BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS038F11

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009784886.1|  PREDICTED: probable leucine-rich repeat rece...    234   3e-69   Nicotiana sylvestris
ref|XP_009605195.1|  PREDICTED: probable leucine-rich repeat rece...    236   2e-68   Nicotiana tomentosiformis
gb|EYU33236.1|  hypothetical protein MIMGU_mgv1a021943mg                233   2e-67   Erythranthe guttata [common monkey flower]
ref|XP_009605193.1|  PREDICTED: probable leucine-rich repeat rece...    229   3e-66   Nicotiana tomentosiformis
gb|EYU33238.1|  hypothetical protein MIMGU_mgv1a025286mg                229   7e-66   Erythranthe guttata [common monkey flower]
ref|XP_002303227.1|  hypothetical protein POPTR_0003s03700g             218   1e-65   
ref|XP_004230391.1|  PREDICTED: probable leucine-rich repeat rece...    226   4e-65   Solanum lycopersicum
gb|EYU33237.1|  hypothetical protein MIMGU_mgv1a000884mg                223   5e-64   Erythranthe guttata [common monkey flower]
ref|XP_009803111.1|  PREDICTED: probable leucine-rich repeat rece...    223   5e-64   Nicotiana sylvestris
ref|XP_006358482.1|  PREDICTED: probable leucine-rich repeat rece...    223   7e-64   Solanum tuberosum [potatoes]
emb|CDO97682.1|  unnamed protein product                                222   1e-63   Coffea canephora [robusta coffee]
ref|XP_004230392.1|  PREDICTED: probable leucine-rich repeat rece...    218   3e-62   Solanum lycopersicum
ref|XP_009784887.1|  PREDICTED: probable leucine-rich repeat rece...    215   3e-62   Nicotiana sylvestris
ref|XP_007023744.1|  Leucine-rich repeat protein kinase family pr...    217   7e-62   
gb|EPS63997.1|  hypothetical protein M569_10784                         209   7e-62   Genlisea aurea
ref|XP_007023745.1|  Leucine-rich repeat protein kinase family pr...    216   8e-62   
ref|XP_007023743.1|  Leucine-rich repeat protein kinase family pr...    217   9e-62   
ref|XP_011092239.1|  PREDICTED: probable leucine-rich repeat rece...    217   1e-61   Sesamum indicum [beniseed]
ref|XP_003594434.1|  Somatic embryogenesis receptor-like kinase         217   1e-61   
gb|AES64685.2|  LRR receptor-like kinase                                217   1e-61   Medicago truncatula
gb|KHG19770.1|  hypothetical protein F383_03980                         216   1e-61   Gossypium arboreum [tree cotton]
gb|KDO40686.1|  hypothetical protein CISIN_1g002189mg                   216   2e-61   Citrus sinensis [apfelsine]
ref|XP_006431373.1|  hypothetical protein CICLE_v10000176mg             216   3e-61   Citrus clementina [clementine]
ref|XP_006470792.1|  PREDICTED: probable leucine-rich repeat rece...    215   5e-61   Citrus sinensis [apfelsine]
gb|KJB68018.1|  hypothetical protein B456_010G221900                    213   8e-61   Gossypium raimondii
gb|KJB68015.1|  hypothetical protein B456_010G221900                    213   9e-61   Gossypium raimondii
ref|XP_002519381.1|  Serine/threonine-protein kinase PBS1, putative     214   9e-61   Ricinus communis
gb|KJB68014.1|  hypothetical protein B456_010G221900                    213   2e-60   Gossypium raimondii
ref|XP_011028448.1|  PREDICTED: probable leucine-rich repeat rece...    213   2e-60   Populus euphratica
ref|XP_011028446.1|  PREDICTED: probable leucine-rich repeat rece...    213   2e-60   Populus euphratica
ref|XP_010657900.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    213   3e-60   
ref|XP_010682082.1|  PREDICTED: probable leucine-rich repeat rece...    213   3e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010252241.1|  PREDICTED: probable leucine-rich repeat rece...    212   5e-60   Nelumbo nucifera [Indian lotus]
gb|KCW62551.1|  hypothetical protein EUGRSUZ_G00043                     211   9e-60   Eucalyptus grandis [rose gum]
ref|XP_006385116.1|  leucine-rich repeat family protein                 211   1e-59   Populus trichocarpa [western balsam poplar]
ref|XP_010065204.1|  PREDICTED: probable leucine-rich repeat rece...    211   1e-59   Eucalyptus grandis [rose gum]
ref|XP_004486417.1|  PREDICTED: probable leucine-rich repeat rece...    211   2e-59   Cicer arietinum [garbanzo]
ref|XP_006385112.1|  hypothetical protein POPTR_0004s24030g             210   3e-59   Populus trichocarpa [western balsam poplar]
emb|CBI29612.3|  unnamed protein product                                212   5e-59   Vitis vinifera
gb|KJB68016.1|  hypothetical protein B456_010G221900                    209   5e-59   Gossypium raimondii
ref|XP_006358481.1|  PREDICTED: probable leucine-rich repeat rece...    209   6e-59   Solanum tuberosum [potatoes]
gb|KEH37006.1|  LRR receptor-like kinase                                208   1e-58   Medicago truncatula
ref|XP_011092237.1|  PREDICTED: probable leucine-rich repeat rece...    208   1e-58   Sesamum indicum [beniseed]
ref|XP_006358480.1|  PREDICTED: probable leucine-rich repeat rece...    208   2e-58   
ref|XP_010065205.1|  PREDICTED: probable leucine-rich repeat rece...    207   2e-58   
ref|XP_010682075.1|  PREDICTED: probable leucine-rich repeat rece...    207   3e-58   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW62550.1|  hypothetical protein EUGRSUZ_G00041                     207   4e-58   Eucalyptus grandis [rose gum]
ref|XP_010521415.1|  PREDICTED: probable leucine-rich repeat rece...    207   4e-58   Tarenaya hassleriana [spider flower]
ref|XP_010067941.1|  PREDICTED: probable leucine-rich repeat rece...    206   5e-58   
gb|KCW62549.1|  hypothetical protein EUGRSUZ_G00041                     206   5e-58   Eucalyptus grandis [rose gum]
ref|XP_010088710.1|  putative leucine-rich repeat receptor-like p...    207   5e-58   
ref|XP_011088111.1|  PREDICTED: probable leucine-rich repeat rece...    204   3e-57   
gb|KCW62545.1|  hypothetical protein EUGRSUZ_G00037                     204   3e-57   Eucalyptus grandis [rose gum]
ref|XP_010682077.1|  PREDICTED: probable leucine-rich repeat rece...    204   5e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010533231.1|  PREDICTED: probable leucine-rich repeat rece...    204   5e-57   Tarenaya hassleriana [spider flower]
ref|XP_010065206.1|  PