAELIGRAY+P   LL GEE
Sbjct  61   GRTRLLAHQHSNPRWYESFHIYCAHMASQVVFTVKVDNPIGAELIGRAYLPVEELLAGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD WL +L++D  PIH HSKIHVKLQF DV RE
Sbjct  121  VDRWLEILNDDHKPIHGHSKIHVKLQFYDVTRE  153



>dbj|BAE79735.1| phospholipase D alpha 2 [Arachis hypogaea]
 dbj|BAE79737.1| phospholipase D alpha 2 [Arachis hypogaea]
Length=807

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 127/153 (83%), Gaps = 2/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LHV +YEVDK+KT G  N+F K+V+  E  VGF K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDKLKTSG-GNVFTKLVQNIEETVGFGKGVTKLYATIDLEKARV  59

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ +H NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  60   GRTRIIEKDHSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEDVLDGEE  119

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD W+ +LD D+NPIH +SKIHVKLQ+ DV ++
Sbjct  120  VDRWVEILDEDKNPIHGNSKIHVKLQYFDVTKD  152



>gb|EYU23016.1| hypothetical protein MIMGU_mgv1a001487mg [Erythranthe guttata]
Length=810

 Score =   216 bits (551),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MA +LLHG LH  +YE+DK+       LFHK+VEG E V+GF +TAS+LYATIDL +ARV
Sbjct  1    MAHILLHGDLHATIYEIDKLHIGAASKLFHKVVEGVEEVLGFKETASKLYATIDLGQARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTRLL  EH NPRWYESFHIYCAH AS V+F++KVDNPIGAELIGRA++P   L+ G+E
Sbjct  61   GRTRLLKHEHTNPRWYESFHIYCAHTASQVIFTIKVDNPIGAELIGRAHIPVSDLMSGDE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D WLP+L  +  P+H H KIHVKL F DV RE
Sbjct  121  IDTWLPILHTNNKPVHGHPKIHVKLHFFDVARE  153



>ref|XP_002517625.1| phopholipase d alpha, putative [Ricinus communis]
 gb|EEF44789.1| phopholipase d alpha, putative [Ricinus communis]
Length=808

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+ LHG+LHV +YEVDK+ + G  + F K+VE  E  VGF K  S+LYATIDLEKARV
Sbjct  1    MAQISLHGTLHVTIYEVDKLHSGGGPHFFRKLVENIEETVGFGKGVSKLYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+L+ E  NPRWYESFH+YCAH ASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRILENEQSNPRWYESFHVYCAHQASNVIFTVKDDNPIGATLIGRAYVPVEELLDGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LD D+NP+HS SKIHVKLQ+ +V ++
Sbjct  121  IDRWVEILDEDKNPVHSGSKIHVKLQYFEVTKD  153



>sp|Q41142.1|PLDA1_RICCO RecName: Full=Phospholipase D alpha 1; Short=PLD 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1; Flags: Precursor [Ricinus communis]
 gb|AAB04095.1| phospholipase D [Ricinus communis]
Length=808

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+ LHG+LHV +YEVDK+ + G  + F K+VE  E  VGF K  S+LYATIDLEKARV
Sbjct  1    MAQISLHGTLHVTIYEVDKLHSGGGPHFFRKLVENIEETVGFGKGVSKLYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+L+ E  NPRWYESFH+YCAH ASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRILENEQSNPRWYESFHVYCAHQASNVIFTVKDDNPIGATLIGRAYVPVEELLDGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LD D+NP+HS SKIHVKLQ+ +V ++
Sbjct  121  IDRWVEILDEDKNPVHSGSKIHVKLQYFEVTKD  153



>gb|AAB37305.1| phospholipase D [Ricinus communis]
Length=808

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+ LHG+LHV +YEVDK+ + G  + F K+VE  E  VGF K  S+LYATIDLEKARV
Sbjct  1    MAQISLHGTLHVTIYEVDKLHSGGGPHFFRKLVENIEETVGFGKGVSKLYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+L+ E  NPRWYESFH+YCAH ASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRILENEQSNPRWYESFHVYCAHQASNVIFTVKDDNPIGATLIGRAYVPVEELLDGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LD D+NP+HS SKIHVKLQ+ +V ++
Sbjct  121  IDRWVEILDEDKNPVHSGSKIHVKLQYFEVTKD  153



>emb|CAB43063.1| phospholipase D1 [Craterostigma plantagineum]
Length=807

 Score =   213 bits (543),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LHV +YEVD++ + G  N F K+    E  VGF K   ++YA+IDLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDQLHSGGGGNFFTKLKANIEETVGFGKGTPKIYASIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P + +L GEE
Sbjct  61   GRTRMIEHEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYIPVQEILDGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LDND+NPI   SKIHVKLQ+ DV R+
Sbjct  121  IDRWVEILDNDKNPISGESKIHVKLQYFDVTRD  153



>ref|XP_007150746.1| hypothetical protein PHAVU_005G177300g [Phaseolus vulgaris]
 gb|ESW22740.1| hypothetical protein PHAVU_005G177300g [Phaseolus vulgaris]
Length=807

 Score =   213 bits (543),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 122/153 (80%), Gaps = 2/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LH  +YEVDK+K  G  N   KIV   E  VGF K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDKLKIGG-GNFLSKIVHNIEETVGFGKGVTKLYATIDLEKARV  59

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ EH NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  60   GRTRIIEKEHSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEILHGEE  119

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LD D+NPIH +SKIHVKLQ+ D+ ++
Sbjct  120  IDRWIEILDVDKNPIHGNSKIHVKLQYFDISKD  152



>ref|XP_010097235.1| Phospholipase D alpha 1 [Morus notabilis]
 gb|EXB67302.1| Phospholipase D alpha 1 [Morus notabilis]
Length=808

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MA +LLHGSLH  +YEVDK++  G  N F K+V+  +  VG     ++LYATIDLEKARV
Sbjct  1    MAHILLHGSLHATIYEVDKLRGKGGGNFFSKLVDNIQETVGLGDGVTKLYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ EH NPRW+ESFHIYCAH+ASNVVF+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  61   GRTRIIEKEHSNPRWFESFHIYCAHLASNVVFTVKDDNPIGATLIGRAYVPVADILDGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD W+ +LD D+NPIH +SKIHVKLQF DV ++
Sbjct  121  VDRWVEILDEDKNPIHGNSKIHVKLQFFDVTKD  153



>ref|XP_004486668.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Cicer arietinum]
 ref|XP_004486669.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Cicer arietinum]
 ref|XP_004486670.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Cicer arietinum]
Length=809

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG LH  +YEVDKIK  G  N+F KI +  E  +GF    ++LYATIDLEKARV
Sbjct  1    MAQILLHGFLHATIYEVDKIKNIGGRNIFSKIKQNFEETIGFGDGVTKLYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ EH NP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  61   GRTRIIEKEHTNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVEEVLGGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D+W+ +LD  +NPIH  SKIHVKLQF DV  +
Sbjct  121  IDKWVEILDEHKNPIHGDSKIHVKLQFFDVTHD  153



>ref|XP_011073436.1| PREDICTED: phospholipase D alpha 1 [Sesamum indicum]
 ref|XP_011073437.1| PREDICTED: phospholipase D alpha 1 [Sesamum indicum]
Length=808

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LH  +YEVD++   G  N   K +E  E  +GF K   ++YATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDRLHAGGGGNFLSKFMENVEEKIGFGKGTPKIYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRIIEKEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVHELLDGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD W+ +LD D+NPIH  SKIHV+LQF DV R+
Sbjct  121  VDRWVEILDEDKNPIHEGSKIHVRLQFFDVPRD  153



>ref|XP_003543677.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Glycine max]
 ref|XP_006595164.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Glycine max]
 gb|KHN44174.1| Phospholipase D alpha 1 [Glycine soja]
Length=807

 Score =   211 bits (536),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 122/153 (80%), Gaps = 2/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LH  +YEVDK+K  G  N   KIV+  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDKLKIGG-GNFLTKIVQNIEETVGIGKGVTKLYATIDLEKARV  59

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ E KNPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P + +L GEE
Sbjct  60   GRTRIIEKEIKNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVQEILHGEE  119

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LD  +NPIH HSKIHVKLQ+ DV ++
Sbjct  120  IDRWVEILDEHKNPIHGHSKIHVKLQYFDVSKD  152



>gb|EPS65578.1| hypothetical protein M569_09194 [Genlisea aurea]
Length=808

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LH  +YEVD++   G  N F K+ E  E  VG  K  S++YATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDRLHVGGGRNFFSKLKENFEEAVGIGKGTSKIYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ E +NPRWYESFHIYCAH+AS+V+F+VK +NPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRMIENEPENPRWYESFHIYCAHLASDVIFTVKDNNPIGATLIGRAYVPVSELLEGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LD D+NPIH  SKIHVKLQ+ DV R+
Sbjct  121  IDRWVEILDEDKNPIHGESKIHVKLQYFDVSRD  153



>emb|CAB43062.1| phospholipase D2 [Craterostigma plantagineum]
Length=807

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MA++LLHG+LHV VYEVD++   G  N+F K+    E  VGF K   ++YA+IDLEKARV
Sbjct  1    MARILLHGTLHVTVYEVDRLHAGGGGNIFSKLRANIEEKVGFGKGTPKIYASIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ E  NPRWYESFHIYCAH+ASN++F+VK DNPIGA LIGRAY+P R +L GEE
Sbjct  61   GRTRMIEHEPTNPRWYESFHIYCAHLASNIIFTVKDDNPIGATLIGRAYVPVRDVLDGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ LLDN++NPI   SKIHVKLQF DV R+
Sbjct  121  LDRWVELLDNNKNPIRGESKIHVKLQFFDVARD  153



>emb|CDY20148.1| BnaA01g28540D [Brassica napus]
Length=399

 Score =   201 bits (512),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 118/151 (78%), Gaps = 2/151 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ LLHG+LH  +YEVD + T GL + F  KI    E  +GF K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHTGGLSSGFLGKIRANVEEAIGFGKGETQLYATIDLQKAR  60

Query  326  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVINGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EV++W+ +LDNDRNPIH  SKIHVKLQ+  V
Sbjct  121  EVEKWVEILDNDRNPIHGESKIHVKLQYFGV  151



>ref|XP_008454241.1| PREDICTED: phospholipase D alpha 1 [Cucumis melo]
 gb|ABS86615.1| phospholipase D alpha [Cucumis melo var. inodorus]
Length=807

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 120/153 (78%), Gaps = 2/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MA +LLHG+LHV +YEVDK+ + G  N   ++VE  E  VGF +  +RLYATIDLEKARV
Sbjct  1    MAHILLHGTLHVTIYEVDKLHSGG-RNFLKQLVENVEEAVGFGRGITRLYATIDLEKARV  59

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR L+ EH NP+WYE+FHIYCAHMASN++F+VK DNPIGA LIGRAY+P R ++ G+E
Sbjct  60   GRTRRLEREHSNPKWYETFHIYCAHMASNIIFTVKDDNPIGATLIGRAYLPVREIIRGDE  119

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD+W+P+LD  + PI    KIHVKLQF DV ++
Sbjct  120  VDKWVPILDEQKKPIRGEPKIHVKLQFFDVTKD  152



>ref|XP_010254401.1| PREDICTED: phospholipase D alpha 1-like [Nelumbo nucifera]
 ref|XP_010254402.1| PREDICTED: phospholipase D alpha 1-like [Nelumbo nucifera]
Length=802

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 118/152 (78%), Gaps = 5/152 (3%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHGSLHV +YEVDK+ +      FH+IVE     +G  K   +LYAT+DLEKARV
Sbjct  1    MAQILLHGSLHVTIYEVDKLSSRH-GGFFHQIVEN----IGIGKGTPQLYATVDLEKARV  55

Query  329  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  508
            GRTR+L E+ NP+W ESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   +L GEEV
Sbjct  56   GRTRMLKENANPQWNESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYIPVEEILNGEEV  115

Query  509  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            D W+ +LD DRNPIH HSKIHV+LQF DV  +
Sbjct  116  DRWVEILDEDRNPIHGHSKIHVRLQFFDVTHD  147



>ref|XP_006385316.1| phospholipase D family protein [Populus trichocarpa]
 gb|ERP63113.1| phospholipase D family protein [Populus trichocarpa]
Length=808

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LHV ++EVDK+   G H   HK+VE     VG     S+LYATIDLE+ARV
Sbjct  1    MAQVLLHGTLHVTIFEVDKLGDGGGHGFLHKLVENIGEKVGIGDGISKLYATIDLERARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+L+ E  NPRW ESFHIYCAHMASN+VF+VK DNPIGA LIGRAY+P + ++ GEE
Sbjct  61   GRTRILEKEATNPRWNESFHIYCAHMASNIVFTVKDDNPIGATLIGRAYIPVQEIVDGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LD D+NPI S SKIHVKLQ+ DV ++
Sbjct  121  IDRWVEMLDEDKNPIQSSSKIHVKLQYFDVTKD  153



>gb|ADA72022.1| phospholipase D [Jatropha curcas]
 gb|KDP37092.1| hypothetical protein JCGZ_06148 [Jatropha curcas]
Length=808

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LH  +YEVDK+ + G  + F K++E  E  VGF K  ++LYATIDL KARV
Sbjct  1    MAQILLHGTLHATIYEVDKLHSGGGPHFFRKLMENIEETVGFGKGVTKLYATIDLGKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+L+ EH NPRWYESFHIYCAH AS+V+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRILENEHSNPRWYESFHIYCAHQASDVIFTVKDDNPIGATLIGRAYVPVEELLDGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LD ++NP+   SKIHVKLQ+ D+ ++
Sbjct  121  IDRWVEILDEEKNPVSGGSKIHVKLQYFDISKD  153



>ref|XP_003597894.1| Phospholipase D alpha [Medicago truncatula]
 gb|ABD28731.1| C2; Peptidase, cysteine peptidase active site [Medicago truncatula]
 gb|AES68145.1| phospholipase D alpha 1 [Medicago truncatula]
Length=809

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LH  ++EVDK+K  G  N+  KI +  E  VGF K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHATIFEVDKLKNIGGGNILSKIRQNFEETVGFGKGTTKLYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ EH NP+W ESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  61   GRTRIIEKEHVNPQWNESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVEEVLGGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD W+ +LD ++ PIH +SKIHVKLQF DV ++
Sbjct  121  VDRWVEILDVNKEPIHGNSKIHVKLQFFDVSKD  153



>ref|XP_004156800.1| PREDICTED: phospholipase D alpha 1-like [Cucumis sativus]
Length=807

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 120/153 (78%), Gaps = 2/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MA +L+HG+LHV +YEVDK+ + G  N   ++VE  E  VGF +  +RLYATIDLEKARV
Sbjct  1    MAHILIHGTLHVTIYEVDKLHSGG-RNFLKQLVENVEEAVGFGRGITRLYATIDLEKARV  59

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR L+ EH NP+WYE+FHIYCAHMASN++F+VK DNPIGA LIGRAY+P R ++ G+E
Sbjct  60   GRTRRLEREHSNPKWYETFHIYCAHMASNIIFTVKDDNPIGATLIGRAYLPVREIIRGDE  119

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD+W+P+LD  + PI    KIHVKLQF DV ++
Sbjct  120  VDKWVPILDESKKPIRGAPKIHVKLQFFDVTKD  152



>ref|XP_004152203.1| PREDICTED: phospholipase D alpha 1-like [Cucumis sativus]
 gb|KGN52888.1| hypothetical protein Csa_4G004970 [Cucumis sativus]
Length=807

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 120/153 (78%), Gaps = 2/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MA +L+HG+LHV +YEVDK+ + G  N   ++VE  E  VGF +  +RLYATIDLEKARV
Sbjct  1    MAHILIHGTLHVTIYEVDKLHSGG-RNFLKQLVENVEEAVGFGRGITRLYATIDLEKARV  59

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR L+ EH NP+WYE+FHIYCAHMASN++F+VK DNPIGA LIGRAY+P R ++ G+E
Sbjct  60   GRTRRLEREHSNPKWYETFHIYCAHMASNIIFTVKDDNPIGATLIGRAYLPVREIIRGDE  119

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD+W+P+LD  + PI    KIHVKLQF DV ++
Sbjct  120  VDKWVPILDESKKPIRGAPKIHVKLQFFDVTKD  152



>ref|XP_009625689.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
 ref|XP_009625690.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
 ref|XP_009625691.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
 ref|XP_009625692.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
Length=808

 Score =   205 bits (522),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LHV +YEVD ++ +G  + F KI E  E  +GF K    +YAT+DLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDNLQKEGGGHFFSKIKEHVEETIGFGKGTPAIYATVDLEKARV  60

Query  329  GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR + +E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRKIKNEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVEELLEGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D+W+ +LD + NPI   SKIHVKLQF DV R+
Sbjct  121  IDKWVEILDREMNPIAEGSKIHVKLQFFDVSRD  153



>ref|XP_009799916.1| PREDICTED: phospholipase D alpha 1 [Nicotiana sylvestris]
 ref|XP_009799917.1| PREDICTED: phospholipase D alpha 1 [Nicotiana sylvestris]
Length=808

 Score =   205 bits (522),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LHV +YEVD ++ +G  + F KI E  E  +G  K    +YAT+DLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDNLQKEGGGHFFSKIKEHVEETIGLGKGTPEIYATVDLEKARV  60

Query  329  GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR + +E KNPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRKIKNEPKNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVEELLEGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D+W+ +LD + NPI   SKIHVKLQF DV R+
Sbjct  121  IDKWVEILDREMNPIAEGSKIHVKLQFFDVSRD  153



>sp|P93400.2|PLDA1_TOBAC RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Nicotiana tabacum]
 emb|CAB06620.1| phospholipase D [Nicotiana tabacum]
Length=808

 Score =   205 bits (522),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LHV +YEVD ++ +G  + F KI E  E  +GF K    +YAT+DLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDNLQKEGGGHFFSKIKEHVEETIGFGKGTPAIYATVDLEKARV  60

Query  329  GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR + +E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRKIKNEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVEELLEGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D+W+ +LD + NPI   SKIHVKLQF DV R+
Sbjct  121  IDKWVEILDREMNPIAEGSKIHVKLQFFDVSRD  153



>ref|XP_004506968.1| PREDICTED: phospholipase D alpha 1-like [Cicer arietinum]
Length=793

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LH  +YEVDK++  G  N+F  I +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDKLQAGGGGNIFSMIRQNIEETVGIGKGVTKLYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ EH NP+WYESFHIYC H+ASN++F+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  61   GRTRIIENEHTNPKWYESFHIYCGHLASNIIFTVKDDNPIGATLIGRAYVPVDEILDGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LD ++NPI   SKIHVKLQ+ DV ++
Sbjct  121  IDRWVEILDEEKNPIPEGSKIHVKLQYFDVTKD  153



>ref|XP_011081358.1| PREDICTED: phospholipase D alpha 1 [Sesamum indicum]
Length=807

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 118/153 (77%), Gaps = 2/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            M+Q+LLHG+LH  ++EVD +K  G   +F K++E  E  VG  K  S+LYATIDLEK+RV
Sbjct  1    MSQILLHGTLHATIFEVDNLKGGG-GGIFSKLMENIEETVGIGKGVSQLYATIDLEKSRV  59

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTRL++ E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL G+E
Sbjct  60   GRTRLIENEPSNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVHDLLEGDE  119

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD W  +LD D+NPI   SKIHVKLQF D+ R+
Sbjct  120  VDRWAEILDEDKNPITEGSKIHVKLQFFDITRD  152



>ref|XP_009619857.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
Length=810

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MA +LLHG+LHV V+EVD+++  G  N F KI E  E  VG  K AS++YAT+DLEKARV
Sbjct  1    MAPILLHGTLHVTVHEVDRLREKGGGNFFSKIKETVEETVGVGKGASKIYATVDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ E  NPRW ESFHIYCAHMASNVVF+VK +N IGA LIGRAY+P   LL GEE
Sbjct  61   GRTRVIENEPSNPRWNESFHIYCAHMASNVVFTVKDNNSIGATLIGRAYLPVNELLEGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VDEW+ +LD D+NPI   SKIHV+LQF D+ R+
Sbjct  121  VDEWIEILDEDKNPIKEGSKIHVRLQFFDISRD  153



>ref|XP_003604419.1| Phospholipase D alpha [Medicago truncatula]
Length=665

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+ LHG+LH  +YEVDK+   G  N    I +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MAQIHLHGTLHATIYEVDKLNAGGGGNFLSMIKQNIEETVGLGKGVTKLYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ EH NP+WYESFHIYCAHMAS+++F+VK DNP+GA LIGRAY+PA  +L GEE
Sbjct  61   GRTRIIENEHTNPKWYESFHIYCAHMASDIIFTVKDDNPVGATLIGRAYVPAEEVLNGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LD ++NPI   SKIHVKLQ+ DV ++
Sbjct  121  IDRWVEILDTEKNPIQEGSKIHVKLQYFDVTKD  153



>tpg|DAA53241.1| TPA: phospholipase D family protein, partial [Zea mays]
Length=202

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 119/158 (75%), Gaps = 7/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKD  157



>ref|XP_003528334.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Glycine max]
 ref|XP_006583126.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Glycine max]
Length=809

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 120/154 (78%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ+LLHG+LH  ++EVD++   G   N F K+ +  E  VG  K  ++LYATIDLEKAR
Sbjct  1    MAQILLHGTLHATIFEVDRLNAGGGGGNFFSKLKQNFEETVGIGKGVTKLYATIDLEKAR  60

Query  326  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR+++ EH NPRWYESFHIYCAHMASN+VF+VK DNPIGA LIGRAY+P   +L GE
Sbjct  61   VGRTRIIENEHTNPRWYESFHIYCAHMASNIVFTVKDDNPIGATLIGRAYVPVSEVLDGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            E+D W+ +LD ++NPIH  SKIHVKLQ+ DV ++
Sbjct  121  EIDRWVEILDEEKNPIHEGSKIHVKLQYFDVTKD  154



>emb|CDY21865.1| BnaC01g35830D [Brassica napus]
Length=812

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 118/152 (78%), Gaps = 3/152 (2%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHN--LFHKIVEGAERVVGFNKTASRLYATIDLEKA  322
            MAQ LLHG+LH  +YEVD + T GL +     KI+   E  VGF K  ++LYATIDL+KA
Sbjct  1    MAQHLLHGTLHATIYEVDALHTGGLRSAGFLGKIISNVEETVGFGKGETQLYATIDLQKA  60

Query  323  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  499
            RVGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ G
Sbjct  61   RVGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVING  120

Query  500  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EEV++W+ +LDNDRNPIH  SKIHVKLQ+  V
Sbjct  121  EEVEKWVEILDNDRNPIHGESKIHVKLQYFGV  152



>sp|P86387.1|PLDA1_CARPA RecName: Full=Phospholipase D alpha 1; Short=CpPLD1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Carica papaya]
Length=808

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MA  L+HG+LH  VYEVDK+ + G+   F KI+   E  +G  K  ++LYATIDLE+ARV
Sbjct  1    MAHYLMHGTLHATVYEVDKLHSGGISGFFGKILANVEGTIGIGKGVTQLYATIDLERARV  60

Query  329  GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR++ DE  NP+WYESFHIYCAHMASNVVF+VK DNPIGA LIGRAY+P   L+ G++
Sbjct  61   GRTRIIKDEPNNPKWYESFHIYCAHMASNVVFTVKDDNPIGATLIGRAYVPVEELIRGDQ  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD W+ +LD D+NPI   SKIHVKLQF DV ++
Sbjct  121  VDRWVEILDEDKNPIEGDSKIHVKLQFFDVKKD  153



>ref|XP_011008452.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
 ref|XP_011008453.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
Length=808

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LHV ++EVDK+   G H    K+VE     VG     S+LYATIDLE+ARV
Sbjct  1    MAQILLHGTLHVTIFEVDKLGDGGGHGFLRKLVENIGEKVGIGDGISKLYATIDLERARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+L+ E  NPRW ESFHIYCAHMASN+VF+VK DNPIGA LIGRAY+P + ++ GEE
Sbjct  61   GRTRILEKEATNPRWNESFHIYCAHMASNIVFTVKDDNPIGATLIGRAYIPVQEIVDGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LD D+NPI S SKIHVKLQ+ DV ++
Sbjct  121  IDRWVEMLDEDKNPIDSGSKIHVKLQYFDVTKD  153



>sp|Q70EW5.2|PLDA1_CYNCA RecName: Full=Phospholipase D alpha 1; Short=PLD 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Cynara cardunculus]
 emb|CAE47482.2| phospholipase D alpha [Cynara cardunculus]
Length=808

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            M+++LLHG+LHV VYEVDK++  G  N+F K++   +  VGF +   ++YATIDLEK+RV
Sbjct  1    MSKVLLHGTLHVTVYEVDKLREGGGPNVFGKLMANIQETVGFGEGTPKIYATIDLEKSRV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ E +NPRWYESFHIYCAH ASN++F+VK DNPIGA L+GRAYMP R LL G+E
Sbjct  61   GRTRMIENEPQNPRWYESFHIYCAHHASNIIFTVKDDNPIGATLLGRAYMPVRELLDGDE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD+W+ ++D D NP  + SKIHVKLQ+ DV ++
Sbjct  121  VDKWIEIMDEDNNPTPAGSKIHVKLQYFDVTQD  153



>gb|AES86616.2| phospholipase D alpha 1 [Medicago truncatula]
Length=808

 Score =   202 bits (515),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+ LHG+LH  +YEVDK+   G  N    I +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MAQIHLHGTLHATIYEVDKLNAGGGGNFLSMIKQNIEETVGLGKGVTKLYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ EH NP+WYESFHIYCAHMAS+++F+VK DNP+GA LIGRAY+PA  +L GEE
Sbjct  61   GRTRIIENEHTNPKWYESFHIYCAHMASDIIFTVKDDNPVGATLIGRAYVPAEEVLNGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LD ++NPI   SKIHVKLQ+ DV ++
Sbjct  121  IDRWVEILDTEKNPIQEGSKIHVKLQYFDVTKD  153



>gb|AGN71006.1| phospholipase D2 [Brassica napus]
Length=812

 Score =   202 bits (514),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 119/151 (79%), Gaps = 2/151 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ LLHG+LH  +YEVD + T GL + F  KI    E+ +GF K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHTGGLSSGFLGKIRANVEKAIGFGKGETQLYATIDLQKAR  60

Query  326  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVINGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EV++W+ +LDNDRNPIH  SKIHVKLQ+  V
Sbjct  121  EVEKWVEILDNDRNPIHGESKIHVKLQYFGV  151



>ref|XP_009115281.1| PREDICTED: phospholipase D alpha 2 [Brassica rapa]
Length=812

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 118/151 (78%), Gaps = 2/151 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ LLHG+LH  +YEVD + T GL + F  KI    E  +GF K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHTGGLSSGFLGKIRANVEEAIGFGKGETQLYATIDLQKAR  60

Query  326  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVINGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EV++W+ +LDNDRNPIH  SKIHVKLQ+  V
Sbjct  121  EVEKWVEILDNDRNPIHGESKIHVKLQYFGV  151



>gb|AGV22364.1| phospholipase D4 [Brassica napus]
Length=812

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 118/151 (78%), Gaps = 2/151 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ LLHG+LH  +YEVD + T GL + F  KI    E  +GF K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHTGGLSSGFLGKIRANVEEAIGFGKGETQLYATIDLQKAR  60

Query  326  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVINGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EV++W+ +LDNDRNPIH  SKIHVKLQ+  V
Sbjct  121  EVEKWVEILDNDRNPIHGESKIHVKLQYFGV  151



>gb|KHN47766.1| Phospholipase D alpha 1 [Glycine soja]
Length=809

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ+LLHG+LH  V+EVD++   G   N F K+ +  E  VG  K  ++LYATIDLEKAR
Sbjct  1    MAQILLHGTLHATVFEVDRLNAGGGGGNFFSKLKQNFEETVGIGKGVTKLYATIDLEKAR  60

Query  326  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR+++ EH NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +L GE
Sbjct  61   VGRTRIIENEHTNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVSEVLDGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            E+D W+ +LD ++NPI   SKIHVKLQ+ DV ++
Sbjct  121  EIDRWVEILDEEKNPIQEGSKIHVKLQYFDVTKD  154



>ref|XP_009146200.1| PREDICTED: phospholipase D alpha 1 [Brassica rapa]
Length=810

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 119/151 (79%), Gaps = 2/151 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1    MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  326  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  ++L GE
Sbjct  61   VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQILHGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EVD+W+ +LDNDRNPIH  SKIHVKLQ+  V
Sbjct  121  EVDQWVEILDNDRNPIHGGSKIHVKLQYFGV  151



>ref|XP_003531710.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Glycine max]
 ref|XP_006585630.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Glycine max]
Length=809

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ+LLHG+LH  V+EVD++   G   N F K+ +  E  VG  K  ++LYATIDLEKAR
Sbjct  1    MAQILLHGTLHATVFEVDRLNAGGGGGNFFSKLKQNFEETVGIGKGVTKLYATIDLEKAR  60

Query  326  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR+++ EH NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +L GE
Sbjct  61   VGRTRIIENEHTNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVSEVLDGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            E+D W+ +LD ++NPI   SKIHVKLQ+ DV ++
Sbjct  121  EIDRWVEILDEEKNPIQEGSKIHVKLQYFDVTKD  154



>gb|KHN01336.1| Phospholipase D alpha 1 [Glycine soja]
Length=809

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ+LLHG+LH  ++EVD++   G   N F K+ +  E  VG  K  ++LYATIDLEKAR
Sbjct  1    MAQILLHGTLHATIFEVDRLNAGGGGGNFFSKLKQNFEETVGIGKGVTKLYATIDLEKAR  60

Query  326  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR+++ EH NPRWYESFHIYCAHMASN+VF+VK DNPIGA LIGRAY+P   +L GE
Sbjct  61   VGRTRIIENEHTNPRWYESFHIYCAHMASNIVFTVKDDNPIGATLIGRAYVPVSEVLDGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            E+D W+ +LD ++NPI   SKIHVKLQ+ DV ++
Sbjct  121  EIDRWVEILDEEKNPIREGSKIHVKLQYFDVTKD  154



>sp|P55939.2|PLDA2_BRAOC RecName: Full=Phospholipase D alpha 2; Short=PLD 2; AltName: 
Full=Choline phosphatase 2; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 2; Flags: Precursor [Brassica 
oleracea var. capitata]
 gb|AAC78486.1| phospholipase D2 [Brassica oleracea var. capitata]
 gb|AAC79125.1| phospholipase D [Brassica oleracea var. capitata]
 gb|AAD17209.1| phospholipase D2 [Brassica oleracea var. capitata]
Length=812

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 118/152 (78%), Gaps = 3/152 (2%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHN--LFHKIVEGAERVVGFNKTASRLYATIDLEKA  322
            MAQ LLHG+LH  +YEVD + T GL +     KI+   E  +GF K  ++LYATIDL+KA
Sbjct  1    MAQHLLHGTLHATIYEVDALHTGGLRSAGFLGKIISNVEETIGFGKGETQLYATIDLQKA  60

Query  323  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  499
            RVGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ G
Sbjct  61   RVGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVING  120

Query  500  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EEV++W+ +LD+DRNPIH  SKIHVKLQ+  V
Sbjct  121  EEVEKWVEILDDDRNPIHGESKIHVKLQYFAV  152



>tpg|DAA53243.1| TPA: phospholipase D family protein, partial [Zea mays]
Length=284

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 119/158 (75%), Gaps = 7/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKD  157



>tpg|DAA53242.1| TPA: phospholipase D family protein, partial [Zea mays]
Length=281

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 119/158 (75%), Gaps = 7/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKD  157



>gb|AIE90138.1| phospholipase D1, partial [Brassica napus]
Length=810

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 119/151 (79%), Gaps = 2/151 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1    MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  326  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQVIHGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EVD+W+ +LDNDRNPIH  SKIHVKLQ+  V
Sbjct  121  EVDQWVEILDNDRNPIHGGSKIHVKLQYFGV  151



>sp|O82549.1|PLDA1_BRAOC RecName: Full=Phospholipase D alpha 1; Short=PLD 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1; Flags: Precursor [Brassica 
oleracea var. capitata]
 gb|AAC78487.1| phospholipase D1 [Brassica oleracea var. capitata]
 gb|AAD17208.1| phospholipase D1 [Brassica oleracea var. capitata]
 emb|CDY30108.1| BnaC05g37540D [Brassica napus]
Length=810

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 119/151 (79%), Gaps = 2/151 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1    MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  326  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQVIHGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EVD+W+ +LDNDRNPIH  SKIHVKLQ+  V
Sbjct  121  EVDQWVEILDNDRNPIHGGSKIHVKLQYFGV  151



>gb|KDO48582.1| hypothetical protein CISIN_1g004579mg [Citrus sinensis]
 gb|KDO48583.1| hypothetical protein CISIN_1g004579mg [Citrus sinensis]
Length=662

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 119/153 (78%), Gaps = 7/153 (5%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LHV +YEVD++++ G  N F       + + G  K  S LYATIDLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDQLESGGGGNFF------TKLLGGLGKGGSELYATIDLEKARV  54

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  55   GRTRMLKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEE  114

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD+W+ +LD DRNPI S SKIHVKLQ+ DV ++
Sbjct  115  VDKWVEILDEDRNPISSGSKIHVKLQYFDVTKD  147



>gb|AAG50297.1| phospholipase PLDa3 [Solanum lycopersicum]
Length=678

 Score =   198 bits (504),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 104/120 (87%), Gaps = 3/120 (3%)
 Frame = +2

Query  245  VEGAERVVGFNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFS  424
            +EGA   +GFNKTAS LYATIDL KARVGRTRLLDEHKNPRWYESFHIYCAHMAS+VVF+
Sbjct  3    IEGA---IGFNKTASTLYATIDLGKARVGRTRLLDEHKNPRWYESFHIYCAHMASDVVFT  59

Query  425  VKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VK DNPIGAELIGRAY+P  +L+ GE VDEWL +LD +R P+H HSKIHVKLQ+ DV RE
Sbjct  60   VKADNPIGAELIGRAYLPVEQLIVGEVVDEWLEILDTERKPVHGHSKIHVKLQYFDVTRE  119



>gb|AGN71005.1| phospholipase D1 [Brassica napus]
Length=810

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 118/151 (78%), Gaps = 2/151 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1    MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  326  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQVIHGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EVD+W+  LDNDRNPIH  SKIHVKLQ+  V
Sbjct  121  EVDQWVETLDNDRNPIHGGSKIHVKLQYFGV  151



>ref|XP_006465340.1| PREDICTED: phospholipase D alpha 1 [Citrus sinensis]
Length=802

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 119/153 (78%), Gaps = 7/153 (5%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LHV +YEVD++++ G  N F       + + G  K  S LYATIDLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDQLESGGGGNFF------TKLLGGLGKGGSELYATIDLEKARV  54

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  55   GRTRMLKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEE  114

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD+W+ +LD DRNPI S SKIHVKLQ+ DV ++
Sbjct  115  VDKWVEILDEDRNPISSGSKIHVKLQYFDVTKD  147



>ref|XP_006427267.1| hypothetical protein CICLE_v10024917mg [Citrus clementina]
 gb|ESR40507.1| hypothetical protein CICLE_v10024917mg [Citrus clementina]
Length=802

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 119/153 (78%), Gaps = 7/153 (5%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LHV +YEVD++++ G  N F       + + G  K  S LYATIDLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDQLESGGGGNFF------TKLLGGLGKGGSELYATIDLEKARV  54

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  55   GRTRMLKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEE  114

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD+W+ +LD DRNPI S SKIHVKLQ+ DV ++
Sbjct  115  VDKWVEILDEDRNPISSGSKIHVKLQYFDVTKD  147



>ref|XP_011012164.1| PREDICTED: phospholipase D alpha 1 [Populus euphratica]
Length=808

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LHV +YEVDKI   G H  FHK+V      VG     SRLYATIDLEKARV
Sbjct  1    MAQILLHGNLHVTIYEVDKIGDGGGHGFFHKLVGSIGEKVGVGNGISRLYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+L+ E  NPRWYESFHIYCAHMASNV+F+VK  NPIGA LIGRAY+P   +L GEE
Sbjct  61   GRTRILENEATNPRWYESFHIYCAHMASNVIFTVKDVNPIGATLIGRAYIPVEEILDGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LD D+NPIH+ SKIHVKLQ+ D+ ++
Sbjct  121  IDRWVEILDGDKNPIHAGSKIHVKLQYFDISKD  153



>emb|CBI36314.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 117/154 (76%), Gaps = 1/154 (1%)
 Frame = +2

Query  140  LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  319
            +SE  ++ LHG+LH  ++E+D++ + G    F K+VE  E  VGF K  S+LYATID+ +
Sbjct  1    MSEFNEIPLHGTLHATIFEIDRLHSGGAPKFFRKLVENIEETVGFGKGTSKLYATIDIGR  60

Query  320  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  496
            ARVGRTR+++ E  NPRWYESFHIYCAHMA +++F+VK DNPIGA LIGRA +P + +LG
Sbjct  61   ARVGRTRMIENEPSNPRWYESFHIYCAHMAGHIIFTVKDDNPIGATLIGRASVPIQEILG  120

Query  497  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  598
            GEEVD+W+ +++ +  PIH  SKIHVKLQ+ +V 
Sbjct  121  GEEVDKWVEIVNEELKPIHGGSKIHVKLQYFEVT  154



>gb|KCW70692.1| hypothetical protein EUGRSUZ_F03862 [Eucalyptus grandis]
Length=673

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 116/153 (76%), Gaps = 3/153 (2%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LH  +YEVD++   G    F KI+   E  VG  K  S+LYATIDL KARV
Sbjct  1    MAQILLHGTLHATIYEVDQLHHGGAPKFFRKIMANIEETVGLGKGVSKLYATIDLGKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTRLL+ E  NPRWYESFHIYCAHMAS+V+F++K DNPIGA LIGRAY+P   LLGGEE
Sbjct  61   GRTRLLEKEPSNPRWYESFHIYCAHMASDVIFTIKDDNPIGATLIGRAYVPVDELLGGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LD +RNPI   SKIHVKL + DV ++
Sbjct  121  LDRWVEILDKERNPI--GSKIHVKLHYFDVSKD  151



>ref|NP_001275827.1| phospholipase D alpha [Citrus sinensis]
 gb|ACA49723.1| phospholipase D alpha [Citrus sinensis]
Length=802

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 118/153 (77%), Gaps = 7/153 (5%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LHV +YEVD++++ G  N F       + + G  K  S LYATIDLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDQLESGGGGNFF------TKLLGGLGKGGSELYATIDLEKARV  54

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P    LGGEE
Sbjct  55   GRTRMLKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEALGGEE  114

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD+W+ +LD DRNPI S SKIHVKLQ+ DV ++
Sbjct  115  VDKWVEILDEDRNPISSGSKIHVKLQYFDVTKD  147



>ref|XP_006356207.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006356208.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum tuberosum]
 ref|XP_006356209.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Solanum tuberosum]
Length=809

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 118/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ+ LHG+LHV ++EVD ++  +G  + F KI +  E  VG  K   +LYATIDLEKAR
Sbjct  1    MAQIQLHGTLHVTIFEVDNLQGEEGGGHFFSKIKQHFEETVGVGKGTPKLYATIDLEKAR  60

Query  326  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR+++ E KNPRWYESFHIYCAHMASNV+F++K DNP GA LIGRAY+P   LL GE
Sbjct  61   VGRTRMIENEPKNPRWYESFHIYCAHMASNVIFTIKDDNPFGASLIGRAYVPVEELLEGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            E+D+W+ +LD + NPI   SKIHVKLQF DV R+
Sbjct  121  EIDKWVEILDKEMNPIAEGSKIHVKLQFFDVSRD  154



>ref|XP_010063458.1| PREDICTED: phospholipase D alpha 1 [Eucalyptus grandis]
Length=805

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 116/153 (76%), Gaps = 3/153 (2%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LH  +YEVD++   G    F KI+   E  VG  K  S+LYATIDL KARV
Sbjct  1    MAQILLHGTLHATIYEVDQLHHGGAPKFFRKIMANIEETVGLGKGVSKLYATIDLGKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTRLL+ E  NPRWYESFHIYCAHMAS+V+F++K DNPIGA LIGRAY+P   LLGGEE
Sbjct  61   GRTRLLEKEPSNPRWYESFHIYCAHMASDVIFTIKDDNPIGATLIGRAYVPVDELLGGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LD +RNPI   SKIHVKL + DV ++
Sbjct  121  LDRWVEILDKERNPI--GSKIHVKLHYFDVSKD  151



>emb|CDX97705.1| BnaA05g23740D [Brassica napus]
Length=810

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 118/151 (78%), Gaps = 2/151 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1    MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  326  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  ++L GE
Sbjct  61   VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQILHGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EVD+W+ +LDNDRNPI   SKIHVKLQ+  V
Sbjct  121  EVDQWVEILDNDRNPIPGGSKIHVKLQYFGV  151



>emb|CDO98145.1| unnamed protein product [Coffea canephora]
Length=809

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 118/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGL-HNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            M  +LLHG+LHV ++EVDK+  +G   ++F K++   E  VGF K   ++YATIDLEKAR
Sbjct  1    MDPVLLHGTLHVTIFEVDKLHGEGGGPSVFRKLMANIEETVGFGKGTPKIYATIDLEKAR  60

Query  326  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR+++ E  NPRWYESFHIYCAH ASNV+F+VK DNPIGA LIGRAY+P   LL GE
Sbjct  61   VGRTRMIENEPNNPRWYESFHIYCAHEASNVIFTVKDDNPIGATLIGRAYVPVHELLEGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            E+D W+ +LD D+NPI   SKIHVKLQ+ DV R+
Sbjct  121  EIDRWVEILDEDKNPIKEESKIHVKLQYFDVTRD  154



>ref|XP_004235964.1| PREDICTED: phospholipase D alpha 1 [Solanum lycopersicum]
Length=811

 Score =   196 bits (499),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 116/153 (76%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MA +LLHG+LHV ++EVDK+      N F KI +  E  VG  K ASR+YAT+DLEKARV
Sbjct  1    MAPILLHGTLHVTIHEVDKLHGKQGRNFFSKIKDSVEEKVGMGKGASRIYATVDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ E  NPRWYESFHIYCAHMA NV+F+VK +N IGA LIGRAY+P   LL GEE
Sbjct  61   GRTRVIENEPNNPRWYESFHIYCAHMAKNVIFTVKDNNSIGATLIGRAYLPVNDLLEGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VDEW+ +LD D NP+ + SKIHV LQ+ ++ R+
Sbjct  121  VDEWIEILDEDENPVEAGSKIHVTLQYFEISRD  153



>ref|XP_006364210.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum tuberosum]
Length=811

 Score =   196 bits (499),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 116/153 (76%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MA +LLHG+LHV ++EVD++      N F KI +  E  VG  K ASR+YAT+DLEKARV
Sbjct  1    MAPILLHGTLHVTIHEVDRLHGKHGRNFFSKIKDSVEETVGMGKGASRIYATVDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ E  NPRWYESFHIYCAHMA NV+F+VK +N IGA LIGRAY+P   LL GEE
Sbjct  61   GRTRVIENEPNNPRWYESFHIYCAHMAKNVIFTVKDNNSIGATLIGRAYLPVNDLLEGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VDEW+ +LD D NPI + SKIHV LQ+ ++ R+
Sbjct  121  VDEWIEILDEDENPIEAGSKIHVTLQYFEISRD  153



>ref|XP_007135745.1| hypothetical protein PHAVU_010G155000g [Phaseolus vulgaris]
 gb|ESW07739.1| hypothetical protein PHAVU_010G155000g [Phaseolus vulgaris]
Length=809

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 116/153 (76%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LH  +YEVDK+   G  N F K+ +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDKLHAGGGGNFFTKLKQNIEETVGIGKGVTKLYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ EH NP+W ESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   +L G E
Sbjct  61   GRTRIIENEHTNPKWEESFHIYCAHVASDIIFTVKDDNPIGATLIGRAYVPVSEVLDGHE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LD ++ PI   SKIHVKLQ+ DV ++
Sbjct  121  IDRWVEILDTEKKPIQEGSKIHVKLQYFDVSKD  153



>ref|NP_001234102.1| phospholipase PLDa1 [Solanum lycopersicum]
 gb|AAG45485.1| phospholipase PLDa1 [Solanum lycopersicum]
Length=809

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 118/155 (76%), Gaps = 4/155 (3%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK--TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  322
            MAQ+ LHG+LHV ++EVD ++   +G H  F KI +  E  VG  K   +LYATIDLEKA
Sbjct  1    MAQIQLHGTLHVTIFEVDNLQGEEEGGH-FFSKIKQHFEETVGIGKGTPKLYATIDLEKA  59

Query  323  RVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  499
            RVGRTR+++ E KNPRWYESFHIYCAHMASNV+F++K DNP GA LIGRAY+P   LL G
Sbjct  60   RVGRTRIIENEPKNPRWYESFHIYCAHMASNVIFTIKDDNPFGASLIGRAYVPVEELLEG  119

Query  500  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EE+D+W+ ++D + NPI   SKIHVKLQF DV R+
Sbjct  120  EEIDKWVEIMDKEMNPIAEGSKIHVKLQFFDVSRD  154



>gb|ABU54776.1| phospholipase D alpha 1 precursor [Helianthus annuus]
Length=810

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MAQLL-LHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ   LHG+LHV +YEVDKI   G  N+F KIV   E  +GF K   ++YAT+DLEKAR
Sbjct  1    MAQKTHLHGTLHVTIYEVDKIHVAGGGNIFSKIVANIEETIGFGKGTPKMYATVDLEKAR  60

Query  326  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR++ DE + P+W ESFHIYCAH ASNV+F+VK DNP+GA LIGRAY+P   +L GE
Sbjct  61   VGRTRMITDEPETPKWNESFHIYCAHSASNVIFTVKDDNPVGATLIGRAYIPVEEILDGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            E+D W+ +LD D+NPI + SKIHVK+Q+ DV ++
Sbjct  121  ELDRWVEILDEDKNPISAGSKIHVKVQYFDVTQD  154



>ref|XP_002299756.1| phospholipase D family protein [Populus trichocarpa]
 gb|EEE84561.1| phospholipase D family protein [Populus trichocarpa]
Length=808

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LHV +YEVDKI   G H  FHK+V      VG     SRLYATIDLEKARV
Sbjct  1    MAQILLHGNLHVTIYEVDKIGEGGGHGFFHKLVGKVGEKVGIGNGISRLYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+L+ E  NPRWYESFHIYCAHMASNV+F+VK  NPIGA LIGRAY+P   +L GEE
Sbjct  61   GRTRILENEATNPRWYESFHIYCAHMASNVIFTVKDVNPIGATLIGRAYIPVEEILDGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LD D+NPI + SKIHVKLQ+ D+  +
Sbjct  121  IDRWVEILDGDKNPIRAGSKIHVKLQYFDITND  153



>gb|ADP23922.1| phospholipase D alpha [Litchi chinensis]
Length=800

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 119/153 (78%), Gaps = 8/153 (5%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LH  +YEVD++ T G  + F K++       G  K  S++YATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDQLDTGGGGHFFRKLI-------GLGKGQSKIYATIDLEKARV  53

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ +H NPRWYESFHIYCAHMAS+V+F+VK DN +GA LIGRA++P   +LGGEE
Sbjct  54   GRTRIIEKDHANPRWYESFHIYCAHMASDVIFTVKDDNAVGASLIGRAHVPVEEILGGEE  113

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD+W+ LLD  +NPI + SKIHVKLQ+ DV ++
Sbjct  114  VDKWVELLDEHKNPIEAGSKIHVKLQYFDVTKD  146



>ref|XP_008461111.1| PREDICTED: phospholipase D alpha 1 [Cucumis melo]
Length=833

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG  K  ++LYATIDLEKARV
Sbjct  26   MEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGIGKGQTKLYATIDLEKARV  85

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+L+ E  NPRWYESFHIYCAH ASNV+F+VK DNPIGA LIGRAY+P   ++ GEE
Sbjct  86   GRTRILESEPSNPRWYESFHIYCAHKASNVIFTVKDDNPIGATLIGRAYVPVEDIVDGEE  145

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD W+P+LD ++NPI   SKIHVKLQ+  V ++
Sbjct  146  VDRWVPILDENQNPIEGESKIHVKLQYFSVTKD  178



>ref|XP_008805616.1| PREDICTED: phospholipase D alpha 1-like [Phoenix dactylifera]
 ref|XP_008805617.1| PREDICTED: phospholipase D alpha 1-like [Phoenix dactylifera]
Length=810

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 115/155 (74%), Gaps = 3/155 (2%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK--TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  322
            MA +LLHG+LHV ++E D +   + G      ++V G E  +G  K +S+LYATIDLEKA
Sbjct  1    MAHILLHGTLHVTIFEADSLSRASAGAPKFIRQLVGGIEDAIGLGKGSSKLYATIDLEKA  60

Query  323  RVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  499
            RVGRTRL+ DE  NPRWYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P   +L G
Sbjct  61   RVGRTRLITDEPVNPRWYESFHIYCAHMAANVIFTVKFDNPIGASLIGRAYLPVAEILDG  120

Query  500  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EE D WL + D DRNP+   +KIHVK+Q+ D+ ++
Sbjct  121  EEADRWLEICDEDRNPLDGGAKIHVKVQYFDISKD  155



>gb|AGV22363.1| phospholipase D3 [Brassica napus]
Length=810

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 117/151 (77%), Gaps = 2/151 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYAT DL++ R
Sbjct  1    MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATTDLQRVR  60

Query  326  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + DE +NP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKDEAENPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQVIHGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EVD+W+ +LDNDRNPIH  SKIHVKLQ+  V
Sbjct  121  EVDQWVEILDNDRNPIHGGSKIHVKLQYFGV  151



>ref|XP_008792036.1| PREDICTED: phospholipase D alpha 1 [Phoenix dactylifera]
 ref|XP_008792037.1| PREDICTED: phospholipase D alpha 1 [Phoenix dactylifera]
Length=813

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 117/158 (74%), Gaps = 6/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LH  ++E D +      + G    F ++VEG E  +G  K +S+LYATIDL
Sbjct  1    MAQILLHGTLHATIFEADSLSNPNRSSGGAPKFFRQLVEGIEDTIGLGKGSSKLYATIDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             KARVGRTRL+  E  NPRWYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P   +
Sbjct  61   GKARVGRTRLITKEPVNPRWYESFHIYCAHMAANVIFTVKFDNPIGASLIGRAYLPVTEI  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            L G+EVD+W+ + D DRNP+   +KIHVK+Q+ D+ ++
Sbjct  121  LYGQEVDKWIEICDEDRNPLDGGAKIHVKVQYFDISKD  158



>gb|EYU21635.1| hypothetical protein MIMGU_mgv1a001489mg [Erythranthe guttata]
 gb|EYU21636.1| hypothetical protein MIMGU_mgv1a001489mg [Erythranthe guttata]
Length=809

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LH  +YEVD +      N F K++E  E  VGF K  +++YA+IDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDTLHAGKGGNFFGKLMENIEETVGFGKGTAKIYASIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRIIEKEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVEELLEGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD+W+ +LD D NP+   SKIHVKLQF DV R+
Sbjct  121  VDKWVEILDTDMNPVSEGSKIHVKLQFFDVTRD  153



>gb|AHN53202.1| phospholipase D alpha 1-like protein [Cocos nucifera]
Length=813

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 117/158 (74%), Gaps = 6/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LHV ++E D +      + G      ++VEG E  +G  K +++LYATIDL
Sbjct  1    MAQILLHGTLHVTIFEADSLSNPNRASGGAPKFIRQLVEGIEDTIGLGKGSTKLYATIDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             KARVGRTRL+ +E  NPRWYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P   +
Sbjct  61   GKARVGRTRLITNEPVNPRWYESFHIYCAHMAANVIFTVKFDNPIGASLIGRAYLPVTEI  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            L GEEVD W+ + D DRNP+   +KIHVK+Q+ D+ ++
Sbjct  121  LDGEEVDRWIEIWDEDRNPLDGGAKIHVKVQYFDISKD  158



>ref|XP_010322318.1| PREDICTED: phospholipase PLDa1 isoform X1 [Solanum lycopersicum]
 ref|XP_010322320.1| PREDICTED: phospholipase PLDa1 isoform X1 [Solanum lycopersicum]
 ref|XP_010322321.1| PREDICTED: phospholipase PLDa1 isoform X1 [Solanum lycopersicum]
 gb|AAF17557.1|AF201661_1 phospholipase D alpha [Solanum lycopersicum]
Length=809

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 117/155 (75%), Gaps = 4/155 (3%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK--TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  322
            MAQ+ LHG+LHV ++EVD ++   +G H  F KI +  E  VG  K   +LYATIDLEKA
Sbjct  1    MAQIQLHGTLHVTIFEVDNLQGEEEGGH-FFSKIKQHFEETVGIGKGTPKLYATIDLEKA  59

Query  323  RVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  499
            RVGRTR+++ E KNPRWYESFHIYCAHMASNV+F++K DNP GA LIGRAY+P   LL G
Sbjct  60   RVGRTRIIENEPKNPRWYESFHIYCAHMASNVIFTIKDDNPFGASLIGRAYVPVEELLEG  119

Query  500  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EE+D+W+ ++D + NP    SKIHVKLQF DV R+
Sbjct  120  EEIDKWVEIMDKEMNPTAEGSKIHVKLQFFDVSRD  154



>sp|O04865.1|PLDA1_VIGUN RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Vigna unguiculata]
 gb|AAB51392.1| phospholipase D [Vigna unguiculata]
Length=809

 Score =   194 bits (493),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LH  +YEVD++   G  N F K+ +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDELHGGGGGNFFSKLKQNIEETVGIGKGVTKLYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ E  NP+W ESFHIYC H+ASN++F+VK DNPIGA LIGRAY+P   +L G E
Sbjct  61   GRTRIIENETTNPKWNESFHIYCGHLASNIIFTVKDDNPIGATLIGRAYVPVSEVLDGHE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D+W+ +LD ++NPI   SKIHV+LQ+ DV+++
Sbjct  121  IDKWVEILDTEKNPIEGGSKIHVRLQYFDVLKD  153



>ref|XP_007150745.1| hypothetical protein PHAVU_005G177200g [Phaseolus vulgaris]
 gb|ESW22739.1| hypothetical protein PHAVU_005G177200g [Phaseolus vulgaris]
Length=808

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ++LHG+LH  +YEVD +K     N+  K++   E  +G  K  ++LYATIDLEKARV
Sbjct  1    MAQVVLHGTLHATIYEVDNLKAGNGGNILTKLLHNMEETIGIGKGITKLYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ EH NP+WYESFHIYCAH ASN++F+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  61   GRTRVIEKEHTNPKWYESFHIYCAHEASNIIFTVKDDNPIGATLIGRAYVPVEEILHGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            ++ W+ +LD  + PIH+ SKIHVKLQ+ DV ++
Sbjct  121  IERWVEILDEHKKPIHTRSKIHVKLQYYDVSKD  153



>gb|ABB82551.1| phospholipase D-alpha [Cucumis melo var. inodorus]
Length=808

 Score =   194 bits (492),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 113/153 (74%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGIGKGQTKLYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+L+ E  NPRWYESFHIYCAH ASNV+F+VK DNPIGA LIGR Y+P   ++ GEE
Sbjct  61   GRTRILESEPSNPRWYESFHIYCAHKASNVIFTVKDDNPIGATLIGRTYVPVEDIVDGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD W+P+LD ++NPI   SKIHVKLQ+  V ++
Sbjct  121  VDRWVPILDENQNPIEGESKIHVKLQYFSVTKD  153



>ref|XP_010907269.1| PREDICTED: phospholipase D alpha 1 [Elaeis guineensis]
 ref|XP_010907270.1| PREDICTED: phospholipase D alpha 1 [Elaeis guineensis]
Length=813

 Score =   194 bits (492),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 117/158 (74%), Gaps = 6/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LHV ++E + +      + G      ++VEG E  +G  K +S+LYATIDL
Sbjct  1    MAQILLHGTLHVTIFEANSLSNPNRASGGAPKFIRQLVEGIEDTIGLGKGSSKLYATIDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTRL+  E  NPRWYESFHIYCAHM++NV+F+VK DNPIGA LIGRAY+P   +
Sbjct  61   EKARVGRTRLITKEPVNPRWYESFHIYCAHMSANVIFTVKFDNPIGASLIGRAYLPVTEI  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            L GEEVD W+ + D DRNP+   ++IHVK+Q+ D+ ++
Sbjct  121  LNGEEVDRWIEICDEDRNPLDGGARIHVKVQYFDISKD  158



>ref|XP_010250112.1| PREDICTED: phospholipase D alpha 1 [Nelumbo nucifera]
Length=815

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 116/157 (74%), Gaps = 5/157 (3%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHN----LFHKIVEGAERVVGFNKTASRLYATIDLE  316
            M+ +LLHGSLHV +YEVD++ + G         H+IVE     VG  K   ++YAT+DLE
Sbjct  1    MSDILLHGSLHVTIYEVDRLSSGGGGGGPGGFLHQIVENIGEAVGIGKDTPKIYATVDLE  60

Query  317  KARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLL  493
            KARVGRTR+++ E  NPRWYESFHIYCAHMASNV+F+VK D+ IGA L GRAY+P   +L
Sbjct  61   KARVGRTRIIENERVNPRWYESFHIYCAHMASNVIFTVKDDDAIGATLYGRAYVPVEEIL  120

Query  494  GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
             GEEVD WL +LD+DRNP+   SKIHV+LQF DV R+
Sbjct  121  NGEEVDRWLEILDDDRNPVREGSKIHVRLQFFDVTRD  157



>ref|XP_010687988.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010687989.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
Length=806

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MA++LLHG LHV +YE +++   G    FHK+VEG E V+G  K A +LYA+ID+E ARV
Sbjct  1    MAKILLHGVLHVTIYEANRLFGGGGGKFFHKVVEGLESVIG--KGAGKLYASIDIEGARV  58

Query  329  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  508
            GRTRL++   NPRWYE FHI CAHMAS++VF++K D  IGA L+GRAY+PA  +LGGEEV
Sbjct  59   GRTRLVENDSNPRWYEQFHICCAHMASDIVFTLKEDEAIGATLLGRAYLPATDILGGEEV  118

Query  509  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            D WL +LD D NPIH  SK+HV +QF DV R+
Sbjct  119  DTWLDILDKDHNPIHKGSKVHVLVQFFDVTRD  150



>ref|XP_006842069.1| hypothetical protein AMTR_s00078p00051300 [Amborella trichopoda]
 gb|ERN03744.1| hypothetical protein AMTR_s00078p00051300 [Amborella trichopoda]
Length=815

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 116/158 (73%), Gaps = 6/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LHV +YE + +      T G      ++VEG E  +GF K A +LYATIDL
Sbjct  1    MAQILLHGTLHVTIYEAESLSNPHRATGGAPKFIRQLVEGIEETIGFGKGAGKLYATIDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTR+L +E  NPRWYESFHIYCAHMAS+++F+VK DNPIGA LIGRA++P   +
Sbjct  61   EKARVGRTRILTNESVNPRWYESFHIYCAHMASDIIFTVKDDNPIGASLIGRAHVPVEEV  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            + G+EVD W  + D +R PI   +KIHVKLQ+ DV ++
Sbjct  121  INGDEVDTWAEICDENRKPIGGGAKIHVKLQYFDVTKD  158



>gb|KHG06123.1| Phospholipase D alpha 1 [Gossypium arboreum]
Length=807

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 114/153 (75%), Gaps = 2/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G  K   ++YATIDLE+ARV
Sbjct  1    MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGKGVPKIYATIDLERARV  59

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR ++ E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+P + L  G+E
Sbjct  60   GRTRTIENETSNPRWYESFHIYCAHNASNVVFTVKDDNPIGATLIGRAYVPVKDLTEGDE  119

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD W+ +LD D+NPI S  KIHVKLQ+ DV ++
Sbjct  120  VDRWVVILDEDKNPIKSGGKIHVKLQYFDVTKD  152



>ref|XP_002882959.1| PLDALPHA1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59218.1| PLDALPHA1 [Arabidopsis lyrata subsp. lyrata]
Length=810

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 115/151 (76%), Gaps = 2/151 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ LLHG+LH  +YEVD +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  326  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDEVINGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EVD W+ +LDNDRNPIH  SKIHVKLQ+  V
Sbjct  121  EVDRWVEILDNDRNPIHGGSKIHVKLQYFHV  151



>ref|NP_001267897.1| phospholipase D alpha [Vitis vinifera]
 gb|ABC59316.1| phospholipase D alpha [Vitis vinifera]
Length=809

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LH  ++ +D++ + G    F K+VE  E  VGF K  S+LYATID+ +ARV
Sbjct  1    MAQILLHGTLHATIFGIDRLHSGGAPKFFRKLVENIEETVGFGKGTSKLYATIDIGRARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ E  NPRWYESFHIYCAHMA +++F+VK DNPIGA LIGRA +P + +LGGEE
Sbjct  61   GRTRMIENEPSNPRWYESFHIYCAHMAGHIIFTVKDDNPIGATLIGRASVPIQEILGGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD+W+ +++ +  PIH  SKIHVKLQ+ +V  +
Sbjct  121  VDKWVEIVNEELKPIHGGSKIHVKLQYFEVTAD  153



>ref|XP_004171103.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 1-like, 
partial [Cucumis sativus]
Length=534

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGIGKGQTKLYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+L+ +  NP+W ESFHIYCAH ASNV+F+VK DNPIGA LIGRAY+P   ++ GEE
Sbjct  61   GRTRILESDPSNPKWNESFHIYCAHKASNVIFTVKDDNPIGATLIGRAYVPVEDIVDGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD+W+P+LD ++NPI   SKIHVKLQ+  V ++
Sbjct  121  VDKWVPILDENQNPIEEESKIHVKLQYFSVTKD  153



>ref|NP_188194.1| phospholipase D alpha 1 [Arabidopsis thaliana]
 sp|Q38882.2|PLDA1_ARATH RecName: Full=Phospholipase D alpha 1; Short=AtPLDalpha1; Short=PLD 
alpha 1; AltName: Full=Choline phosphatase 1; AltName: 
Full=PLDalpha; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Arabidopsis thaliana]
 dbj|BAB02304.1| phospholipase D [Arabidopsis thaliana]
 dbj|BAE98964.1| phospholipase D [Arabidopsis thaliana]
 gb|AEE75720.1| phospholipase D alpha 1 [Arabidopsis thaliana]
Length=810

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 116/151 (77%), Gaps = 2/151 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ LLHG+LH  +YEVD +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  326  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDQVINGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EVD+W+ +LDNDRNPI   SKIHVKLQ+  V
Sbjct  121  EVDQWVEILDNDRNPIQGGSKIHVKLQYFHV  151



>ref|XP_006643814.1| PREDICTED: phospholipase D alpha 1-like [Oryza brachyantha]
Length=812

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 115/158 (73%), Gaps = 7/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LH  + E   +      +        K VEG E  VG  K A+++Y+TIDL
Sbjct  1    MAQMLLHGTLHATILEAASLSNPHRASGSAPKFIRKFVEGIEDTVGVGKGATKVYSTIDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTR++ +E  NPRWYESFHIYCAHMASNV+F+VK+DNPIGA  IGRAY+PA+ L
Sbjct  61   EKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKIDNPIGATNIGRAYLPAQEL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            L GEE+D WL + DNDR P+   SKIHVKLQ+ DV ++
Sbjct  121  LSGEEIDRWLDICDNDRQPV-GESKIHVKLQYFDVAKD  157



>ref|XP_010691149.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
Length=809

 Score =   191 bits (485),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LHV +YE   +       +F K++   E  VG  +   ++YATIDLEKAR 
Sbjct  1    MAQILLHGTLHVTIYEASDLHHGNDPGVFRKLMANIEETVGLGQGTPKMYATIDLEKARA  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ E  NPRWYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  61   GRTRIIENEPANPRWYESFHIYCAHLASSIIFTVKDDNPIGATLIGRAYVPVEEILGGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD W+ + D D+NP+ S +KIHVKLQF ++ +E
Sbjct  121  VDRWVEICDRDKNPLDSGAKIHVKLQFFEITQE  153



>ref|XP_008673445.1| PREDICTED: phospholipase D alpha 1 isoform X1 [Zea mays]
 ref|XP_008673446.1| PREDICTED: phospholipase D alpha 1 isoform X1 [Zea mays]
 gb|ACN25900.1| unknown [Zea mays]
 gb|ACN27927.1| unknown [Zea mays]
 gb|ACN28359.1| unknown [Zea mays]
 gb|ACN29073.1| unknown [Zea mays]
 tpg|DAA53244.1| TPA: phospholipase D family protein [Zea mays]
Length=812

 Score =   191 bits (484),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 119/158 (75%), Gaps = 7/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKD  157



>gb|ACR35730.1| unknown [Zea mays]
Length=812

 Score =   191 bits (484),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 119/158 (75%), Gaps = 7/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKD  157



>gb|ACG63794.1| phospholipase D alpha [Gossypium arboreum]
 gb|ACG70840.1| phospholipase D alpha [Gossypium arboreum]
 gb|ADD83098.1| PLDalpha isoform 2 [Gossypium hirsutum]
 gb|ADD83099.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83100.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83104.1| PLDalpha isoform 1 [Gossypium hirsutum]
Length=807

 Score =   191 bits (484),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 113/153 (74%), Gaps = 2/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G  K   ++YATIDLE+ARV
Sbjct  1    MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGKGVPKIYATIDLERARV  59

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR ++ E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA  IGRAY+P + L  G+E
Sbjct  60   GRTRTIENETSNPRWYESFHIYCAHNASNVVFTVKDDNPIGATQIGRAYVPVKDLTEGDE  119

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD W+ +LD D+NPI S  KIHVKLQ+ DV ++
Sbjct  120  VDRWVVILDEDKNPIKSGGKIHVKLQYFDVTKD  152



>gb|ACL53693.1| unknown [Zea mays]
Length=812

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 119/158 (75%), Gaps = 7/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFTRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKD  157



>ref|XP_009381115.1| PREDICTED: phospholipase D alpha 1 [Musa acuminata subsp. malaccensis]
Length=812

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 117/158 (74%), Gaps = 7/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LH  ++E + +      + G      K+VEG E  VG  K +S+LYATIDL
Sbjct  1    MAQILLHGTLHATIFEAESLTNPHRASGGAPKFLRKLVEGIEDTVGIGKGSSKLYATIDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTR++ +E  +PRWYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P   +
Sbjct  61   EKARVGRTRMITNEPVSPRWYESFHIYCAHMAANVIFTVKFDNPIGASLIGRAYLPVMEI  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            L GEEVD WL + D DRNP+   +KIHVK+Q+ D+ ++
Sbjct  121  LDGEEVDRWLEICDADRNPV-GDAKIHVKVQYFDISKD  157



>ref|XP_008654846.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 ref|XP_008654847.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 gb|AFW80165.1| phospholipase D family protein [Zea mays]
Length=812

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 117/158 (74%), Gaps = 7/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K  +++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGIGKGTTKIYATVDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++VVF+VK+DNPIGA LIGRAY+P   +
Sbjct  61   EKARVGRTRMVSNEPVNPRWYESFHIYCAHMAADVVFTVKIDNPIGASLIGRAYLPVEDI  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            LGG+E+D+WL + D  R PI   SKIHVKLQ+ DV ++
Sbjct  121  LGGDEIDKWLEICDEKREPI-GDSKIHVKLQYFDVGKD  157



>gb|ADY75750.1| phospholipase D alpha [Dimocarpus longan]
Length=800

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 117/153 (76%), Gaps = 8/153 (5%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+LH  +YEVD++   G  + F K++       G  K  S++YATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDQLDRGGGGHFFRKLI-------GLGKGESKIYATIDLEKARV  53

Query  329  GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR++  +H NPRWYESFHIYCAHMAS+V+F+VK DN +GA LIGRA++P   +LGGEE
Sbjct  54   GRTRIIGKDHANPRWYESFHIYCAHMASDVIFTVKDDNAVGASLIGRAHVPVEEILGGEE  113

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD+W+ LLD  +NPI + SKIHVKLQ+ D+ ++
Sbjct  114  VDKWVELLDEHKNPIEAGSKIHVKLQYFDIRKD  146



>ref|XP_006297003.1| hypothetical protein CARUB_v10012996mg [Capsella rubella]
 gb|EOA29901.1| hypothetical protein CARUB_v10012996mg [Capsella rubella]
Length=810

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 114/151 (75%), Gaps = 2/151 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ LLHG+LH  +YEVD +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  326  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F++K DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTIKDDNPIGATLIGRAYIPVDEVINGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EVD W+ +LDNDRNPI   SKIHVKLQ+  V
Sbjct  121  EVDRWVEILDNDRNPIQGGSKIHVKLQYFHV  151



>gb|KJB70611.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
Length=665

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 113/153 (74%), Gaps = 2/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G  K   ++YATIDLE+ARV
Sbjct  1    MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGKGVPKIYATIDLERARV  59

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR ++ E  NPRW+ESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+P + L  G+E
Sbjct  60   GRTRTIENETSNPRWFESFHIYCAHNASNVVFTVKDDNPIGATLIGRAYVPVKDLTEGDE  119

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD W+ +LD D+NPI S  KIHVKLQ+  V ++
Sbjct  120  VDRWVEILDEDKNPIKSGGKIHVKLQYFGVTKD  152



>ref|XP_007023176.1| Phospholipase D alpha 2 isoform 3 [Theobroma cacao]
 gb|EOY25798.1| Phospholipase D alpha 2 isoform 3 [Theobroma cacao]
Length=670

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            M  +LLHG+LHV +YE DK+ + G   + F K++   E  +G  K   ++YATIDLE+AR
Sbjct  1    MEDILLHGTLHVTIYEADKLHSGGGGGHFFRKLMANVEETIGIGKGIPKIYATIDLERAR  60

Query  326  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR+++ E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+    LL GE
Sbjct  61   VGRTRIIEKEISNPRWYESFHIYCAHRASNVVFTVKDDNPIGATLIGRAYVSVDELLSGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EVD W+ +LD D+NPI S  KIHVKLQ+ DV R+
Sbjct  121  EVDRWVEILDEDKNPIESGGKIHVKLQYFDVTRD  154



>ref|XP_004135845.1| PREDICTED: phospholipase D alpha 1-like [Cucumis sativus]
 gb|KGN45278.1| hypothetical protein Csa_7G432600 [Cucumis sativus]
Length=808

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGIGKGQTKLYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+L+ +  NP+W ESFHIYCAH ASNV+F+VK DNPIGA LIGRAY+P   ++ GEE
Sbjct  61   GRTRILESDPSNPKWNESFHIYCAHKASNVIFTVKDDNPIGATLIGRAYVPVEDIVDGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD+W+P+LD ++NPI   SKIHVKLQ+  V ++
Sbjct  121  VDKWVPILDENQNPIEEESKIHVKLQYFSVTKD  153



>gb|ABN13537.2| phospholipase D [Cucumis sativus]
Length=808

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGIGKGQTKLYATIDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+L+ +  NP+W ESFHIYCAH ASNV+F+VK DNPIGA LIGRAY+P   ++ GEE
Sbjct  61   GRTRILESDPSNPKWNESFHIYCAHKASNVIFTVKDDNPIGATLIGRAYVPVEDIVDGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD+W+P+LD ++NPI   SKIHVKLQ+  V ++
Sbjct  121  VDKWVPILDENQNPIEEESKIHVKLQYFSVTKD  153



>ref|XP_006406922.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 ref|XP_006406923.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 gb|ESQ48375.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 gb|ESQ48376.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
Length=810

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 116/151 (77%), Gaps = 2/151 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ LLHG+LH  ++EVD +   G+   F  K++   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIFEVDALHGGGIRQGFLGKVLANVEEKIGVGKGETQLYATIDLQKAR  60

Query  326  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDQVINGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EVD+W+ +LDNDRNPI   SKIHVKLQ+  V
Sbjct  121  EVDQWVEILDNDRNPIEGGSKIHVKLQYFHV  151



>gb|ACG63795.1| phospholipase D alpha [Gossypium raimondii]
 gb|ACG70839.1| phospholipase D alpha [Gossypium raimondii]
 gb|ACV70145.1| phospholipase D [Gossypium raimondii]
 gb|ADD83101.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83102.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83103.1| PLDalpha isoform 1 [Gossypium hirsutum]
 gb|ADD83105.1| PLDalpha isoform 2 [Gossypium hirsutum]
 gb|KJB70610.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
 gb|KJB70614.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
Length=807

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 113/153 (74%), Gaps = 2/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G  K   ++YATIDLE+ARV
Sbjct  1    MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGKGVPKIYATIDLERARV  59

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR ++ E  NPRW+ESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+P + L  G+E
Sbjct  60   GRTRTIENETSNPRWFESFHIYCAHNASNVVFTVKDDNPIGATLIGRAYVPVKDLTEGDE  119

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD W+ +LD D+NPI S  KIHVKLQ+  V ++
Sbjct  120  VDRWVEILDEDKNPIKSGGKIHVKLQYFGVTKD  152



>tpg|DAA53239.1| TPA: phospholipase D family protein, partial [Zea mays]
Length=205

 Score =   178 bits (451),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 110/147 (75%), Gaps = 7/147 (5%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIH  571
            LGGEE+D+WL + D +R P+   SKIH
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIH  146



>ref|XP_007023174.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
 ref|XP_007023175.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
 gb|EOY25796.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
 gb|EOY25797.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
Length=809

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            M  +LLHG+LHV +YE DK+ + G   + F K++   E  +G  K   ++YATIDLE+AR
Sbjct  1    MEDILLHGTLHVTIYEADKLHSGGGGGHFFRKLMANVEETIGIGKGIPKIYATIDLERAR  60

Query  326  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR+++ E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+    LL GE
Sbjct  61   VGRTRIIEKEISNPRWYESFHIYCAHRASNVVFTVKDDNPIGATLIGRAYVSVDELLSGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EVD W+ +LD D+NPI S  KIHVKLQ+ DV R+
Sbjct  121  EVDRWVEILDEDKNPIESGGKIHVKLQYFDVTRD  154



>ref|NP_001042153.1| Os01g0172400 [Oryza sativa Japonica Group]
 sp|Q43007.2|PLDA1_ORYSJ RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAF04067.1| Os01g0172400 [Oryza sativa Japonica Group]
 gb|EEE53959.1| hypothetical protein OsJ_00559 [Oryza sativa Japonica Group]
Length=812

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 115/158 (73%), Gaps = 7/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LH  ++E   +      +        K VEG E  VG  K A+++Y+TIDL
Sbjct  1    MAQMLLHGTLHATIFEAASLSNPHRASGSAPKFIRKFVEGIEDTVGVGKGATKVYSTIDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTR++ +E  NPRWYESFHIYCAHMASNV+F+VK+DNPIGA  IGRAY+P + L
Sbjct  61   EKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKIDNPIGATNIGRAYLPVQEL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            L GEE+D WL + DN+R P+   SKIHVKLQ+ DV ++
Sbjct  121  LNGEEIDRWLDICDNNREPV-GESKIHVKLQYFDVSKD  157



>gb|EEC70024.1| hypothetical protein OsI_00588 [Oryza sativa Indica Group]
Length=812

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 115/158 (73%), Gaps = 7/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LH  ++E   +      +        K VEG E  VG  K A+++Y+TIDL
Sbjct  1    MAQMLLHGTLHATIFEAASLSNPHRASGSAPKFIRKFVEGIEDTVGVGKGATKVYSTIDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTR++ +E  NPRWYESFHIYCAHMASNV+F+VK+DNPIGA  IGRAY+P + L
Sbjct  61   EKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKIDNPIGATNIGRAYLPVQEL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            L GEE+D WL + DN+R P+   SKIHVKLQ+ DV ++
Sbjct  121  LNGEEIDRWLDICDNNREPV-GESKIHVKLQYFDVSKD  157



>tpg|DAA53240.1| TPA: phospholipase D family protein [Zea mays]
Length=243

 Score =   178 bits (452),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 110/147 (75%), Gaps = 7/147 (5%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIH  571
            LGGEE+D+WL + D +R P+   SKIH
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIH  146



>ref|XP_009408983.1| PREDICTED: phospholipase D alpha 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009408984.1| PREDICTED: phospholipase D alpha 1-like [Musa acuminata subsp. 
malaccensis]
Length=809

 Score =   188 bits (477),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 114/155 (74%), Gaps = 4/155 (3%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTD--GLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  322
            MAQ+LLHG+LH  +++ + +     G       +VEG E  +G  K  ++ YATIDLEKA
Sbjct  1    MAQILLHGTLHATIFDAESLTNPQRGSGGFLRMVVEGIEDTIGLGKGTTKHYATIDLEKA  60

Query  323  RVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  499
            RVGRTR+L DE  NPRWYESFHIYCAHMA+NV+F++K DNPIGA LIGRAY+P   +L G
Sbjct  61   RVGRTRMLSDEPVNPRWYESFHIYCAHMAANVIFTIKFDNPIGATLIGRAYLPVMEILDG  120

Query  500  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +EVD WL + D DRNP+   +KIHVKLQ+ DV+++
Sbjct  121  DEVDRWLEICDEDRNPV-GDAKIHVKLQYFDVLKD  154



>ref|XP_003569355.1| PREDICTED: phospholipase D alpha 1 [Brachypodium distachyon]
Length=811

 Score =   188 bits (477),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 116/157 (74%), Gaps = 6/157 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLE  316
            MAQ+LLHG+LHV ++E   +     + G      K VEG E  VG  K AS+LYATIDLE
Sbjct  1    MAQILLHGNLHVTIFEASSLSNPRASGGAPKFLRKFVEGIEDTVGVGKGASKLYATIDLE  60

Query  317  KARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLL  493
            KARVGRTR+L +E  NPRWYESFHIYCAH+A++V+F+VK DN IGA LIGRAY+P + LL
Sbjct  61   KARVGRTRMLSNEPVNPRWYESFHIYCAHLAADVIFTVKADNAIGATLIGRAYLPVQELL  120

Query  494  GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
             GEE+D WL + D++R P+   SKIHVKLQ+ D+ ++
Sbjct  121  DGEEIDRWLEVRDDNREPV-GESKIHVKLQYFDISKD  156



>gb|ACV70146.1| phospholipase D [Gossypium arboreum]
Length=807

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 112/153 (73%), Gaps = 2/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G      ++YATIDLE+ARV
Sbjct  1    MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGIGVPKIYATIDLERARV  59

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR ++ E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA  IGRAY+P + L  G+E
Sbjct  60   GRTRTIENETSNPRWYESFHIYCAHNASNVVFTVKDDNPIGATQIGRAYVPVKDLTEGDE  119

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD W+ +LD D+NPI S  KIHVKLQ+ DV ++
Sbjct  120  VDRWVVILDEDKNPIKSGGKIHVKLQYFDVTKD  152



>gb|ABX83202.2| phospholipase D [Lolium temulentum]
Length=811

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 113/157 (72%), Gaps = 6/157 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTD----GLHNLFHKIVEGAERVVGFNKTASRLYATIDLE  316
            MAQ+LLHG+LHV ++E   + T            KIVEG E  VG  K AS+LYATIDLE
Sbjct  1    MAQILLHGNLHVTIFEAQALSTGRASAAAPKFLRKIVEGLEDTVGVGKGASKLYATIDLE  60

Query  317  KARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLL  493
            KARVGRTR+L +E  +PRWYESFHIYCAH+A++V+F+VK DN IGA LIGRAY+P   LL
Sbjct  61   KARVGRTRMLANEPVSPRWYESFHIYCAHLAADVIFTVKADNAIGAALIGRAYLPVSELL  120

Query  494  GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
             G+E+D WL + D DR PI   SKIHVKLQF +  ++
Sbjct  121  AGDEIDRWLEVCDTDRQPI-GESKIHVKLQFFEATKD  156



>ref|XP_010465563.1| PREDICTED: phospholipase D alpha 1-like [Camelina sativa]
Length=810

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 114/151 (75%), Gaps = 2/151 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ LLHG+LH  ++E+D +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIFEIDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  326  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDEVINGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EVD W+ +LDND+NPI   SKIHVKLQ+  V
Sbjct  121  EVDRWVEILDNDKNPIQGGSKIHVKLQYFHV  151



>ref|XP_009348321.1| PREDICTED: phospholipase D alpha 1 [Pyrus x bretschneideri]
Length=810

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = +2

Query  140  LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  319
            ++E     LHG+LH  +YEVDK+ +    N F KI    E  VG  K  S+LYAT+DLE+
Sbjct  1    MTEAENQWLHGTLHATIYEVDKLHSSS-GNFFRKITGKIEETVGIGKGISKLYATVDLER  59

Query  320  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  496
            ARVGRTR+++ E  NPRWYESFHIYCAH  +NV+F+VK  NPIGA LIGRAY+P + L+ 
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHTTANVIFTVKESNPIGASLIGRAYVPVQELIE  119

Query  497  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            GEEVD+W  +LD  +NP+H + KIHVKLQF  V ++
Sbjct  120  GEEVDQWAEILDEKKNPVHGNPKIHVKLQFFHVTKD  155



>gb|AGW22212.1| phospholipase D alpha [Chorispora bungeana]
Length=809

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 111/150 (74%), Gaps = 1/150 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ LLHG+LH  +YEVD++          K++   E  +G  K  ++LY TIDL+KARV
Sbjct  1    MAQHLLHGTLHATIYEVDELHGGVRSGFLGKMLANVEEKIGVGKGETQLYTTIDLQKARV  60

Query  329  GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR + +E KNP+WYESFHIYC HMAS+++F+VK DNPIGA LIGRAY+P   ++ GEE
Sbjct  61   GRTRKIKNEPKNPKWYESFHIYCGHMASDIIFTVKDDNPIGATLIGRAYVPVDDVINGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            VD W+ +LDNDRNPIH  SKIHVKLQ+  V
Sbjct  121  VDRWVEILDNDRNPIHGGSKIHVKLQYFHV  150



>ref|XP_010487412.1| PREDICTED: phospholipase D alpha 1 isoform X2 [Camelina sativa]
Length=810

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 113/151 (75%), Gaps = 2/151 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ LLHG+LH  +YE+D +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEIDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  326  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGR Y+P   ++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRGYIPVDEVINGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EVD W+ +LDND+NPI   SKIHVKLQ+  V
Sbjct  121  EVDRWVEILDNDKNPIQGGSKIHVKLQYFHV  151



>ref|NP_001105686.1| phospholipase D alpha 1 [Zea mays]
 sp|Q43270.1|PLDA1_MAIZE RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Zea mays]
 dbj|BAA11135.1| phospholipase D [Zea mays]
Length=812

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 118/158 (75%), Gaps = 7/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+  + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLAVQDL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++
Sbjct  121  LGGEEIDKWLEISDENREPV-GDSKIHVKLQYFDVGKD  157



>ref|XP_006364211.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum tuberosum]
Length=805

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 113/153 (74%), Gaps = 7/153 (5%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MA +LLHG+LHV ++EVD++      N F K        VG  K ASR+YAT+DLEKARV
Sbjct  1    MAPILLHGTLHVTIHEVDRLHGKHGRNFFSK------ETVGMGKGASRIYATVDLEKARV  54

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ E  NPRWYESFHIYCAHMA NV+F+VK +N IGA LIGRAY+P   LL GEE
Sbjct  55   GRTRVIENEPNNPRWYESFHIYCAHMAKNVIFTVKDNNSIGATLIGRAYLPVNDLLEGEE  114

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VDEW+ +LD D NPI + SKIHV LQ+ ++ R+
Sbjct  115  VDEWIEILDEDENPIEAGSKIHVTLQYFEISRD  147



>gb|EYU24646.1| hypothetical protein MIMGU_mgv1a001477mg [Erythranthe guttata]
Length=812

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MA +LLHG+LH  + EVDK+      N F K++E     VG  K   ++YAT+DLEK+RV
Sbjct  1    MAHILLHGTLHATICEVDKLHGGADGNFFGKLMENIGETVGIGKGTPKIYATVDLEKSRV  60

Query  329  GRTRLLDEHKN-PRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTRL++   N PRWYESFHIYCAHMAS+V+F+VK  NPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRLIENEPNSPRWYESFHIYCAHMASSVIFTVKDANPIGATLIGRAYVPVHDLLDGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +D W+ +LD ++NP+   SKI VKLQF DV R+
Sbjct  121  IDRWVEILDENKNPVPEGSKIRVKLQFFDVTRD  153



>ref|XP_010503392.1| PREDICTED: phospholipase D alpha 1-like [Camelina sativa]
Length=810

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 113/151 (75%), Gaps = 2/151 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ LLHG+LH  ++E+D +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIFEIDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  326  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGR Y+P   ++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRGYVPVDEVINGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EVD W+ +LDND+NPI   SKIHVKLQ+  V
Sbjct  121  EVDRWVEILDNDKNPIQGGSKIHVKLQYFHV  151



>dbj|BAA11136.1| phospholipase D [Oryza sativa Japonica Group]
 dbj|BAA19467.1| phospholipase D [Oryza sativa Japonica Group]
Length=812

 Score =   185 bits (470),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 114/158 (72%), Gaps = 7/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LH  ++E   +      +        K VEG E  VG  K A+++Y+TIDL
Sbjct  1    MAQMLLHGTLHATIFEAASLSNPHRASGSAPKFIRKFVEGIEDTVGVGKGATKVYSTIDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTR++ +E  NPRWYESFHIYCAHMASNV+F+VK+DNPIGA  IGRAY+P + L
Sbjct  61   EKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKIDNPIGATNIGRAYLPVQEL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            L GEE+D WL + DN+R  +   SKIHVKLQ+ DV ++
Sbjct  121  LNGEEIDRWLDICDNNRESV-GESKIHVKLQYFDVSKD  157



>gb|EMT03624.1| Phospholipase D alpha 1 [Aegilops tauschii]
Length=812

 Score =   185 bits (470),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 115/158 (73%), Gaps = 7/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LHV ++E   +      + G      K VEG E  VG  K +S+LYATIDL
Sbjct  1    MAQILLHGNLHVTIFEASSLSHPGRASGGAPKFIRKFVEGIEETVGVGKGSSKLYATIDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTR+L +E  NPRWYESFHIYCAH+A++V+F++K DN IGA LIGRAY+P   L
Sbjct  61   EKARVGRTRMLGNEPVNPRWYESFHIYCAHLAADVIFTMKADNAIGATLIGRAYLPVGEL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            LGGEE+D WL + D++R P+   SKIHVKLQ+  V ++
Sbjct  121  LGGEEIDRWLEICDDNREPV-GESKIHVKLQYFGVDKD  157



>ref|XP_008373955.1| PREDICTED: phospholipase D alpha 1 [Malus domestica]
Length=810

 Score =   185 bits (469),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = +2

Query  140  LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  319
            ++E     LHG+LH  +YEVDK+ +    N   KI    E  VG  K  S+LYAT+DLE+
Sbjct  1    MTEAENHWLHGTLHATIYEVDKLHSSS-GNFLRKIAGKIEETVGIGKGISKLYATVDLER  59

Query  320  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  496
            ARVGRTR+++ E  NPRWYESFHIYCAH A+NV+F+VK  NPIGA LIGRAY+P + L+ 
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHTAANVIFTVKESNPIGASLIGRAYVPVQELIE  119

Query  497  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            GEEVD+W  +LD  +NP+H + KIHVKLQF  V ++
Sbjct  120  GEEVDQWAEILDEKKNPVHGNPKIHVKLQFFHVTKD  155



>ref|XP_008360327.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 1-like 
[Malus domestica]
Length=810

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 111/156 (71%), Gaps = 2/156 (1%)
 Frame = +2

Query  140  LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  319
            ++E     LHG+LH  +YEVDK+ +    N   KI    E  VG  K  SRLYAT+DLE+
Sbjct  1    MTEAENHWLHGTLHATIYEVDKLHSSS-GNFLRKITGKLEETVGIGKGISRLYATVDLER  59

Query  320  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  496
            ARVGRTR+++ E  NPRWYESFHIYCAH A+NV+F+VK  NPIGA LIGRAY+P + L+ 
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHTAANVIFTVKESNPIGASLIGRAYVPVQELIE  119

Query  497  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            GEEVD+W  +LD  + P+H + KIHVKLQF  V ++
Sbjct  120  GEEVDQWAEILDGKKEPVHGNPKIHVKLQFFHVTKD  155



>ref|XP_007217042.1| hypothetical protein PRUPE_ppa001519mg [Prunus persica]
 gb|EMJ18241.1| hypothetical protein PRUPE_ppa001519mg [Prunus persica]
Length=810

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = +2

Query  140  LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  319
            ++E  +  LHG+LH  +YEVDK+ +    NL  KI    E  VG  K  SRLYAT+DLE+
Sbjct  1    MAEPQEQWLHGTLHATIYEVDKLHSSS-GNLLRKITGKIEETVGIGKGVSRLYATVDLER  59

Query  320  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  496
            ARVGRTR+++ E  NPRWYESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P   L+ 
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVDDLVE  119

Query  497  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            GEEVD W  +LD  + P+H + KIHVKLQF  V ++
Sbjct  120  GEEVDRWAEILDEKKRPVHGNPKIHVKLQFFHVTKD  155



>ref|XP_008243731.1| PREDICTED: phospholipase D alpha 1 [Prunus mume]
 ref|XP_008243732.1| PREDICTED: phospholipase D alpha 1 [Prunus mume]
 ref|XP_008243733.1| PREDICTED: phospholipase D alpha 1 [Prunus mume]
Length=810

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = +2

Query  140  LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  319
            ++E  +  LHG+LH  +YEVDK+ +    NL  KI    E  VG  K  SRLYAT+DLE+
Sbjct  1    MAEPQEQWLHGTLHATIYEVDKLHSSS-GNLLRKITGKIEETVGIGKGVSRLYATVDLER  59

Query  320  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  496
            ARVGRTR+++ E  NPRWYESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P   L+ 
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVDDLVE  119

Query  497  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            GEEVD W  +LD  + P+H + KIHVKLQF  V ++
Sbjct  120  GEEVDRWAEILDEKKRPVHGNPKIHVKLQFFHVTKD  155



>gb|ACG80607.1| phospholipase D alpha [Prunus persica]
Length=810

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = +2

Query  140  LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  319
            ++E  +  LHG+LH  +YEVDK+ +    NL  KI    E  VG  K  SRLYAT+DLE+
Sbjct  1    MAEPQEQWLHGTLHATIYEVDKLHSSS-GNLLRKITGKIEETVGIGKGVSRLYATVDLER  59

Query  320  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  496
            ARVGRTR+++ E  NPRWYESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P   L+ 
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVDDLVE  119

Query  497  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            GEEVD W  +LD  + P+H + KIHVKLQF  V ++
Sbjct  120  GEEVDRWAEILDEKKRPVHGNPKIHVKLQFFHVTKD  155



>emb|CDY63527.1| BnaAnng18990D, partial [Brassica napus]
Length=334

 Score =   176 bits (445),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  322
            M + LLHG LH  +YEVD +     G    F KI+   E  +G  K   +LYATIDLEKA
Sbjct  1    MEEFLLHGRLHATIYEVDSLHGSEGGRSGFFGKILANVEETIGVGKGEPQLYATIDLEKA  60

Query  323  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  499
            RVGRTR + +E  NP+W+ESFHIYC HMA +V+F+VK DNPIGA LIGRAY+P   +L G
Sbjct  61   RVGRTRKITNEPNNPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRAYIPVEDILHG  120

Query  500  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EEVD W+ +LD ++ P+   SKIHVKLQ+  V ++
Sbjct  121  EEVDRWVEILDTEKKPVEGGSKIHVKLQYFGVEKD  155



>ref|XP_009365415.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=816

 Score =   182 bits (463),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 113/162 (70%), Gaps = 8/162 (5%)
 Frame = +2

Query  140  LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  319
            ++E     LHG+LH  +YEVDK+ +    N F KI    E  VG  K  S+LYAT+DLE+
Sbjct  1    MTEAENQWLHGTLHATIYEVDKLHSSS-GNFFRKITGKIEETVGIGKGISKLYATVDLER  59

Query  320  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIG------RAYMP  478
            ARVGRTR+++ E  NPRWYESFHIYCAH A+NV+F+VK  NPIGA LIG      RAY+P
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHTATNVIFTVKESNPIGASLIGGASLIGRAYVP  119

Query  479  ARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
             + L+ GEEVD+W  +LD  +NP+H + KIHVKLQF  V ++
Sbjct  120  VQELIEGEEVDQWAEILDEKKNPVHGNPKIHVKLQFFHVTKD  161



>emb|CDM81985.1| unnamed protein product [Triticum aestivum]
Length=812

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 113/158 (72%), Gaps = 7/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LHV ++E   +      + G      K VEG E  VG  K +S+LYATIDL
Sbjct  1    MAQILLHGNLHVTIFEASSLSHPGRASGGAPKFIRKFVEGIEETVGVGKGSSKLYATIDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EKARVGRTR+L +E  NPRWYESFHIYCAH+A++V+F++K DN IGA LIGRAY+P   L
Sbjct  61   EKARVGRTRMLGNEPVNPRWYESFHIYCAHLAADVIFTMKADNAIGATLIGRAYLPVAEL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            L GEE+D WL + D+ R P+   SKIHVKLQ+  V ++
Sbjct  121  LEGEEIDRWLEICDDKREPV-GESKIHVKLQYFGVDKD  157



>ref|XP_010462102.1| PREDICTED: phospholipase D alpha 2 [Camelina sativa]
 ref|XP_010462103.1| PREDICTED: phospholipase D alpha 2 [Camelina sativa]
 ref|XP_010462104.1| PREDICTED: phospholipase D alpha 2 [Camelina sativa]
Length=810

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            M + LLHG LH  +YEVD++ T+G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEEFLLHGRLHATIYEVDRLNTEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  326  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61   VGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EVD W+ +LDN++NPI   SKIHVKLQ+  V ++
Sbjct  121  EVDRWVEILDNEKNPIAGGSKIHVKLQYFGVEKD  154



>ref|XP_004303313.1| PREDICTED: phospholipase D alpha 1 [Fragaria vesca subsp. vesca]
Length=810

 Score =   179 bits (455),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 111/156 (71%), Gaps = 2/156 (1%)
 Frame = +2

Query  140  LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  319
            + + A+  LHG+LH  +YEVDK+      N   KI    E  VG  K  S+LYAT+DLE+
Sbjct  1    MGDAAEHWLHGTLHATIYEVDKLHGSS-GNFLRKITGKLEETVGLGKGVSKLYATVDLER  59

Query  320  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  496
            ARVGRTR+++ E  NP+W+ESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P  +L+ 
Sbjct  60   ARVGRTRVIEKEPSNPKWFESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVEQLIE  119

Query  497  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            GEEVD W  +LD+ + P+H   KIHVKLQF  V ++
Sbjct  120  GEEVDTWAEILDDKKKPVHGEPKIHVKLQFFHVSKD  155



>ref|NP_001267764.1| phospholipase D alpha 1-like [Setaria italica]
 gb|ADK60917.1| phospholipase D alpha 1 [Setaria italica]
Length=811

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 115/158 (73%), Gaps = 7/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+LLHG+LH  ++E  ++      + G      K+VEG E  VG  K  +++YATIDL
Sbjct  1    MAQILLHGTLHATIFEAQELSNPHRASGGAPKFIRKLVEGIEDTVGVGKGTTKIYATIDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            EK RVGRTR++ +E  NPRWYESFHIYCAH+A++V+F+VK+DNPIGA LIGRA++P + L
Sbjct  61   EKTRVGRTRMISNEPANPRWYESFHIYCAHLAADVIFTVKIDNPIGATLIGRAHLPVQDL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            L G+E+D+WL + D    PI   SKIHVKLQ+ DV ++
Sbjct  121  LDGKEIDKWLEICDEGGEPI-GGSKIHVKLQYFDVSKD  157



>ref|XP_002894388.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70647.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=810

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEEFLLHGRLHATIYEVDRLHAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  326  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR +  E KNP+W+ESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61   VGRTRKITKEPKNPKWFESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYIPVEDILHGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EVD W+ +LDND+NPI   SKIHVKLQ+  V ++
Sbjct  121  EVDRWVDILDNDKNPIAGGSKIHVKLQYFGVEKD  154



>gb|AAW83125.1| phospholipase D alpha [Fragaria x ananassa]
Length=810

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 110/156 (71%), Gaps = 2/156 (1%)
 Frame = +2

Query  140  LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  319
            + + A+  LHG+LH  +YEVDK+      N   KI    E  VG  K  S+LYAT+DLE+
Sbjct  1    MGDSAEHWLHGTLHATIYEVDKLHGSS-GNFLRKITGKLEETVGLGKGVSKLYATVDLER  59

Query  320  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  496
            ARVGRTR+++ E  NP W ESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P  +L+ 
Sbjct  60   ARVGRTRVIEKEPSNPNWSESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVEQLIE  119

Query  497  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            GEEVD W  +LD+ +NP+H   KIHVKLQF  V ++
Sbjct  120  GEEVDTWAKILDDKKNPVHGEPKIHVKLQFFHVSKD  155



>ref|XP_010500864.1| PREDICTED: phospholipase D alpha 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010500866.1| PREDICTED: phospholipase D alpha 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010500867.1| PREDICTED: phospholipase D alpha 2-like isoform X1 [Camelina 
sativa]
Length=811

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEEFLLHGRLHATIYEVDRLNAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  326  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61   VGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EVD W+ +LDN++NPI   SKIHVKLQ+  V ++
Sbjct  121  EVDRWVEILDNEKNPIAGGSKIHVKLQYFGVEKD  154



>ref|XP_010500868.1| PREDICTED: phospholipase D alpha 2-like isoform X2 [Camelina 
sativa]
Length=811

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEEFLLHGRLHATIYEVDRLNAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  326  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61   VGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EVD W+ +LDN++NPI   SKIHVKLQ+  V ++
Sbjct  121  EVDRWVEILDNEKNPIAGGSKIHVKLQYFGVEKD  154



>ref|XP_006392903.1| hypothetical protein EUTSA_v10011246mg [Eutrema salsugineum]
 gb|ESQ30189.1| hypothetical protein EUTSA_v10011246mg [Eutrema salsugineum]
Length=813

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            M + +LHG LH  +YEVD++  +G  + F  +I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEEFMLHGRLHATIYEVDRLHVEGGRSGFLGQILANVEETIGVGKGETQLYATIDLEKAR  60

Query  326  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK DNPIGA LIGRAY+P   +  GE
Sbjct  61   VGRTRKITKEPKNPKWYESFHIYCGHMAKHVIFTVKDDNPIGATLIGRAYVPVEDIFHGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EVD W+ +LD +R PI+  SKIHVKLQ+  V ++
Sbjct  121  EVDRWVEILDTERKPINGGSKIHVKLQYFGVEKD  154



>ref|XP_006306783.1| hypothetical protein CARUB_v10008323mg, partial [Capsella rubella]
 gb|EOA39681.1| hypothetical protein CARUB_v10008323mg, partial [Capsella rubella]
Length=813

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 111/155 (72%), Gaps = 2/155 (1%)
 Frame = +2

Query  146  EMAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKA  322
            +M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKA
Sbjct  3    KMDEFLLHGRLHATIYEVDRLNAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKA  62

Query  323  RVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  499
            RVGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L G
Sbjct  63   RVGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHG  122

Query  500  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EEVD W+ +LDN++NPI   SKIHVKLQ+  V ++
Sbjct  123  EEVDRWVEILDNEKNPIAGGSKIHVKLQYFGVEKD  157



>ref|XP_002443625.1| hypothetical protein SORBIDRAFT_08g022520 [Sorghum bicolor]
 gb|EES17463.1| hypothetical protein SORBIDRAFT_08g022520 [Sorghum bicolor]
Length=813

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 118/161 (73%), Gaps = 9/161 (6%)
 Frame = +2

Query  140  LSEMAQLLLHGSLHVCVYEVDKI----KTDGLHNLF-HKIVEGAERVVGFNKTASRLYAT  304
            ++EM+  LLHG+LH  ++E   +    +  G    F  K+VEG E  VG  K ++++YAT
Sbjct  1    MAEMS--LLHGTLHATIFEAASLSNPQRASGRAPKFIRKLVEGIEESVGVGKGSTKIYAT  58

Query  305  IDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPA  481
            IDLEK RVGRTR++ +E  NPRWYESFHIYCAH A+NV+F+VK+DNPIGA LIGRAYMP 
Sbjct  59   IDLEKTRVGRTRIISNEPVNPRWYESFHIYCAHRAANVIFTVKIDNPIGASLIGRAYMPV  118

Query  482  RRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
              +L GEE+D+WL + D+ R PI  HSKIHVK+Q+ DV ++
Sbjct  119  ADILVGEEIDKWLEICDDKREPI-GHSKIHVKIQYFDVSKD  158



>ref|XP_007204652.1| hypothetical protein PRUPE_ppa001528mg [Prunus persica]
 gb|EMJ05851.1| hypothetical protein PRUPE_ppa001528mg [Prunus persica]
Length=807

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 111/151 (74%), Gaps = 6/151 (4%)
 Frame = +2

Query  149  MAQ-LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ +LLHG LH  +YEVD++  DG    F K+++   + V F K  S+ YATIDLE AR
Sbjct  1    MAQTVLLHGVLHTTIYEVDRLMADGCCIFFCKLLK---KSVEFGK-GSKFYATIDLENAR  56

Query  326  VGRTRLLDE-HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTRLL+   +NPRW ESFHIYCAH ASNVVFS+K DN IGA++IGRAYMPA  LL GE
Sbjct  57   VGRTRLLENATQNPRWRESFHIYCAHKASNVVFSIKEDNAIGAKVIGRAYMPAAELLNGE  116

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EVD WL +LDN+  P+H  SKIHVKL F  V
Sbjct  117  EVDRWLKILDNNNKPLHGGSKIHVKLCFSSV  147



>gb|AAL48261.2|AF451979_1 phospholipase D1 [Papaver somniferum]
 gb|AAL48263.2|AF451981_1 phospholipase D1 [Papaver somniferum]
Length=813

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 120/158 (76%), Gaps = 6/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKI-----KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+ LHG+LHV ++E + I     KT G    F K+VE  E  VGF K AS LYA++DL
Sbjct  1    MAQISLHGTLHVTIFEANSISHPDRKTGGAPKFFRKLVENIEETVGFGKGASMLYASVDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            +KARVGRTR++ DE  NP+WYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P  ++
Sbjct  61   DKARVGRTRIIKDEPVNPKWYESFHIYCAHMAANVIFTVKDDNPIGATLIGRAYVPIDKV  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            L GEEVDEW+ ++D +RNP+    KIHVKLQ+ DV ++
Sbjct  121  LSGEEVDEWVEVVDQERNPVQGGCKIHVKLQYFDVGQD  158



>ref|XP_010925209.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
 ref|XP_010925210.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
 ref|XP_010925211.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
Length=810

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 112/155 (72%), Gaps = 3/155 (2%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKT--DGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  322
            MA +LLHG+LH+ ++E D + +   G      ++VEG    +G  K +S+LYATID+EKA
Sbjct  1    MAYILLHGTLHITIFEADSLSSASGGGPKFIRQLVEGIGDTIGLGKGSSQLYATIDVEKA  60

Query  323  RVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  499
            RVGRTRL+ +E   PRWYESFHIYCAH+A++V+F+VK D PIGA L+GRAY+P   +L G
Sbjct  61   RVGRTRLITNEPVKPRWYESFHIYCAHLAASVIFTVKDDKPIGASLVGRAYLPVTEILDG  120

Query  500  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EE+D WL + D D  P+   +KIHVK+Q+ D+ ++
Sbjct  121  EEIDRWLEICDEDSKPLDGGAKIHVKVQYFDISKD  155



>gb|EPS60466.1| hypothetical protein M569_14336, partial [Genlisea aurea]
Length=770

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +2

Query  245  VEGAERVVGFNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFS  424
             EG E  +GF KTASRLYATIDL  ARVGRTRLL+E  NPRWYESFHIYCAH  S+VVFS
Sbjct  1    AEGVEEALGFRKTASRLYATIDLGIARVGRTRLLEETSNPRWYESFHIYCAHTTSDVVFS  60

Query  425  VKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VK+DNPIGAE+IGRA + A  ++ GEE+D WLP+L++D   IH + KIHVKLQF DV RE
Sbjct  61   VKIDNPIGAEVIGRAALAAADIVVGEEIDAWLPILNSDHKAIHGNPKIHVKLQFFDVARE  120



>ref|XP_008242775.1| PREDICTED: phospholipase D alpha 1-like [Prunus mume]
Length=807

 Score =   177 bits (448),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 110/151 (73%), Gaps = 6/151 (4%)
 Frame = +2

Query  149  MAQ-LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ +LLHG LH  +YEVD++   G    F K+++   + V F K  S+LYATIDLE AR
Sbjct  1    MAQTVLLHGVLHTTIYEVDRLMASGCSIFFCKLLK---KSVEFGK-GSKLYATIDLENAR  56

Query  326  VGRTRLLDE-HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTRLL+   KNPRW ESFHIYCAH ASNVVFS+K DN IGA +IGRAYMPA  LL GE
Sbjct  57   VGRTRLLENATKNPRWRESFHIYCAHKASNVVFSIKEDNAIGATVIGRAYMPAAELLNGE  116

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EVD WL +LDN+  P+H  SKIHVKL+   V
Sbjct  117  EVDRWLKILDNNNKPLHGGSKIHVKLRLSSV  147



>emb|CDX87920.1| BnaC06g09820D [Brassica napus]
Length=343

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  322
            M + LLHG LH  +YE+D +     G      K++   E  +G  K  ++LYATIDLEKA
Sbjct  1    MEEFLLHGRLHATIYEIDALHATQGGRSGFLGKMLANVEEKIGVGKGETQLYATIDLEKA  60

Query  323  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  499
            RVGRTR + +E K+P+W+ESFHIYC HMA +V+F+VK DNPIGA LIGR Y+P   +L G
Sbjct  61   RVGRTRKITNEPKSPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRGYVPVEDILHG  120

Query  500  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EEVD W+ +LD ++ PI   SKIHVKLQ+  V ++
Sbjct  121  EEVDRWVEILDTEKKPIEGGSKIHVKLQYFGVEKD  155



>gb|AAL48262.2|AF451980_1 phospholipase D2 [Papaver somniferum]
 gb|AAL48264.2|AF451982_1 phospholipase D2 [Papaver somniferum]
Length=813

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 120/158 (76%), Gaps = 6/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKI-----KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MAQ+ LHG+LHV ++E + I     KT G    F K+VE  E  VGF K AS LYA++DL
Sbjct  1    MAQISLHGTLHVTIFEANSISHPDRKTGGAPKFFRKLVENIEETVGFGKGASMLYASVDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            +KARVGRTR++ DE  NP+WYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P  ++
Sbjct  61   DKARVGRTRIIKDEPVNPKWYESFHIYCAHMAANVIFTVKDDNPIGATLIGRAYVPIDQV  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            L GEEVDEW+ ++D +RNP+    KIHVKLQ+ DV ++
Sbjct  121  LSGEEVDEWVEVVDEERNPVQGGCKIHVKLQYFDVGQD  158



>ref|XP_009123823.1| PREDICTED: phospholipase D alpha 2-like [Brassica rapa]
Length=812

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  322
            M + LLHG LH  +YEVD +     G    F KI+   E  +G  K   +LYATIDLEKA
Sbjct  1    MEEFLLHGRLHATIYEVDSLHGSEGGRSGFFGKILANVEETIGVGKGEPQLYATIDLEKA  60

Query  323  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  499
            RVGRTR + +E  NP+W+ESFHIYC HMA +V+F+VK DNPIGA LIGRAY+P   +L G
Sbjct  61   RVGRTRKITNEPNNPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRAYIPVEDILHG  120

Query  500  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EEVD W+ +LD ++ P+   SKIHVKLQ+  V ++
Sbjct  121  EEVDRWVEILDTEKKPVEGGSKIHVKLQYFGVEKD  155



>ref|XP_010479770.1| PREDICTED: phospholipase D alpha 2-like [Camelina sativa]
 ref|XP_010479771.1| PREDICTED: phospholipase D alpha 2-like [Camelina sativa]
 ref|XP_010479772.1| PREDICTED: phospholipase D alpha 2-like [Camelina sativa]
Length=810

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 109/154 (71%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEEFLLHGRLHATIYEVDRLNAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  326  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61   VGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EVD W+ +LDN++ PI   SKIHVK+Q+  V ++
Sbjct  121  EVDRWVEILDNEKKPIAGGSKIHVKIQYFGVEKD  154



>emb|CDY47540.1| BnaC03g69220D [Brassica napus]
Length=812

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  322
            M + LLHG LH  +YEVD +     G    F KI+   E  +G  K   +LYATIDLEKA
Sbjct  1    MEEFLLHGRLHATIYEVDSLHGSEGGRSGFFGKILANVEETIGVGKGEPQLYATIDLEKA  60

Query  323  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  499
            RVGRTR + +E  NP+W+ESFHIYC HMA +V+F+VK DNPIGA LIGRAY+P   +L G
Sbjct  61   RVGRTRKITNEPNNPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRAYIPVEDILHG  120

Query  500  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EEVD W+ +LD ++ P+   SKIHVKLQ+  V ++
Sbjct  121  EEVDRWVEILDTEKKPVEGGSKIHVKLQYFGVEKD  155



>ref|NP_175666.1| phospholipase D alpha 2 [Arabidopsis thaliana]
 sp|Q9SSQ9.1|PLDA2_ARATH RecName: Full=Phospholipase D alpha 2; Short=AtPLDalpha2; Short=PLD 
alpha 2; AltName: Full=Choline phosphatase 2; AltName: 
Full=Phosphatidylcholine-hydrolyzing phospholipase D 2 [Arabidopsis 
thaliana]
 gb|AAD55607.1|AC008016_17 Similar to gb|AF090445 phospholipase D1 from Brassica oleacea 
[Arabidopsis thaliana]
 gb|AEE32825.1| phospholipase D alpha 2 [Arabidopsis thaliana]
Length=810

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 109/154 (71%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            M + LLHG LH  +YEVD +  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEECLLHGRLHATIYEVDHLHAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  326  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR +  E KNP+W+ESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61   VGRTRKITKEPKNPKWFESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYIPVEDILHGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EVD W+ +LDN++NPI   SKIHVKLQ+  V ++
Sbjct  121  EVDRWVDILDNEKNPIAGGSKIHVKLQYFGVEKD  154



>tpg|DAA53245.1| TPA: phospholipase D family protein, partial [Zea mays]
Length=332

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 101/123 (82%), Gaps = 2/123 (2%)
 Frame = +2

Query  239  KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNV  415
            ++VEG E  VG  K A+++YAT+DLEKARVGRTR++ +E  NPRWYESFHIYCAHMA++V
Sbjct  34   QLVEGIEDTVGVGKGATKIYATVDLEKARVGRTRMISNEPVNPRWYESFHIYCAHMAADV  93

Query  416  VFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            +F+VK+DN IGA LIGRAY+P + LLGGEE+D+WL + D +R P+   SKIHVKLQ+ DV
Sbjct  94   IFTVKIDNSIGASLIGRAYLPVQDLLGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDV  152

Query  596  VRE  604
             ++
Sbjct  153  GKD  155



>sp|O04883.1|PLDA1_PIMBR RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Spuriopimpinella brachycarpa]
 gb|AAB70463.1| phospholipase D [Spuriopimpinella brachycarpa]
Length=808

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 110/153 (72%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MA+ LLHG+LHV ++EVD +K   +      +     + +   K   ++YA+IDL+KARV
Sbjct  1    MAKTLLHGTLHVTIFEVDHLKAGSVVVFSESLRRTLRKPLVLAKGTPKIYASIDLDKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ E  NP+W ESFHIYC H ++NV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRMIENEPNNPKWNESFHIYCGHPSTNVIFTVKDDNPIGATLIGRAYLPVHELLEGEE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD+W+ +LD D+NPI   SKIHVKLQ+ D+ ++
Sbjct  121  VDKWVEILDEDKNPISEGSKIHVKLQYFDITQD  153



>ref|XP_002524502.1| phopholipase d alpha, putative [Ricinus communis]
 gb|EEF37942.1| phopholipase d alpha, putative [Ricinus communis]
Length=725

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 109/152 (72%), Gaps = 1/152 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MA +LLHG L + ++EVD++   G    F KI+E  E  VG  K  S+LYATIDLE  +V
Sbjct  1    MAPVLLHGILDLTIFEVDRLSGSGCSKFFCKILENVEETVGCGKGFSKLYATIDLEGTKV  60

Query  329  GRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR L   + +P+W ESFHIYCAH+ASNV FS+KV +PIG+++IGRAY+P   LL GE+
Sbjct  61   GRTRELKHARSDPQWDESFHIYCAHLASNVTFSIKVKDPIGSQVIGRAYLPVVELLNGEK  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVR  601
            VD+WL +L+ +  P+H   KIHV++QFLD  +
Sbjct  121  VDKWLRILNKNHKPLHRGLKIHVRVQFLDATK  152



>emb|CBI28204.3| unnamed protein product [Vitis vinifera]
Length=703

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 109/154 (71%), Gaps = 5/154 (3%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEG-AERVVGFNKTASRLYATIDLEKAR  325
            M Q L+HG+LH  +YEVD + T G  N   K+    ++R+VG     S++Y TIDLEKA 
Sbjct  2    MEQSLVHGTLHATIYEVDGLSTGGPWNFIQKVYTTLSKRIVG--APISKIYVTIDLEKAG  59

Query  326  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRT  LD E  NPRWY+SFHIYCAH AS+VVFSVK DNPIGA +IGRA++P   LL G 
Sbjct  60   VGRTSKLDNEDSNPRWYQSFHIYCAHKASHVVFSVKQDNPIGATVIGRAHLPVGELLEG-  118

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EVD WL L  +D  PI+  SK+HVKLQF+DV RE
Sbjct  119  EVDRWLELFHHDHTPINGGSKLHVKLQFVDVTRE  152



>ref|XP_011070230.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 1-like 
[Sesamum indicum]
Length=819

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 110/171 (64%), Gaps = 24/171 (14%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKI------------------KTDGLHNLFHKIVEGAERVVGF  274
            MA  LLHG+LH  ++E D++                  KT    + F + +  +  +VG 
Sbjct  1    MAPRLLHGTLHATIFEADRLQGGFSLSHLFGTTGNPQKKTKSFLSQFKRFLLCSPEIVG-  59

Query  275  NKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  451
                SR+YATIDLE+ARVGRTR++ +E  NPRW E FHIYCAH  SN+VF+VK DNPIGA
Sbjct  60   ----SRIYATIDLERARVGRTRVIQNEPSNPRWSEYFHIYCAHNVSNIVFTVKDDNPIGA  115

Query  452  ELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
             LIGRAY+P   L+ G  VD W+ +LD DRNPIH  SKIHVKLQF  V++E
Sbjct  116  TLIGRAYLPVEELMSGHMVDRWIDILDEDRNPIHGGSKIHVKLQFFQVIQE  166



>ref|XP_010545768.1| PREDICTED: phospholipase D alpha 1 [Tarenaya hassleriana]
Length=810

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKI-KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ LLHG+LH  VYE+D +    G    F +++   E  +G  K  ++LYAT+DLEKAR
Sbjct  1    MAQRLLHGTLHATVYEIDHLHGGGGRSGFFGQLLANVEETIGVGKGETQLYATVDLEKAR  60

Query  326  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + D+  +P+W ESFHIYCAHMASN++F+VK  NPIGA LIGRAY+P   +  GE
Sbjct  61   VGRTRKIKDDPNSPKWNESFHIYCAHMASNIIFTVKDANPIGATLIGRAYVPVEEIWDGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EV++W+ +LD +RNPI   SKI V+LQ+ DV ++
Sbjct  121  EVEKWVEILDTNRNPIKGDSKIRVRLQYFDVTKD  154



>tpg|DAA53246.1| TPA: phospholipase D family protein [Zea mays]
Length=655

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 102/125 (82%), Gaps = 2/125 (2%)
 Frame = +2

Query  233  FHKIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMAS  409
            F ++VEG E  VG  K A+++YAT+DLEKARVGRTR++ +E  NPRWYESFHIYCAHMA+
Sbjct  5    FRQLVEGIEDTVGVGKGATKIYATVDLEKARVGRTRMISNEPVNPRWYESFHIYCAHMAA  64

Query  410  NVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFL  589
            +V+F+VK+DN IGA LIGRAY+P + LLGGEE+D+WL + D +R P+   SKIHVKLQ+ 
Sbjct  65   DVIFTVKIDNSIGASLIGRAYLPVQDLLGGEEIDKWLEICDENREPV-GDSKIHVKLQYF  123

Query  590  DVVRE  604
            DV ++
Sbjct  124  DVGKD  128



>ref|XP_010656428.1| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
Length=814

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 109/153 (71%), Gaps = 7/153 (5%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            M Q L+HG+LH  +YEVD + T G  N   K+   ++R+VG     S++Y TIDLEKA V
Sbjct  2    MEQSLVHGTLHATIYEVDGLSTGGPWNFIQKL---SKRIVG--APISKIYVTIDLEKAGV  56

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRT  LD E  NPRWY+SFHIYCAH AS+VVFSVK DNPIGA +IGRA++P   LL G E
Sbjct  57   GRTSKLDNEDSNPRWYQSFHIYCAHKASHVVFSVKQDNPIGATVIGRAHLPVGELLEG-E  115

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD WL L  +D  PI+  SK+HVKLQF+DV RE
Sbjct  116  VDRWLELFHHDHTPINGGSKLHVKLQFVDVTRE  148



>emb|CBI28205.3| unnamed protein product [Vitis vinifera]
Length=604

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 106/153 (69%), Gaps = 7/153 (5%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            M Q+LLHG+LH  +YEVD++ + G  N   K+    ER       +S++Y TIDL+KARV
Sbjct  1    MEQILLHGTLHGTIYEVDRLSSGGPWNFIDKLKRRIERA-----GSSKVYVTIDLDKARV  55

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR L+ E  NP W E FHIYCAH AS+VVFSVK +NPIGA +IGRA +P   LL G E
Sbjct  56   GRTRKLENEETNPHWSECFHIYCAHKASHVVFSVKQENPIGATVIGRAQLPVEELLEG-E  114

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD WL L  +DR PIH  SK+HVKLQF DV RE
Sbjct  115  VDRWLELFHHDRTPIHGGSKLHVKLQFFDVTRE  147



>ref|XP_011017763.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
 ref|XP_011017764.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
Length=831

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 115/173 (66%), Gaps = 1/173 (1%)
 Frame = +2

Query  86   ISDLPVLCFILSASS*PPLSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERV  265
            IS L  +    S SS      M  +L+HG+LHV +YE  ++   G      KI+E  ++ 
Sbjct  3    ISALSGIIHTRSRSSTYVTRTMEPVLIHGTLHVTIYEACRVFGSGCSKFCCKILENIDKN  62

Query  266  VGFNKTASRLYATIDLEKARVGRTRLLDE-HKNPRWYESFHIYCAHMASNVVFSVKVDNP  442
            VGF K   +LYA I LE+ARVGRTRLL+  H +P+W+ESFHIYCAH+ASNV+FSVK DNP
Sbjct  63   VGFGKGFCKLYAGIYLEEARVGRTRLLEHPHSDPQWFESFHIYCAHIASNVIFSVKEDNP  122

Query  443  IGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVR  601
            I A +IG+AY+P   LL G+EVD+WL +L  +  P H  SKIHVK+QF D  +
Sbjct  123  IEAVVIGKAYLPVAELLDGKEVDKWLDILHKNHRPPHKGSKIHVKVQFFDATK  175



>gb|KDP32412.1| hypothetical protein JCGZ_13337 [Jatropha curcas]
Length=810

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 110/152 (72%), Gaps = 3/152 (2%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MA +LLHG LHV ++E+D++      N F KIVE  E  V   K+ S++YATI+LE+AR+
Sbjct  1    MASVLLHGILHVTIFEIDRLSGSSCCNFFCKIVEKCEGTVACGKSISKIYATIELEEARI  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR L     NP+W+ESFHIYCAHMASNV FS+K+ +PIG+++IGRA +PA ++L GE 
Sbjct  61   GRTRELKHASSNPQWHESFHIYCAHMASNVTFSIKIKDPIGSQVIGRASLPAMQVLNGEA  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVR  601
            ++ WL +L+    P+   SKIHVKLQF DV +
Sbjct  121  LNTWLRILNKKNKPL--RSKIHVKLQFFDVSK  150



>emb|CDY60551.1| BnaA05g35700D [Brassica napus]
Length=812

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  322
            M + LLHG LH  +YE+D +     G      K++   E  +G  K  ++LYATIDLEKA
Sbjct  1    MEEFLLHGRLHATIYEIDALHATQGGRSGFLGKMLANVEEKIGVGKGETQLYATIDLEKA  60

Query  323  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  499
            RVGRTR + +E K+P+W+ESFHIYC HMA +V+F+VK DNPIGA LIGR Y+P   +L G
Sbjct  61   RVGRTRKITNEPKSPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRGYVPVEDILHG  120

Query  500  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EEVD W+ +LD ++ PI   SKIHVKLQ+  V ++
Sbjct  121  EEVDRWVEILDTEKKPIEGGSKIHVKLQYFGVEKD  155



>ref|XP_009144830.1| PREDICTED: phospholipase D alpha 2 [Brassica rapa]
Length=812

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  322
            M + LLHG LH  +YE+D +     G      K++   E  +G  K  ++LYATIDLEKA
Sbjct  1    MEEFLLHGRLHATIYEIDALHATQGGRSGFLGKMLANVEEKIGVGKGETQLYATIDLEKA  60

Query  323  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  499
            RVGRTR + +E K+P+W+ESFHIYC HMA +V+F+VK DNPIGA LIGR Y+P   +L G
Sbjct  61   RVGRTRKITNEPKSPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRGYVPVEDILHG  120

Query  500  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EEVD W+ +LD ++ PI   SKIHVKLQ+  V ++
Sbjct  121  EEVDRWVEILDTEKKPIEGGSKIHVKLQYFGVEKD  155



>ref|XP_002325225.2| hypothetical protein POPTR_0018s13110g [Populus trichocarpa]
 gb|EEF03790.2| hypothetical protein POPTR_0018s13110g [Populus trichocarpa]
Length=808

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 108/152 (71%), Gaps = 1/152 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            M  +LLHG+LHV +YE  ++   G      KI+E  ++ VGF K   +LYA I LE+ RV
Sbjct  1    MEPVLLHGTLHVTIYEACRVFGSGCSKFCCKILENIDKTVGFGKGFCKLYAGIYLEETRV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTRLL+  H +P+W+ESFHIYCAH+ASNV+FSVK DNPI A +IG+AY+P   LL G+E
Sbjct  61   GRTRLLEHPHSDPQWFESFHIYCAHIASNVIFSVKEDNPIEAVVIGKAYLPVAELLDGKE  120

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVR  601
            V++WL +L  +  P+H  SKIHVK+QF D  +
Sbjct  121  VEKWLNILHKNHRPLHKGSKIHVKVQFFDATK  152



>ref|XP_009787005.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Nicotiana 
sylvestris]
Length=790

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +2

Query  239  KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNV  415
            KI E  E  VG  K AS++YAT+DLEKARVGRTR+++ E  NPRW ESFHIYCAHMASNV
Sbjct  11   KIKETVEETVGVGKGASKMYATVDLEKARVGRTRVIENEPSNPRWNESFHIYCAHMASNV  70

Query  416  VFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            +F+VK +N IGA LIGRAY+P   LL GEEVDEW+ +LD D+NPI   SKIHV LQF D+
Sbjct  71   IFTVKDNNSIGATLIGRAYLPVNELLEGEEVDEWIEILDEDKNPIKEGSKIHVTLQFFDI  130

Query  596  VRE  604
             R+
Sbjct  131  SRD  133



>gb|EYU32345.1| hypothetical protein MIMGU_mgv1a001383mg [Erythranthe guttata]
Length=828

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 110/171 (64%), Gaps = 24/171 (14%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKI------------------KTDGLHNLFHKIVEGAERVVGF  274
            MA  LLHG+LH  +YE D++                  +T    + F + V     VVG 
Sbjct  1    MAPRLLHGTLHATIYEADRLQGRFNFDLCGGTAGNPQKRTKRFLSQFKRYVLCRPEVVG-  59

Query  275  NKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  451
                SR+YATIDLE+ARVGRTR+++ E  NPRWYE+FHIYCAH  SN+VF+VK DNPIGA
Sbjct  60   ----SRVYATIDLERARVGRTRMIENEPSNPRWYENFHIYCAHTVSNIVFTVKDDNPIGA  115

Query  452  ELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
             LIGRAY+P   L+ G  VD W+ ++D DRNPIH  SKIHVKLQ+  V +E
Sbjct  116  ILIGRAYLPVEDLISGRAVDRWIEIVDEDRNPIHGGSKIHVKLQYFHVFQE  166



>ref|XP_002282187.3| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
 ref|XP_010656427.1| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
Length=814

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 106/153 (69%), Gaps = 7/153 (5%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            M Q+LLHG+LH  +YEVD++ + G  N   K+    ER       +S++Y TIDL+KARV
Sbjct  2    MEQILLHGTLHGTIYEVDRLSSGGPWNFIDKLKRRIERA-----GSSKVYVTIDLDKARV  56

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR L+ E  NP W E FHIYCAH AS+VVFSVK +NPIGA +IGRA +P   LL G E
Sbjct  57   GRTRKLENEETNPHWSECFHIYCAHKASHVVFSVKQENPIGATVIGRAQLPVEELLEG-E  115

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD WL L  +DR PIH  SK+HVKLQF DV RE
Sbjct  116  VDRWLELFHHDRTPIHGGSKLHVKLQFFDVTRE  148



>gb|AFW76092.1| phospholipase D family protein [Zea mays]
Length=529

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 108/163 (66%), Gaps = 11/163 (7%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA++LLHGSLHV ++E +++      +        K+VEG E  VG  K  S++YATI L
Sbjct  1    MARILLHGSLHVTIFEAEELSNSSRPSSQAPGFLRKLVEGIEDTVGVGKGTSKIYATIGL  60

Query  314  EKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             K RVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  61   GKTRVGRTRKLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  120

Query  491  LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRE  604
              G EVD WL L D      DR P+ S  K+HV+LQ+ D+ ++
Sbjct  121  FEGHEVDRWLHLCDGGGDDKDRTPLESGGKVHVRLQYFDISKD  163



>ref|XP_008673447.1| PREDICTED: phospholipase D alpha 1 isoform X2 [Zea mays]
Length=810

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 101/123 (82%), Gaps = 2/123 (2%)
 Frame = +2

Query  239  KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNV  415
            ++VEG E  VG  K A+++YAT+DLEKARVGRTR++ +E  NPRWYESFHIYCAHMA++V
Sbjct  34   QLVEGIEDTVGVGKGATKIYATVDLEKARVGRTRMISNEPVNPRWYESFHIYCAHMAADV  93

Query  416  VFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            +F+VK+DN IGA LIGRAY+P + LLGGEE+D+WL + D +R P+   SKIHVKLQ+ DV
Sbjct  94   IFTVKIDNSIGASLIGRAYLPVQDLLGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDV  152

Query  596  VRE  604
             ++
Sbjct  153  GKD  155



>ref|XP_008650412.1| PREDICTED: phospholipase D alpha 1-like [Zea mays]
Length=733

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 108/163 (66%), Gaps = 11/163 (7%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA++LLHGSLHV ++E +++      +        K+VEG E  VG  K  S++YATI L
Sbjct  1    MARILLHGSLHVTIFEAEELSNSSRPSSQAPGFLRKLVEGIEDTVGVGKGTSKIYATIGL  60

Query  314  EKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             K RVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  61   GKTRVGRTRKLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  120

Query  491  LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRE  604
              G EVD WL L D      DR P+ S  K+HV+LQ+ D+ ++
Sbjct  121  FEGHEVDRWLHLCDGGGDDKDRTPLESGGKVHVRLQYFDISKD  163



>ref|XP_006654096.1| PREDICTED: phospholipase D alpha 1-like [Oryza brachyantha]
Length=818

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 111/162 (69%), Gaps = 10/162 (6%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA++LLHG+LHV V+E D +      +        K+VEG E  VG  K  S++YATI L
Sbjct  1    MAKILLHGTLHVTVFEADGLSNPSRPSSQAPQFLRKLVEGIEDTVGVGKGTSKVYATIGL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            +KARVGRTR L D+   PRWYESFH+YCAH+AS+V+F++K  NPIG+ L+G AY+P R +
Sbjct  61   DKARVGRTRTLADDTAAPRWYESFHVYCAHLASDVLFTLKAKNPIGSSLLGVAYLPVRDI  120

Query  491  LGGEEVDEWLPLLDN---DRNPI-HSHSKIHVKLQFLDVVRE  604
              G EV+ WLPL D+   +R P+    SK+HVKLQ+ D+ ++
Sbjct  121  FAGAEVERWLPLCDDVDAERKPVGDGDSKVHVKLQYFDISKD  162



>ref|XP_002440692.1| hypothetical protein SORBIDRAFT_09g005220 [Sorghum bicolor]
 gb|EES19122.1| hypothetical protein SORBIDRAFT_09g005220 [Sorghum bicolor]
Length=700

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 108/163 (66%), Gaps = 11/163 (7%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDG-----LHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA++LLHGSLHV ++E +++   G           K+VE  E  VG  K  S++YATI L
Sbjct  1    MARILLHGSLHVTIFEAEELSNSGRPSSQAPGFLRKLVETVEDTVGVGKGTSKIYATIGL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             KARVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  61   GKARVGRTRTLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  120

Query  491  LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRE  604
              G EVD WL L D      +R P+ +  K+HVKLQ+ D+ ++
Sbjct  121  FDGHEVDRWLHLCDGGGDDKNRTPLETGGKVHVKLQYFDISKD  163



>ref|XP_008649399.1| PREDICTED: phospholipase D alpha 1-like [Zea mays]
 ref|XP_008649400.1| PREDICTED: phospholipase D alpha 1-like [Zea mays]
Length=821

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 108/163 (66%), Gaps = 11/163 (7%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA++LLHGSLHV ++E +++      +        K+VEG E  VG  K  S++YATI L
Sbjct  1    MARILLHGSLHVTIFEAEELSNSSRPSSQAPGFLRKLVEGIEDTVGVGKGTSKIYATIGL  60

Query  314  EKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             K RVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  61   GKTRVGRTRKLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  120

Query  491  LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRE  604
              G EVD WL L D      DR P+ S  K+HV+LQ+ D+ ++
Sbjct  121  FEGHEVDRWLHLCDGGGDDKDRTPLESGGKVHVRLQYFDISKD  163



>ref|XP_004965943.1| PREDICTED: phospholipase D alpha 2-like [Setaria italica]
Length=818

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 106/158 (67%), Gaps = 6/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA LLLHG+L   + E D +      T G   +F K VEG E  +G  + A+RLYAT+D+
Sbjct  1    MAHLLLHGTLDATILEADHLTNPTRATGGAPGIFRKFVEGFEDSLGLGQGATRLYATVDI  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             +ARVGRTR++  +  NPRWYE+FHIYCAH AS+VVFSVK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVIAGDPVNPRWYEAFHIYCAHFASDVVFSVKAAQPIGATLIGRAYLPVRDL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            LGG E+D WL +LD  R  +    KI V+L+F DV  +
Sbjct  121  LGGHEIDRWLDVLDAARKRLPHGPKIRVRLRFQDVAAD  158



>ref|NP_001054773.2| Os05g0171000 [Oryza sativa Japonica Group]
 dbj|BAF16687.2| Os05g0171000 [Oryza sativa Japonica Group]
Length=686

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 109/161 (68%), Gaps = 9/161 (6%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA++LLHG++HV ++E + +      +        K+VEG E  VG  K  S++YATI L
Sbjct  1    MAKILLHGTMHVTIFEAESLSNPSRPSSQAPQFLRKLVEGIEDTVGVGKGTSKVYATIGL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            +KARVGRTR L D+   PRWYESFH+YCAH+A++V F++K  NPIGA L+G  Y+P R +
Sbjct  61   DKARVGRTRTLADDTAAPRWYESFHVYCAHLATHVAFTLKAKNPIGASLLGVGYLPVRDV  120

Query  491  LGGEEVDEWLPLLDND--RNPI-HSHSKIHVKLQFLDVVRE  604
            L G+EVD WLPL D+   R PI     K+HVKLQ+ D+ ++
Sbjct  121  LAGDEVDRWLPLCDDTDARTPIGDGGGKVHVKLQYFDISKD  161



>gb|AFW77332.1| phospholipase D family protein [Zea mays]
Length=925

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 108/163 (66%), Gaps = 11/163 (7%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA++LLHGSLHV ++E +++      +        K+VEG E  VG  K  S++YATI L
Sbjct  105  MARILLHGSLHVTIFEAEELSNSSRPSSQAPGFLRKLVEGIEDTVGVGKGTSKIYATIGL  164

Query  314  EKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             K RVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  165  GKTRVGRTRKLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  224

Query  491  LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRE  604
              G EVD WL L D      DR P+ S  K+HV+LQ+ D+ ++
Sbjct  225  FEGHEVDRWLHLCDGGGDDKDRTPLESGGKVHVRLQYFDISKD  267



>ref|XP_006656220.1| PREDICTED: phospholipase D alpha 2-like [Oryza brachyantha]
Length=820

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 103/156 (66%), Gaps = 6/156 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA LLLHG+L   + E D +      T G   +F K VEG E  +G  K A+RLYATIDL
Sbjct  1    MAHLLLHGTLEATILEADNLSDPTRATGGAPGIFRKFVEGFEDSLGLGKGATRLYATIDL  60

Query  314  EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             +ARVGRTR++D E  NPRWYE FHIYCAH A++VVFSVK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVVDGESVNPRWYEVFHIYCAHFAADVVFSVKAAQPIGATLIGRAYLPVRDL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  598
            L G+ ++  L +LD  R  I     IHV+LQF DV 
Sbjct  121  LSGQAIERRLDVLDASRKRISHGPTIHVRLQFRDVA  156



>gb|AAU44332.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAY96710.1| hypothetical protein OsI_18631 [Oryza sativa Indica Group]
 dbj|BAH00843.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62492.1| hypothetical protein OsJ_17289 [Oryza sativa Japonica Group]
Length=824

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 109/161 (68%), Gaps = 9/161 (6%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA++LLHG++HV ++E + +      +        K+VEG E  VG  K  S++YATI L
Sbjct  1    MAKILLHGTMHVTIFEAESLSNPSRPSSQAPQFLRKLVEGIEDTVGVGKGTSKVYATIGL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            +KARVGRTR L D+   PRWYESFH+YCAH+A++V F++K  NPIGA L+G  Y+P R +
Sbjct  61   DKARVGRTRTLADDTAAPRWYESFHVYCAHLATHVAFTLKAKNPIGASLLGVGYLPVRDV  120

Query  491  LGGEEVDEWLPLLDND--RNPI-HSHSKIHVKLQFLDVVRE  604
            L G+EVD WLPL D+   R PI     K+HVKLQ+ D+ ++
Sbjct  121  LAGDEVDRWLPLCDDTDARTPIGDGGGKVHVKLQYFDISKD  161



>gb|EEC80931.1| hypothetical protein OsI_23625 [Oryza sativa Indica Group]
Length=802

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 102/156 (65%), Gaps = 6/156 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA LLLHG+L   + E D +      T     +F K VEG E  +G  K A+RLYATIDL
Sbjct  1    MAHLLLHGTLEATILEADHLSNPTRATGAAPGIFRKFVEGFEDSLGLGKGATRLYATIDL  60

Query  314  EKARVGRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             +ARVGRTR++D+   NPRWYE FHIYCAH A++VVFSVK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVVDDEPVNPRWYEVFHIYCAHFAADVVFSVKAAQPIGATLIGRAYLPVREL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  598
            L GE ++  L +LD  R  I     IHV+LQF DV 
Sbjct  121  LSGEAIERRLDILDAGRRRISHGPTIHVRLQFRDVA  156



>ref|XP_008385550.1| PREDICTED: phospholipase D alpha 1-like [Malus domestica]
Length=809

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 105/150 (70%), Gaps = 5/150 (3%)
 Frame = +2

Query  158  LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRT  337
            +LLHG LH  +YEVD++   G    F K +     +VG  K  S LYATIDLE  RVGRT
Sbjct  6    VLLHGVLHATIYEVDRLMPGGCCIFFCKFLG---ELVGLGK-GSXLYATIDLENVRVGRT  61

Query  338  RLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDE  514
            RLL+   KNP+W ESFHIYCAHM SNVVFS+K D   GA++IGRAYMPA  LL G+EVD 
Sbjct  62   RLLENSTKNPQWGESFHIYCAHMTSNVVFSIKEDKAFGAKVIGRAYMPAAELLDGKEVDR  121

Query  515  WLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            WL ++ ++  P+H  SKIHVKLQF +V ++
Sbjct  122  WLKIMYDNNKPLHIRSKIHVKLQFFNVNQD  151



>ref|NP_001058017.1| Os06g0604400 [Oryza sativa Japonica Group]
 sp|P93844.2|PLDA2_ORYSJ RecName: Full=Phospholipase D alpha 2; Short=PLD alpha 2; AltName: 
Full=Choline phosphatase 2; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 2 [Oryza sativa Japonica 
Group]
 dbj|BAD35531.1| Phospholipase D alpha 2 [Oryza sativa Japonica Group]
 dbj|BAF19931.1| Os06g0604400 [Oryza sativa Japonica Group]
 gb|EEE65982.1| hypothetical protein OsJ_21907 [Oryza sativa Japonica Group]
Length=817

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 102/156 (65%), Gaps = 6/156 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA LLLHG+L   + E D +      T     +F K VEG E  +G  K A+RLYATIDL
Sbjct  1    MAHLLLHGTLEATILEADHLSNPTRATGAAPGIFRKFVEGFEDSLGLGKGATRLYATIDL  60

Query  314  EKARVGRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             +ARVGRTR++D+   NPRWYE FHIYCAH A++VVFSVK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVVDDEPVNPRWYEVFHIYCAHFAADVVFSVKAAQPIGATLIGRAYLPVREL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  598
            L GE ++  L +LD  R  I     IHV+LQF DV 
Sbjct  121  LSGEAIERRLDILDAGRRRISHGPTIHVRLQFRDVA  156



>ref|XP_006859166.1| hypothetical protein AMTR_s00070p00140920 [Amborella trichopoda]
 gb|ERN20633.1| hypothetical protein AMTR_s00070p00140920 [Amborella trichopoda]
Length=126

 Score =   151 bits (382),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = +2

Query  239  KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNV  415
            K+V+G    VGF K AS+ YA I LEKA VGRTR+L ++  NPRWYESFHIYCAHMAS +
Sbjct  2    KLVKGIGETVGFGKGASKHYARIILEKAIVGRTRVLTNQLVNPRWYESFHIYCAHMASYI  61

Query  416  VFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            +F++K D PIGA LIGRA++P + +L G+EVD W  + D DR PI   +KIHVKLQ+ D+
Sbjct  62   IFTIKDDVPIGASLIGRAHVPVKEVLNGDEVDTWAEICDEDRKPIGGGTKIHVKLQYFDI  121

Query  596  VRE  604
             ++
Sbjct  122  TKD  124



>gb|KCW70693.1| hypothetical protein EUGRSUZ_F03862 [Eucalyptus grandis]
Length=773

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 93/117 (79%), Gaps = 3/117 (3%)
 Frame = +2

Query  257  ERVVGFNKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKV  433
            E  VG  K  S+LYATIDL KARVGRTRLL+ E  NPRWYESFHIYCAHMAS+V+F++K 
Sbjct  5    EETVGLGKGVSKLYATIDLGKARVGRTRLLEKEPSNPRWYESFHIYCAHMASDVIFTIKD  64

Query  434  DNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            DNPIGA LIGRAY+P   LLGGEE+D W+ +LD +RNPI   SKIHVKL + DV ++
Sbjct  65   DNPIGATLIGRAYVPVDELLGGEELDRWVEILDKERNPI--GSKIHVKLHYFDVSKD  119



>gb|KJB68102.1| hypothetical protein B456_010G225600 [Gossypium raimondii]
Length=805

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 108/152 (71%), Gaps = 4/152 (3%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MA+  LHG+LHV +YEV+K++  G    F K++   E  +G  K + +LYATIDLEKARV
Sbjct  1    MARTSLHGNLHVTIYEVNKLEGGGF---FRKLMANVEESIGIGKGSGKLYATIDLEKARV  57

Query  329  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  508
            GRTR + E  +P W ESFHIYCAHMA++V+F+VK    IGA +IGRAY+P   +L GEEV
Sbjct  58   GRTRKV-ESDDPSWNESFHIYCAHMANDVIFTVKQAGSIGANVIGRAYLPVEDILSGEEV  116

Query  509  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            D W+ L D ++  + + +KIHVK+++ DV ++
Sbjct  117  DRWIELKDEEKQNLENEAKIHVKIRYFDVTKD  148



>ref|XP_003568837.1| PREDICTED: phospholipase D alpha 1-like [Brachypodium distachyon]
Length=822

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 105/158 (66%), Gaps = 6/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA++LLHG+LHV V+E + +      +        K+VEG E  VG  K  S  YAT+ L
Sbjct  1    MAKILLHGTLHVTVFEAEGLSNPSRPSSQAPQFLRKLVEGIEDTVGVGKGNSNFYATVSL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             + R+GRTR L DE  +PRW+ESFHIYCAH+AS+V+F++K  + IGA ++G  ++P R +
Sbjct  61   GQCRIGRTRTLSDESTSPRWFESFHIYCAHLASDVLFTIKAKSAIGASVVGTGFLPVRDI  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
              G+EV+ WLPL D+ RNP     K+HVKLQ+ D+ ++
Sbjct  121  FPGDEVERWLPLCDDARNPADGGGKVHVKLQYFDISKD  158



>ref|XP_009364028.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=807

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 106/150 (71%), Gaps = 7/150 (5%)
 Frame = +2

Query  158  LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRT  337
            +LLHG LH  +YEVD++   G    F K +  +   VG  K  SRLYATIDLE  RVGRT
Sbjct  6    VLLHGVLHATIYEVDRLMPGGCCIFFCKFLGES---VGLRK-GSRLYATIDLENVRVGRT  61

Query  338  RLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDE  514
            RLL+   KNP+W ESFHIYCAHM SNVVFS+K D   GA++IGRAYMPA  LL G+EVD 
Sbjct  62   RLLENSTKNPQWRESFHIYCAHMTSNVVFSIKEDKAFGAKVIGRAYMPAAELLNGKEVDR  121

Query  515  WLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            WL ++ ++  P+  HSKIHVKLQF +V ++
Sbjct  122  WLTIMYHNNKPL--HSKIHVKLQFFNVNQD  149



>emb|CAN76339.1| hypothetical protein VITISV_014670 [Vitis vinifera]
Length=801

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 100/153 (65%), Gaps = 19/153 (12%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            M Q L+HG+LH  +YEVD + T G  N   KI                 Y TIDLEKA V
Sbjct  1    MEQSLVHGTLHATIYEVDGLSTGGPWNFIQKI-----------------YVTIDLEKAGV  43

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRT  LD E  NPRWY+SFHIYCAH AS+VVFSVK DNPIGA +IGRA++P   LL G E
Sbjct  44   GRTSKLDNEDSNPRWYQSFHIYCAHKASHVVFSVKQDNPIGATVIGRAHLPVGELLEG-E  102

Query  506  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            VD WL L  +D  PI+  SK+HVKLQF+DV RE
Sbjct  103  VDRWLELFHHDHTPINGGSKLHVKLQFVDVTRE  135



>ref|XP_003563661.1| PREDICTED: phospholipase D alpha 2-like [Brachypodium distachyon]
Length=823

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 106/158 (67%), Gaps = 8/158 (5%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA  LLHG+LH  + E DK+      T G   +F K VEG E  +G  K ++RLYATIDL
Sbjct  1    MAHRLLHGTLHATILEADKLTDPTRATGGAPGIFRKFVEGFEETIGRGKGSTRLYATIDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             +ARVGRTR++ D+  NPRWYE FHIYCAH A++VVF+VK D PIGA L+GRAY+P R L
Sbjct  61   GRARVGRTRVIADDPVNPRWYEEFHIYCAHFAADVVFTVKADQPIGATLLGRAYLPVRDL  120

Query  491  L--GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  598
            L   G+E++  L +LD  +  +     IHV+L+F DV 
Sbjct  121  LDAAGKEIERRLDVLDPGKKKLPHGPTIHVRLRFCDVA  158



>dbj|BAA19466.1| phospholipase D [Oryza sativa Japonica Group]
Length=818

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 101/156 (65%), Gaps = 6/156 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA LLLHG+L   + E D +      T     +F K VEG E  +G  K A+RLYATIDL
Sbjct  1    MAHLLLHGTLEATILEADHLSNPTRATGAAPGIFRKFVEGFEDSLGLGKGATRLYATIDL  60

Query  314  EKARVGRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             +ARVGRTR++D+   NPRWYE FHIYCAH A++VVFSVK   PIGA LI RAY+P R L
Sbjct  61   GRARVGRTRVVDDEPVNPRWYEVFHIYCAHFAADVVFSVKAAQPIGATLIDRAYLPVREL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  598
            L GE ++  L +LD  R  I     IHV+LQF DV 
Sbjct  121  LCGEAIERRLDILDAGRRRISHGPTIHVRLQFRDVA  156



>dbj|BAJ85695.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96017.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87850.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=820

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 105/158 (66%), Gaps = 8/158 (5%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA  LLHG+LH  + E D +      T G   +F + VEG E  +G  K +++LYAT+DL
Sbjct  1    MAHRLLHGTLHATILEADNLTNPDRATGGAPQIFRRFVEGFEETIGRGKGSTQLYATVDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             KARVGRTR++  +  NPRWYE FHIYCAH A++VVF+VK   PIGA LIGRAY+P R L
Sbjct  61   GKARVGRTRVIAGDPVNPRWYEEFHIYCAHFAADVVFTVKAAQPIGATLIGRAYLPVRDL  120

Query  491  L--GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  598
            L  GG+E++  L +LD  +  IH    IHV+L+F DV 
Sbjct  121  LDAGGQEIERRLDVLDPSKKKIHHGPTIHVRLRFCDVA  158



>dbj|BAJ94103.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=820

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 105/158 (66%), Gaps = 8/158 (5%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA  LLHG+LH  + E D +      T G   +F + VEG E  +G  K +++LYAT+DL
Sbjct  1    MAHRLLHGTLHATILEADNLTNPDRATGGAPQIFRRFVEGFEETIGRGKGSTQLYATVDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             KARVGRTR++  +  NPRWYE FHIYCAH A++VVF+VK   PIGA LIGRAY+P R L
Sbjct  61   GKARVGRTRVIAGDPVNPRWYEEFHIYCAHFAADVVFTVKAAQPIGATLIGRAYLPVRDL  120

Query  491  L--GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  598
            L  GG+E++  L +LD  +  IH    IHV+L+F DV 
Sbjct  121  LDAGGQEIERRLDVLDPSKKKIHHGPTIHVRLRFCDVA  158



>gb|EMT32202.1| Phospholipase D alpha 2 [Aegilops tauschii]
Length=820

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 104/158 (66%), Gaps = 8/158 (5%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA  LLHG+LH  + E D +      T G   +F + VEG E  +G  K +++LYAT+DL
Sbjct  1    MAHRLLHGTLHATILEADNLTNPDRATGGAPQIFRRFVEGFEETIGRGKGSTQLYATVDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             KARVGRTR++  +  NPRWYE FHIYCAH A++VVF+VK   PIGA LIGRAY+P R L
Sbjct  61   GKARVGRTRVIAGDPVNPRWYEDFHIYCAHFAADVVFTVKAAQPIGATLIGRAYLPVREL  120

Query  491  L--GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  598
            L  GG E++  L +LD  +  IH    IHV+L+F DV 
Sbjct  121  LDAGGREIERRLDVLDPSKKKIHHGPTIHVRLRFCDVT  158



>gb|KJB70612.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
 gb|KJB70613.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
 gb|KJB70615.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
Length=795

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +2

Query  239  KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNV  415
            ++V   +  +G  K   ++YATIDLE+ARVGRTR ++ E  NPRW+ESFHIYCAH ASNV
Sbjct  18   QLVANVQETIGIGKGVPKIYATIDLERARVGRTRTIENETSNPRWFESFHIYCAHNASNV  77

Query  416  VFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            VF+VK DNPIGA LIGRAY+P + L  G+EVD W+ +LD D+NPI S  KIHVKLQ+  V
Sbjct  78   VFTVKDDNPIGATLIGRAYVPVKDLTEGDEVDRWVEILDEDKNPIKSGGKIHVKLQYFGV  137

Query  596  VRE  604
             ++
Sbjct  138  TKD  140



>ref|XP_004287315.1| PREDICTED: phospholipase D alpha 1-like [Fragaria vesca subsp. 
vesca]
Length=809

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 104/153 (68%), Gaps = 7/153 (5%)
 Frame = +2

Query  149  MAQ-LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MAQ +LLHG LH  ++EVD +K  G    F K+ E +   VG  K   R YATIDLE AR
Sbjct  1    MAQTVLLHGVLHATIFEVDSLKAGGCCTFFCKLFEES---VGLGK-GCRPYATIDLENAR  56

Query  326  VGRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTRLL+E   NP+W E+FHIYCAHMASNVVFS+K  NPIGA +IG AY+PA  L  GE
Sbjct  57   VGRTRLLEETTTNPQWNEAFHIYCAHMASNVVFSIKEYNPIGANVIGEAYLPAAELFNGE  116

Query  503  EVDEWLPL-LDNDRNPIHSHSKIHVKLQFLDVV  598
            EVD WL + + +   P+H  SKI VKL+F  V 
Sbjct  117  EVDRWLKITMHHHGRPLHGGSKIRVKLRFYPVT  149



>emb|CDP13512.1| unnamed protein product [Coffea canephora]
Length=825

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 100/162 (62%), Gaps = 13/162 (8%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNK------------TASR  292
            MA  LLHG+L   ++E+D+++T    N   K     +   GF                SR
Sbjct  1    MASKLLHGTLQATIFEIDRLRTGWGFNFCGKTGGPEKMARGFCARVKRAVFCRPEIVGSR  60

Query  293  LYATIDLEKARVGRTRLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  469
            LYATIDLE+ARVGRTR++++   NPRWYE F IYCAHM SNV+F+VK DN +GA LIGRA
Sbjct  61   LYATIDLERARVGRTRMIEKQLSNPRWYEGFRIYCAHMVSNVIFTVKDDNAVGATLIGRA  120

Query  470  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            Y+P   ++ G  VD WL +LD D  PI    KIHVKLQF  V
Sbjct  121  YLPVEEIINGFIVDRWLQILDEDGIPIQGGPKIHVKLQFFSV  162



>emb|CDP13510.1| unnamed protein product [Coffea canephora]
Length=825

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 102/162 (63%), Gaps = 13/162 (8%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKI---VEGAERVVGFNKTA---------SR  292
            MA  LLHG+L   ++E+D+++T    N   K     + A R     K A         SR
Sbjct  1    MASKLLHGTLQATIFEIDRLQTGWGFNFCGKTGGPAKMARRFFARLKRAVLCRPEIVGSR  60

Query  293  LYATIDLEKARVGRTRLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  469
            LYATIDLE+ARVGRTR++++   NPRWYE F IYCAHM SNV+F+VK DN +GA LIGRA
Sbjct  61   LYATIDLERARVGRTRMIEKQLSNPRWYEGFRIYCAHMVSNVIFTVKDDNAVGATLIGRA  120

Query  470  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            Y+P   ++ G  VD WL +LD D  PI    KIHVKLQF  V
Sbjct  121  YLPVEEIISGFVVDRWLQILDEDGIPIQGGPKIHVKLQFFSV  162



>ref|XP_002437251.1| hypothetical protein SORBIDRAFT_10g023630 [Sorghum bicolor]
 gb|EER88618.1| hypothetical protein SORBIDRAFT_10g023630 [Sorghum bicolor]
Length=816

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 105/158 (66%), Gaps = 6/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA LLLHG+L   + E D +      T G   +F K VEG E  +G  + ++RLYAT+DL
Sbjct  1    MAHLLLHGTLDATILEADHLTNPTRATGGAPGIFRKFVEGFEESLGLGQGSTRLYATVDL  60

Query  314  EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             +ARVGRTR++  +  NPRWYE+FHIYCAH ASNVVFSVK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVITGDPVNPRWYEAFHIYCAHFASNVVFSVKAAQPIGATLIGRAYLPVRDL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            + G+E++  L +L+  +  +    K+ V+L+F DV  +
Sbjct  121  IAGQEIERSLDILNASKKRLPHGPKLRVRLRFQDVAAD  158



>ref|XP_009368855.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=808

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 105/150 (70%), Gaps = 6/150 (4%)
 Frame = +2

Query  158  LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRT  337
            +LLHG LH  +YEVD++   G    F K +  +   VGF K  SRLYATIDLE  RVGRT
Sbjct  6    VLLHGVLHATIYEVDRLMAGGCCIFFCKFLGES---VGFGK-GSRLYATIDLENVRVGRT  61

Query  338  RLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDE  514
            RLL+   KNP W ESFHIYCAHM SNVVFS+K DN  G ++IGRA+MPA  LL  E +D 
Sbjct  62   RLLENSTKNPLWCESFHIYCAHMTSNVVFSIKEDNAFGTKVIGRAHMPAAELLNSEVIDR  121

Query  515  WLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            W+ ++ +++ P+H  SKIHVKL+F +V +E
Sbjct  122  WVRIIYHNK-PLHGRSKIHVKLRFFNVNQE  150



>ref|XP_010090252.1| Phospholipase D alpha 1 [Morus notabilis]
 gb|EXB39153.1| Phospholipase D alpha 1 [Morus notabilis]
Length=788

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 104/154 (68%), Gaps = 22/154 (14%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR-  325
            MAQ+LLHG LH                    ++E  E +VGF K  S+LYATIDLE +R 
Sbjct  1    MAQVLLHGVLH--------------------LIEKFEEIVGFRKGTSKLYATIDLENSRS  40

Query  326  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VG TR+L+ +  NPRWYESF IYCAH ASNVVF++K D PIGAE+I RAY+P   LL G+
Sbjct  41   VGSTRVLECKTWNPRWYESFDIYCAHKASNVVFTIKQDKPIGAEVIARAYLPVDELLSGK  100

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            EVD+WL L+D+   P+H  SKIHV+++F DV ++
Sbjct  101  EVDQWLHLMDHKHKPLHHGSKIHVRVRFCDVSKD  134



>ref|NP_001146242.1| uncharacterized protein LOC100279815 [Zea mays]
 gb|ACL53544.1| unknown [Zea mays]
 gb|AFW87188.1| phospholipase D family protein [Zea mays]
Length=816

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 103/155 (66%), Gaps = 6/155 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA LLLHG+L   + E D +      T G   +F K VEG E  +G  + ++RLYAT+DL
Sbjct  1    MAHLLLHGTLDATILEADHLTNPTRATGGAPGIFRKFVEGFEDSLGLGQGSTRLYATVDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             +ARVGRTR++  +  NPRWYE FHIYCAH AS+VVFSVK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVITGDPVNPRWYEVFHIYCAHFASDVVFSVKAAQPIGATLIGRAYLPVRDL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            + G+E++  L +LD  +  +    KI V+L+F DV
Sbjct  121  IAGQEIERSLDILDASKKRLPHGPKIRVRLRFQDV  155



>ref|XP_002515518.1| phopholipase d alpha, putative [Ricinus communis]
 gb|EEF46967.1| phopholipase d alpha, putative [Ricinus communis]
Length=817

 Score =   155 bits (391),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 80/161 (50%), Positives = 108/161 (67%), Gaps = 15/161 (9%)
 Frame = +2

Query  161  LLHGSLHVCVYEVDKIKTD----------GLHNLFHKIVEGAERVVGFNK--TASRLYAT  304
            LLHG+L V ++EVDK++T           G  N   + +   +RVV        + LYAT
Sbjct  4    LLHGTLSVTIFEVDKLQTGCGFNFFSRGPGQQNCGKRFLSQVKRVVLCRPEIVGTGLYAT  63

Query  305  IDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPA  481
            +DL+KARVGRTR L D+H NP+WYESFHIYCAH+ S+V+F++K D  +GA LIGRAY+P 
Sbjct  64   VDLDKARVGRTRKLEDQHYNPQWYESFHIYCAHLISHVIFTIKDDQFVGASLIGRAYIPV  123

Query  482  RRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
              ++ G  +D W+ +LD  RNPI   SKIHVKLQFL+V ++
Sbjct  124  EDVITGYIIDRWVEILDEQRNPI--GSKIHVKLQFLNVTQD  162



>dbj|BAJ93878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=783

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 92/124 (74%), Gaps = 1/124 (1%)
 Frame = +2

Query  236  HKIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASN  412
             ++VEG E  VG  K AS+LYAT+ L KAR+GRTR L DE   PRW+ESFHIYCAH+AS+
Sbjct  3    QQLVEGIEDTVGVGKGASKLYATVGLGKARIGRTRTLNDESSTPRWFESFHIYCAHLASD  62

Query  413  VVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLD  592
            V+F++K  + IGA ++G  Y+P R + GG+EV+ WLPL D+ RNP+    KIHVKLQ+ D
Sbjct  63   VLFTIKGKSTIGAVVVGTGYLPVRDIYGGDEVERWLPLCDDSRNPVEGGGKIHVKLQYFD  122

Query  593  VVRE  604
            + ++
Sbjct  123  ISKD  126



>gb|EMT24153.1| Phospholipase D alpha 1 [Aegilops tauschii]
Length=906

 Score =   155 bits (392),  Expect = 8e-40, Method: Composition-based stats.
 Identities = 67/122 (55%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = +2

Query  242  IVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVV  418
            +VEG E  VG  K AS+LYAT+ L KAR+GRTR L DE   PRW+ESFHIYCAH+A++V+
Sbjct  4    LVEGIEDTVGVGKGASKLYATVGLGKARIGRTRTLNDESSTPRWFESFHIYCAHLATDVL  63

Query  419  FSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  598
            F++K  + IGA ++G  Y+P R + GG+EV+ WLPL D+ RNP+    KIHVKLQ+ D+ 
Sbjct  64   FTIKGSSTIGASVVGTGYLPVRDIYGGDEVERWLPLCDDSRNPVEGGGKIHVKLQYFDIS  123

Query  599  RE  604
            ++
Sbjct  124  KD  125



>ref|XP_009407292.1| PREDICTED: phospholipase D alpha 1-like [Musa acuminata subsp. 
malaccensis]
Length=815

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 98/153 (64%), Gaps = 6/153 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            M+Q LLHG LH  ++E   +      T        ++VE  E+ V F K  SR YATID+
Sbjct  1    MSQFLLHGVLHATIFEATSVSDRCRITRHAPKFVRELVEAVEKTVSFGKGWSRFYATIDI  60

Query  314  EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
            E AR+GRTR++   H NPRW ESFHIYCAH A+NVVF+VK++ PIGA ++GRA +    L
Sbjct  61   EMARLGRTRVITGHHGNPRWNESFHIYCAHTAANVVFTVKLEEPIGARVVGRASLSTEEL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFL  589
            LG  EVD WL +LD DR P+     IHV L+F+
Sbjct  121  LGCAEVDRWLEILDEDRRPLRGGPAIHVSLRFV  153



>ref|XP_009787006.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Nicotiana 
sylvestris]
Length=762

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 86/105 (82%), Gaps = 1/105 (1%)
 Frame = +2

Query  293  LYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  469
            +YAT+DLEKARVGRTR+++ E  NPRW ESFHIYCAHMASNV+F+VK +N IGA LIGRA
Sbjct  1    MYATVDLEKARVGRTRVIENEPSNPRWNESFHIYCAHMASNVIFTVKDNNSIGATLIGRA  60

Query  470  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            Y+P   LL GEEVDEW+ +LD D+NPI   SKIHV LQF D+ R+
Sbjct  61   YLPVNELLEGEEVDEWIEILDEDKNPIKEGSKIHVTLQFFDISRD  105



>gb|KHN22449.1| Phospholipase D alpha 1 [Glycine soja]
Length=271

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  328
            MAQ+LLHG+L   +YEVD +K   + N+  K V   E   G  K  ++LYAT+DLEKARV
Sbjct  1    MAQILLHGTLQAKIYEVDNLKVGSVGNVLTKSVHNIEETNGIGKGITKLYATVDLEKARV  60

Query  329  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  505
            GRTR+++ EH NP+  ESFHIYCAHMASN++F+VK DNPIGA LIG AY+P   +L G+E
Sbjct  61   GRTRIIEKEHTNPKGNESFHIYCAHMASNIIFTVKDDNPIGATLIGSAYVPVEEILDGKE  120

Query  506  V  508
            +
Sbjct  121  I  121



>ref|XP_009614730.1| PREDICTED: phospholipase D alpha 1 {ECO:0000250|UniProtKB:Q41142}-like 
[Nicotiana tomentosiformis]
Length=820

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 104/164 (63%), Gaps = 12/164 (7%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK---------TDGLHNLFHKIVEGAERV--VGFNKTASRL  295
            M   LLHG+LH  +YEVDKI+         T     +  + +   +++       + ++ 
Sbjct  1    MGPRLLHGTLHATIYEVDKIRGGCGDCCGPTASPQKVSRRFLNNVKKLFFCAPEISGTKF  60

Query  296  YATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAY  472
            YATIDL+KARVGRTR+  ++  NPRWYE+F IYCAH  SN++F++K +NPI A LIGRAY
Sbjct  61   YATIDLDKARVGRTRIFGNDPSNPRWYETFRIYCAHEISNIIFTIKDENPISATLIGRAY  120

Query  473  MPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +P   +L    VD W+P+LD D  PI   SKIHV+LQF +V ++
Sbjct  121  LPVEEVLNRYVVDRWVPILDEDGYPISGRSKIHVRLQFFNVKQD  164



>ref|XP_011459180.1| PREDICTED: phospholipase D alpha 1-like [Fragaria vesca subsp. 
vesca]
Length=814

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 109/154 (71%), Gaps = 6/154 (4%)
 Frame = +2

Query  161  LLHGSLHVCVYEVDKIKTD-GLHNLF---HKIVEGAERVV--GFNKTASRLYATIDLEKA  322
            LLHG+L+  +YE+DKI +  G+  L+    K V+  +R+V  G   + S++YAT+DL+KA
Sbjct  4    LLHGTLYATIYEIDKINSGCGIGLLWTSPKKFVDQVKRLVLCGPEISGSKIYATVDLDKA  63

Query  323  RVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            RV RTR+++  +NP W E FHIY AH  S+++F+VK ++PIGA LIGRAY+P   ++ G 
Sbjct  64   RVARTRMVNNPRNPIWKEDFHIYSAHNISHIIFTVKANDPIGATLIGRAYVPVEDIIKGY  123

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
             VD W+ +LD + NPIH +S+IHVKLQF  V+ +
Sbjct  124  VVDRWVEILDEEHNPIHGNSRIHVKLQFSSVIED  157



>gb|KHN07080.1| Phospholipase D alpha 1 [Glycine soja]
Length=799

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 100/148 (68%), Gaps = 15/148 (10%)
 Frame = +2

Query  161  LLHGSLHVCVYEVDKIKT--DGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGR  334
            LLHG L V +YEVD + T  D   NL  K VE            + LYATIDL+KARVGR
Sbjct  4    LLHGRLDVIIYEVDTLPTLNDCNLNLCSKFVE------------TGLYATIDLDKARVGR  51

Query  335  TRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVD  511
            T+LL D+  NP W E+FH+YCAH+ S+V+F+VK  +PI A LIGRAY+P  +++ G  VD
Sbjct  52   TKLLNDQSSNPTWDETFHVYCAHLISHVIFTVKQKDPIDATLIGRAYVPVEQVVNGNIVD  111

Query  512  EWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            EW+ +LD D NPI S SKIHVK+QF  V
Sbjct  112  EWVQILDEDHNPIPSESKIHVKMQFSSV  139



>ref|XP_009758055.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana sylvestris]
 ref|XP_009758056.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana sylvestris]
Length=820

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 104/164 (63%), Gaps = 12/164 (7%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK---------TDGLHNLFHKIVEGAERV--VGFNKTASRL  295
            M   LLHG+LH  +YEVDKI+         T     +  + +   +++       + ++ 
Sbjct  1    MGPRLLHGTLHATIYEVDKIRGGCGDCCGPTASPQKVSRRFLNNVKKLFFCAPEISGTKF  60

Query  296  YATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAY  472
            YATIDL+KARVGRTR+ + +  NPRWYE+F IYCAH  SN++F++K +NP+ A LIGRAY
Sbjct  61   YATIDLDKARVGRTRIFENDPSNPRWYETFRIYCAHEISNIIFTIKDENPVSATLIGRAY  120

Query  473  MPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            +P   +L    VD W+P+LD D  PI   SKIHV+LQF +V ++
Sbjct  121  LPVEEVLNRYVVDRWVPILDEDGYPISGRSKIHVRLQFFNVKQD  164



>ref|XP_004251821.1| PREDICTED: phospholipase D alpha 1-like [Solanum lycopersicum]
Length=820

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 107/163 (66%), Gaps = 11/163 (7%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKT--------DGLHNLFHKIVEGAERV--VGFNKTASRLY  298
            M   LLHG+LH  +YE+DKI+T             L  +++   +++       +A++LY
Sbjct  1    MVPRLLHGTLHATIYEIDKIRTGCADCCGPTSPQKLTKRVLNNVKKLFFCAPKISATKLY  60

Query  299  ATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYM  475
            ATIDL+KARVGRTR+ + E  NP W ++F +YCAH  SN++F+VK +NP+ A LIGRAY+
Sbjct  61   ATIDLDKARVGRTRIAENEPSNPHWNDTFRLYCAHEVSNIIFTVKDENPVSATLIGRAYL  120

Query  476  PARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            P   +L    VD W+P++D +R+PI  HSKIHV+LQF  V ++
Sbjct  121  PVEEVLNRYIVDRWVPIVDEERHPISGHSKIHVRLQFYSVKQD  163



>ref|XP_006350007.1| PREDICTED: phospholipase D alpha 1-like [Solanum tuberosum]
Length=819

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 106/163 (65%), Gaps = 11/163 (7%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKT--------DGLHNLFHKIVEGAERV--VGFNKTASRLY  298
            M   LLHG+LH  +YE+DKI+T             L  +++   +++       +A++LY
Sbjct  1    MGPRLLHGTLHATIYEIDKIRTGCADCCGPTSPQKLTKRVLNNVKKLFFCAPKISATKLY  60

Query  299  ATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYM  475
            ATIDL+KARVGRTR+ + E  NP W ++F  YCAH  SN++F+VK +NP+ A LIGRAY+
Sbjct  61   ATIDLDKARVGRTRIAENEPSNPHWNDTFRFYCAHEVSNIIFTVKDENPVSATLIGRAYL  120

Query  476  PARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            P   +L    VD W+P++D +R+PI  HSKIHV+LQF  V ++
Sbjct  121  PVEEVLNRYIVDRWVPIVDEERHPISGHSKIHVRLQFYSVKQD  163



>ref|XP_007013459.1| Phospholipase D alpha 1 [Theobroma cacao]
 gb|EOY31078.1| Phospholipase D alpha 1 [Theobroma cacao]
Length=806

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = +2

Query  242  IVEGAERVVGFNKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVV  418
            +V+  E  VG  K  S+LY TIDLE+ RVGR+RLL+ E  N +W+ESFHIYCAH ASNVV
Sbjct  30   LVQNIEESVGVGKAFSKLYVTIDLEETRVGRSRLLENEGSNLQWHESFHIYCAHKASNVV  89

Query  419  FSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  598
            FS+K ++PIGA LIGRAY+P   LL GEEVD WL ++D +  P+   S+IHVKLQF D  
Sbjct  90   FSIKENDPIGASLIGRAYLPVEELLNGEEVDRWLKVVDKEYKPLCRGSRIHVKLQFFDTT  149

Query  599  R  601
            R
Sbjct  150  R  150



>ref|XP_010923204.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
Length=859

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 109/186 (59%), Gaps = 34/186 (18%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYE-----------------VDKIKTDGLHNLFH-------------  238
            MAQ LLHG+L V ++E                 + K  T     L               
Sbjct  1    MAQYLLHGTLQVTIFEATSLSNSNAISVSAPKPIQKAPTTSKRRLMRRLSWIKRVSFCRP  60

Query  239  KIVEGAERVVGFNKTASRLYATIDLEKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNV  415
            K+VE  E  VGF K +++LYATIDLE+ARVGRTR +++E  NPRWYESFHIYCAH  +N+
Sbjct  61   KLVEEIEDTVGFGKGSAKLYATIDLERARVGRTRVIMNEPNNPRWYESFHIYCAHWTANI  120

Query  416  VFSVKVDNPIGAELIGRAYMPARRLLGGEE---VDEWLPLLDNDRNPIHSHSKIHVKLQF  586
            +F++K DNP+GA LIGRAY+P + +L       VD WL +   D + +   ++IHV+L +
Sbjct  121  IFTIKADNPVGASLIGRAYLPVKDILNNNNSGAVDRWLNIYREDCSQVGGGAQIHVRLWY  180

Query  587  LDVVRE  604
            LDV ++
Sbjct  181  LDVSKD  186



>ref|XP_004984143.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Setaria italica]
Length=832

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 104/169 (62%), Gaps = 20/169 (12%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVD-KIKTDG-----------------LHNL-FHKIVEGAERVVG  271
            MAQLLLHG +   +   D  + +DG                 +  L F K  +  E  +G
Sbjct  1    MAQLLLHGLIDARIVAADLSVTSDGQLQPTKKTRMKRKVFSWISKLPFCKCQQRLENAIG  60

Query  272  FNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  451
               TA +LYAT+D++KARVGRTR+LD   +PRW E+F IYCAH ASN++F+VK DN IGA
Sbjct  61   LG-TAGKLYATVDIDKARVGRTRMLDPVHSPRWNEAFRIYCAHDASNIIFTVKADNAIGA  119

Query  452  ELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  598
             LIGRAY+P R ++ G++V+ WL + D  R P+    KIHV+LQF DV 
Sbjct  120  TLIGRAYLPTRDVVAGQKVERWLDICDEKRQPLEGGDKIHVQLQFTDVA  168



>ref|XP_008219493.1| PREDICTED: phospholipase D alpha 1-like [Prunus mume]
Length=806

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 106/157 (68%), Gaps = 17/157 (11%)
 Frame = +2

Query  161  LLHGSLHVCVYEVDKIKTD-GLHNLFHK-----------IVEGAERVVGFNKTASRLYAT  304
            LLHG+L   +YEVD++    GLH L+             ++ G +++VG     S+LYAT
Sbjct  4    LLHGTLLATIYEVDRLYNGCGLHLLWKSPKIFVAQIKKLVLCGPKQIVG-----SKLYAT  58

Query  305  IDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPAR  484
            +DL+KARVGRTR++++  NP+W E FHIYCAH  S+++F+VK ++ IGA LIGRAY+P  
Sbjct  59   VDLDKARVGRTRMVNDPNNPKWREDFHIYCAHNISSLIFTVKSNDLIGATLIGRAYIPVE  118

Query  485  RLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
             ++ G  VD WL + D D NPI+ +S+IHVKLQF  V
Sbjct  119  EIIKGYAVDRWLEIFDEDGNPIYGNSRIHVKLQFSSV  155



>ref|XP_004984141.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Setaria italica]
Length=834

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 104/171 (61%), Gaps = 22/171 (13%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVD-KIKTDG-------------------LHNL-FHKIVEGAERV  265
            MAQLLLHG +   +   D  + +DG                   +  L F K  +  E  
Sbjct  1    MAQLLLHGLIDARIVAADLSVTSDGQLQPTKKVETRMKRKVFSWISKLPFCKCQQRLENA  60

Query  266  VGFNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPI  445
            +G   TA +LYAT+D++KARVGRTR+LD   +PRW E+F IYCAH ASN++F+VK DN I
Sbjct  61   IGLG-TAGKLYATVDIDKARVGRTRMLDPVHSPRWNEAFRIYCAHDASNIIFTVKADNAI  119

Query  446  GAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  598
            GA LIGRAY+P R ++ G++V+ WL + D  R P+    KIHV+LQF DV 
Sbjct  120  GATLIGRAYLPTRDVVAGQKVERWLDICDEKRQPLEGGDKIHVQLQFTDVA  170



>gb|AAC49274.1| phospholipase D [Arabidopsis thaliana]
Length=809

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 98/151 (65%), Gaps = 3/151 (2%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIKTDG-LHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  325
            MA  LLHG+LH  +YEVD +   G +     KI+   E  +G  K  +RLYATIDL+KAR
Sbjct  1    MAHDLLHGTLHATIYEVDALHGGGVMQGFLGKILANVEETIGVGKGETRLYATIDLQKAR  60

Query  326  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  502
            VGRTR + +E KNP+WYESF +             K D PIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFQVSVVTWLLISSSLSKDDIPIGATLIGRAYIPVDQVINGE  120

Query  503  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
             VD+W+ +LDNDRNPI   SKIHVKLQ+  V
Sbjct  121  -VDQWVEILDNDRNPIQGGSKIHVKLQYFHV  150



>ref|XP_010648662.1| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
Length=825

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 104/160 (65%), Gaps = 14/160 (9%)
 Frame = +2

Query  152  AQLLLHGSLHVCVYEVDK----------IKTDGLHNLFHKIVEGAERVVGFNK--TASRL  295
            A  +LHG+L+  ++++D+          IKT    NL  +++   +R+V        S+L
Sbjct  3    APFVLHGTLYATIFDIDRLYGGCECGHIIKTSRTQNLPKRLLGEVKRMVLCRPEVIGSKL  62

Query  296  YATIDLEKARVGRTRLLDE--HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  469
            YAT+DLEKARV RTRL++   +  PRW+ESF IYCAH  SN++F++K DNP+GA LIGRA
Sbjct  63   YATVDLEKARVARTRLIENRAYSKPRWFESFRIYCAHRISNIIFTIKEDNPVGARLIGRA  122

Query  470  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFL  589
            Y+P   +  G EVD  + +LD DRNP+  HS+IHVKL F 
Sbjct  123  YVPVEAIKSGHEVDLQVEILDEDRNPLPGHSRIHVKLHFF  162



>dbj|BAK02630.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=828

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 104/172 (60%), Gaps = 20/172 (12%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVD-KIKTDGLHNLFHKIV------------------EGAERVVG  271
            MAQ+LLHG +   + E D  + +DG      K V                  +  E  +G
Sbjct  1    MAQMLLHGVVDAMILEADLSVGSDGQLRPTRKTVMKKRVFSWIKKLSFCNNCQQLENAIG  60

Query  272  FNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  451
               TA +LYAT+D++KARVGRTR+++    P W ESFHIYCAH AS+++F+VK DN +GA
Sbjct  61   LGGTAGKLYATVDIDKARVGRTRMVNPSNAPSWNESFHIYCAHDASHIIFTVKADNTVGA  120

Query  452  ELIGRAYMPAR-RLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
             LIGRAY+P    +L G+ VD+WLP+ D+ R P+    ++HV+L+F DV  +
Sbjct  121  TLIGRAYLPTDGAVLAGQWVDQWLPICDDKRRPLDGGDRVHVQLRFTDVAAD  172



>ref|XP_004984142.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Setaria italica]
Length=833

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 102/170 (60%), Gaps = 21/170 (12%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVD-KIKTDGLHNLFHKI-------------------VEGAERVV  268
            MAQLLLHG +   +   D  + +DG      K+                    +  E  +
Sbjct  1    MAQLLLHGLIDARIVAADLSVTSDGQLQPTKKVETRMKRKVFSWISKLPFCKCQRLENAI  60

Query  269  GFNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIG  448
            G   TA +LYAT+D++KARVGRTR+LD   +PRW E+F IYCAH ASN++F+VK DN IG
Sbjct  61   GLG-TAGKLYATVDIDKARVGRTRMLDPVHSPRWNEAFRIYCAHDASNIIFTVKADNAIG  119

Query  449  AELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  598
            A LIGRAY+P R ++ G++V+ WL + D  R P+    KIHV+LQF DV 
Sbjct  120  ATLIGRAYLPTRDVVAGQKVERWLDICDEKRQPLEGGDKIHVQLQFTDVA  169



>ref|XP_004984144.1| PREDICTED: phospholipase D alpha 1-like isoform X4 [Setaria italica]
Length=831

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 102/168 (61%), Gaps = 19/168 (11%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVD-KIKTDG-----------------LHNLFHKIVEGAERVVGF  274
            MAQLLLHG +   +   D  + +DG                 +  L     +  E  +G 
Sbjct  1    MAQLLLHGLIDARIVAADLSVTSDGQLQPTKKTRMKRKVFSWISKLPFCKCQRLENAIGL  60

Query  275  NKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAE  454
              TA +LYAT+D++KARVGRTR+LD   +PRW E+F IYCAH ASN++F+VK DN IGA 
Sbjct  61   G-TAGKLYATVDIDKARVGRTRMLDPVHSPRWNEAFRIYCAHDASNIIFTVKADNAIGAT  119

Query  455  LIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  598
            LIGRAY+P R ++ G++V+ WL + D  R P+    KIHV+LQF DV 
Sbjct  120  LIGRAYLPTRDVVAGQKVERWLDICDEKRQPLEGGDKIHVQLQFTDVA  167



>ref|XP_006656219.1| PREDICTED: phospholipase D alpha 2-like [Oryza brachyantha]
Length=828

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 98/158 (62%), Gaps = 6/158 (4%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA LL+HG+L   ++E   +      T      F K  EG E+  G     +RLYATIDL
Sbjct  1    MAHLLMHGTLDATIFEAANLTNPTRLTGDAPEGFRKWWEGLEKTTGLGPGGTRLYATIDL  60

Query  314  EKARVGRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             KAR+GRTR++D+   NPRW E FH+YCAH A NVVFSVKV  P+GA LIGRAY+P R L
Sbjct  61   GKARLGRTRIVDDEPVNPRWDERFHLYCAHFAENVVFSVKVSLPVGAALIGRAYLPVREL  120

Query  491  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            L GE V+  L +L  D+  +     IHV+LQF +V  +
Sbjct  121  LSGEVVERKLDILGEDKKKLPHGPTIHVRLQFKNVAAD  158



>ref|XP_008394091.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Malus domestica]
Length=672

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 104/160 (65%), Gaps = 17/160 (11%)
 Frame = +2

Query  161  LLHGSLHVCVYEVDKIKTDGLHNLFHK------------IVEGAERVVGFNKTASRLYAT  304
            LLHG L+  +YEVD++ T    NL  K            ++   +++VG     S+LYAT
Sbjct  4    LLHGMLYATIYEVDRLDTGCGFNLLCKSPKRFATQIKKLVLCRPQQIVG-----SKLYAT  58

Query  305  IDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPAR  484
            IDL+KARVGRTR++++  NP+W E F+IYCAH  S ++F+VK D+ IGA LIGRAY+P  
Sbjct  59   IDLDKARVGRTRMVNDPNNPKWREEFYIYCAHNISQIIFTVKDDDLIGATLIGRAYIPVG  118

Query  485  RLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
             ++ G   + W+ +LD D NPIH +S+IHVKLQF  V  +
Sbjct  119  DIIKGYVEERWVEILDEDHNPIHGNSRIHVKLQFSSVAED  158



>ref|XP_011039694.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
 ref|XP_011039695.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
Length=820

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 103/162 (64%), Gaps = 13/162 (8%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKI---------KTDGLHNLFHKIVEGAERVVGF---NKTASR  292
            MA  LLHG+L V VY VD +         KT+G      + +   +R +     N   SR
Sbjct  1    MAPRLLHGTLDVTVYGVDNLQYGCGFSLLKTEGFLKFGKRCLVNVKRSMSCLPENVAGSR  60

Query  293  LYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  469
            LYAT+DL+KARV RTR++  E  NPRW ESFHIYCAH  S+VVF++K D+ IGA LIGRA
Sbjct  61   LYATVDLDKARVARTRMVGKEPYNPRWNESFHIYCAHSISHVVFTIKDDDAIGATLIGRA  120

Query  470  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            Y+P   +  G+ ++ W+ ++D DR P+   S++H+KLQF DV
Sbjct  121  YLPVEDIPNGKILERWVEIVDEDRKPVPGGSRVHIKLQFFDV  162



>ref|XP_006581357.1| PREDICTED: phospholipase D alpha 1-like [Glycine max]
Length=826

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 104/166 (63%), Gaps = 24/166 (14%)
 Frame = +2

Query  161  LLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVG--------------------FNK  280
            LLHG L V +YEVD + T    NL +   +G  R VG                    F +
Sbjct  4    LLHGRLDVIIYEVDTLPTLNDCNL-NLCSKGTSRSVGKRFLSQLKSCFLCQCQCQPEFVE  62

Query  281  TASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAEL  457
            T   LYATIDL+KARVGRT+LL D+  NP W E+FH+YCAH+ S+V+F+VK  +PI A L
Sbjct  63   TG--LYATIDLDKARVGRTKLLNDQSSNPTWDETFHVYCAHLISHVIFTVKQKDPIDATL  120

Query  458  IGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            IGRAY+P  +++ G  VDEW+ +LD D NPI S SKIHVK+QF  V
Sbjct  121  IGRAYVPVEQVVNGNIVDEWVQILDEDHNPIPSESKIHVKMQFSSV  166



>ref|XP_010228542.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Brachypodium 
distachyon]
Length=824

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 104/172 (60%), Gaps = 20/172 (12%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVD--KIKTDGL-----HNLFHKIV------------EGAERVVG  271
            MA +LLHG +   + + D   + +DG        L  K V            +  E  +G
Sbjct  1    MALMLLHGVIDAQILDADLSSVSSDGQIRPNRKTLMKKKVFSWIKKLPFCNCQQVENAIG  60

Query  272  FNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  451
               TA +LYAT+D++KARVGRTR+L+    P+W + FHIYCAH A++V+F+VK DNP+GA
Sbjct  61   LGSTAGKLYATVDIDKARVGRTRMLEPTNTPKWGQEFHIYCAHDAAHVIFTVKADNPVGA  120

Query  452  ELIGRAYMP-ARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
             LIGRAY+P    +  G+ VD+WLP+ D+ R P+    +IHV+L+F DV  +
Sbjct  121  TLIGRAYLPTGGAVAAGQRVDQWLPICDDKRRPLEGGDRIHVQLRFTDVAAD  172



>ref|XP_008394090.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Malus domestica]
Length=810

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 104/160 (65%), Gaps = 17/160 (11%)
 Frame = +2

Query  161  LLHGSLHVCVYEVDKIKTDGLHNLFHK------------IVEGAERVVGFNKTASRLYAT  304
            LLHG L+  +YEVD++ T    NL  K            ++   +++VG     S+LYAT
Sbjct  4    LLHGMLYATIYEVDRLDTGCGFNLLCKSPKRFATQIKKLVLCRPQQIVG-----SKLYAT  58

Query  305  IDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPAR  484
            IDL+KARVGRTR++++  NP+W E F+IYCAH  S ++F+VK D+ IGA LIGRAY+P  
Sbjct  59   IDLDKARVGRTRMVNDPNNPKWREEFYIYCAHNISQIIFTVKDDDLIGATLIGRAYIPVG  118

Query  485  RLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
             ++ G   + W+ +LD D NPIH +S+IHVKLQF  V  +
Sbjct  119  DIIKGYVEERWVEILDEDHNPIHGNSRIHVKLQFSSVAED  158



>gb|EPS71739.1| hypothetical protein M569_03019, partial [Genlisea aurea]
Length=782

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +2

Query  287  SRLYATIDLEKARVGRTRLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIG  463
            SR+YAT+DLE AR+GRTR++ +   NPRWYE+F IYCAH  SNVVF+VK DNPIGA LIG
Sbjct  21   SRIYATVDLEGARMGRTRMISKKASNPRWYENFRIYCAHTLSNVVFTVKDDNPIGATLIG  80

Query  464  RAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            RAY+P   +L G+ +D W+ +LD D+NPI+  SKIHVKLQ+  V +E
Sbjct  81   RAYLPVEDILDGQIIDRWIQILDEDKNPINGGSKIHVKLQYFHVSQE  127



>gb|EMS46811.1| Phospholipase D alpha 2 [Triticum urartu]
Length=684

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 105/189 (56%), Gaps = 39/189 (21%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKI-----------------------  244
            MA  LLHG+LH  + E D +      T G   +F ++                       
Sbjct  1    MAHRLLHGTLHATILEADDLTNPDRATGGAPQIFRRVSHSPSFPASTCCNHGRVKLVGLV  60

Query  245  --------VEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCA  397
                    VEG E  +G  K +++LYAT+DL KARVGRTR++  +  NPRWYE FHIYCA
Sbjct  61   RNLVWLQFVEGFEETIGRGKGSTQLYATVDLGKARVGRTRVIAGDPVNPRWYEDFHIYCA  120

Query  398  HMASNVVFSVKVDNPIGAELIGRAYMPARRLL--GGEEVDEWLPLLDNDRNPIHSHSKIH  571
            H A++VVF+VK   PIGA LIGRAY+P R LL  GG E++  L +LD  +  IH    IH
Sbjct  121  HFAADVVFTVKAAQPIGATLIGRAYLPVRELLDAGGREIERRLDVLDPSKKKIHHGPTIH  180

Query  572  VKLQFLDVV  598
            V+L+F DV 
Sbjct  181  VRLRFCDVA  189



>tpg|DAA45660.1| TPA: phospholipase D family protein [Zea mays]
Length=715

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 100/169 (59%), Gaps = 18/169 (11%)
 Frame = +2

Query  146  EMAQLLLHGSLHVCVYEVD-KIKTDGL-----HNLFHKIVEGAERVVGFNK---------  280
            +  QLLLHG +   + E D  + TDG        L  K V    R + F +         
Sbjct  21   QTTQLLLHGVIEATILEADLSVTTDGKLQPTKKTLMKKKVFSWIRKLTFCRNQQQLENAI  80

Query  281  ---TASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  451
               T  +LYAT+D++KARVGRTR++    +P W ESFH+YCAH ASN++F+VK DN IGA
Sbjct  81   GLGTDGKLYATVDIDKARVGRTRMVPPVHSPMWDESFHLYCAHDASNIIFTVKADNAIGA  140

Query  452  ELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  598
             LIGRAY+P   ++ G +VD WLP+ D  R P+    +IHV++QF DV 
Sbjct  141  TLIGRAYLPTEGVVAGRKVDLWLPIRDEKRQPLEGGDQIHVQVQFTDVA  189



>ref|XP_010228543.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Brachypodium 
distachyon]
Length=795

 Score =   142 bits (358),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 60/114 (53%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +2

Query  257  ERVVGFNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVD  436
            E  +G   TA +LYAT+D++KARVGRTR+L+    P+W + FHIYCAH A++V+F+VK D
Sbjct  27   ENAIGLGSTAGKLYATVDIDKARVGRTRMLEPTNTPKWGQEFHIYCAHDAAHVIFTVKAD  86

Query  437  NPIGAELIGRAYMP-ARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            NP+GA LIGRAY+P    +  G+ VD+WLP+ D+ R P+    +IHV+L+F DV
Sbjct  87   NPVGATLIGRAYLPTGGAVAAGQRVDQWLPICDDKRRPLEGGDRIHVQLRFTDV  140



>ref|XP_008673230.1| PREDICTED: phospholipase D family protein isoform X2 [Zea mays]
 ref|XP_008673233.1| PREDICTED: phospholipase D family protein isoform X2 [Zea mays]
 ref|XP_008673237.1| PREDICTED: phospholipase D family protein isoform X2 [Zea mays]
 ref|XP_008673242.1| PREDICTED: phospholipase D family protein isoform X2 [Zea mays]
 tpg|DAA45661.1| TPA: phospholipase D family protein isoform 1 [Zea mays]
 tpg|DAA45662.1| TPA: phospholipase D family protein isoform 2 [Zea mays]
 tpg|DAA45663.1| TPA: phospholipase D family protein isoform 3 [Zea mays]
 tpg|DAA45664.1| TPA: phospholipase D family protein isoform 4 [Zea mays]
Length=855

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 101/169 (60%), Gaps = 16/169 (9%)
 Frame = +2

Query  146  EMAQLLLHGSLHVCVYEVD-KIKTDGL-----HNLFHKIVEGAERVVGFNK---------  280
            +  QLLLHG +   + E D  + TDG        L  K V    R + F +         
Sbjct  21   QTTQLLLHGVIEATILEADLSVTTDGKLQPTKKTLMKKKVFSWIRKLTFCRNQLENAIGL  80

Query  281  -TASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAEL  457
             T  +LYAT+D++KARVGRTR++    +P W ESFH+YCAH ASN++F+VK DN IGA L
Sbjct  81   GTDGKLYATVDIDKARVGRTRMVPPVHSPMWDESFHLYCAHDASNIIFTVKADNAIGATL  140

Query  458  IGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
            IGRAY+P   ++ G +VD WLP+ D  R P+    +IHV++QF DV  +
Sbjct  141  IGRAYLPTEGVVAGRKVDLWLPIRDEKRQPLEGGDQIHVQVQFTDVAAD  189



>gb|KDO48581.1| hypothetical protein CISIN_1g004579mg [Citrus sinensis]
Length=610

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +2

Query  341  LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWL  520
            L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEEVD+W+
Sbjct  2    LKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEEVDKWV  61

Query  521  PLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
             +LD DRNPI S SKIHVKLQ+ DV ++
Sbjct  62   EILDEDRNPISSGSKIHVKLQYFDVTKD  89



>ref|XP_008673211.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 ref|XP_008673215.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 ref|XP_008673217.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 ref|XP_008673221.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 ref|XP_008673223.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 ref|XP_008673226.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 tpg|DAA45658.1| TPA: phospholipase D family protein isoform 1 [Zea mays]
 tpg|DAA45659.1| TPA: phospholipase D family protein isoform 2 [Zea mays]
Length=857

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 101/171 (59%), Gaps = 18/171 (11%)
 Frame = +2

Query  146  EMAQLLLHGSLHVCVYEVD-KIKTDGL-----HNLFHKIVEGAERVVGFNK---------  280
            +  QLLLHG +   + E D  + TDG        L  K V    R + F +         
Sbjct  21   QTTQLLLHGVIEATILEADLSVTTDGKLQPTKKTLMKKKVFSWIRKLTFCRNQQQLENAI  80

Query  281  ---TASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  451
               T  +LYAT+D++KARVGRTR++    +P W ESFH+YCAH ASN++F+VK DN IGA
Sbjct  81   GLGTDGKLYATVDIDKARVGRTRMVPPVHSPMWDESFHLYCAHDASNIIFTVKADNAIGA  140

Query  452  ELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
             LIGRAY+P   ++ G +VD WLP+ D  R P+    +IHV++QF DV  +
Sbjct  141  TLIGRAYLPTEGVVAGRKVDLWLPIRDEKRQPLEGGDQIHVQVQFTDVAAD  191



>gb|EMT15739.1| Phospholipase D alpha 2 [Aegilops tauschii]
Length=755

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 93/140 (66%), Gaps = 8/140 (6%)
 Frame = +2

Query  149  MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  313
            MA  LLHG+LH  + E DK+      T G   +  K+VEG E  +G  K ++RLYATIDL
Sbjct  1    MAHRLLHGTLHATILEADKLTHPDRATGGAPEILRKLVEGFEETIGRGKGSTRLYATIDL  60

Query  314  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  490
             +ARVGRTR+L  +  NPRWYE FHIYCAH A++VVF+VK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVLAGDPVNPRWYEDFHIYCAHFAAHVVFTVKAAQPIGATLIGRAYLPVREL  120

Query  491  L--GGEEVDEWLPLLDNDRN  544
            L   G E++  L +LD  + 
Sbjct  121  LDADGNEIERRLDILDATKQ  140



>ref|XP_007137028.1| hypothetical protein PHAVU_009G093500g [Phaseolus vulgaris]
 gb|ESW09022.1| hypothetical protein PHAVU_009G093500g [Phaseolus vulgaris]
Length=827

 Score =   142 bits (357),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 78/165 (47%), Positives = 103/165 (62%), Gaps = 22/165 (13%)
 Frame = +2

Query  161  LLHGSLHVCVYEVDKIKTDGLHNL-FHKIVEGAERVVGFN------------------KT  283
            LLHGSL V +YEVD + T  L++  F+   +G  R V                      T
Sbjct  4    LLHGSLDVTIYEVDTLPT--LNDCDFNLCCKGTSRSVRKRVLSQLKSCLFCQCQCQPGST  61

Query  284  ASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELI  460
             + LYAT+DL+KARVGRT++L DE  N  W ++F IYCAH+ S+V+F+VK  +PI A LI
Sbjct  62   QTGLYATVDLDKARVGRTKVLNDERSNTMWNDTFRIYCAHLISHVIFTVKQKDPINATLI  121

Query  461  GRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  595
            GRAY+P  +++ G  VD W+ +LD D NPI S SKIHVK+QF DV
Sbjct  122  GRAYVPVEQVMTGNIVDTWVQILDEDLNPIPSDSKIHVKMQFSDV  166



>gb|KDO48580.1| hypothetical protein CISIN_1g004579mg [Citrus sinensis]
Length=744

 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +2

Query  341  LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWL  520
            L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEEVD+W+
Sbjct  2    LKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEEVDKWV  61

Query  521  PLLDNDRNPIHSHSKIHVKLQFLDVVRE  604
             +LD DRNPI S SKIHVKLQ+ DV ++
Sbjct  62   EILDEDRNPISSGSKIHVKLQYFDVTKD  89



>gb|EEE65981.1| hypothetical protein OsJ_21905 [Oryza sativa Japonica Group]
Length=698

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 94/154 (61%), Gaps = 6/154 (4%)
 Frame = +2

Query  155  QLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  319
            Q L+HG+L   ++E   +      T        K  EG E+  G  +  +RLYAT+DL K
Sbjct  4    QQLMHGTLDATIFEATNLTNPTRLTGSAPEGIRKWWEGVEKTTGVGQGGTRLYATVDLGK  63

Query  320  ARVGRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  496
            AR+GRTR++D+   NPRW E FH+YCAH A NVVFSVKV  PI A LIGRAY+P   LL 
Sbjct  64   ARLGRTRVIDDEPVNPRWDERFHLYCAHFADNVVFSVKVSLPIDAALIGRAYLPVGDLLS  123

Query  497  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  598
            GE V+  L +LD  +N +     IHV+LQF DV 
Sbjct  124  GEVVERKLDILDEHKNKLPHGPTIHVRLQFKDVA  157



>emb|CAN81667.1| hypothetical protein VITISV_017804 [Vitis vinifera]
Length=642

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 89/133 (67%), Gaps = 10/133 (8%)
 Frame = +2

Query  209  KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFH  385
            K +G  + F +++   + +         +Y TIDL+KARVGRTR L+ E  NP W E FH
Sbjct  20   KVEGCGSYFSRLIIQCDSL--------EVYVTIDLDKARVGRTRKLENEETNPHWSECFH  71

Query  386  IYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSK  565
            IYCAH AS+VVFSVK +NPIGA +IGRA +P   LL G EVD WL L  +DR PIH  SK
Sbjct  72   IYCAHKASHVVFSVKQENPIGATVIGRAQLPVEELLEG-EVDRWLELFHHDRTPIHGGSK  130

Query  566  IHVKLQFLDVVRE  604
            +HVKLQF DV RE
Sbjct  131  LHVKLQFFDVTRE  143



>ref|NP_001058015.1| Os06g0604200 [Oryza sativa Japonica Group]
 dbj|BAD35529.1| phospholipase D [Oryza sativa Japonica Group]
 dbj|BAF19929.1| Os06g0604200 [Oryza sativa Japonica Group]
 dbj|BAH00401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=832

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 94/154 (61%), Gaps = 6/154 (4%)
 Frame = +2

Query  155  QLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  319
            Q L+HG+L   ++E   +      T        K  EG E+  G  +  +RLYAT+DL K
Sbjct  4    QQLMHGTLDATIFEATNLTNPTRLTGSAPEGIRKWWEGVEKTTGVGQGGTRLYATVDLGK  63

Query  320  ARVGRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  496
            AR+GRTR++D+   NPRW E FH+YCAH A NVVFSVKV  PI A LIGRAY+P   LL 
Sbjct  64   ARLGRTRVIDDEPVNPRWDERFHLYCAHFADNVVFSVKVSLPIDAALIGRAYLPVGDLLS  123

Query  497  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  598
            GE V+  L +LD  +N +     IHV+LQF DV 
Sbjct  124  GEVVERKLDILDEHKNKLPHGPTIHVRLQFKDVA  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370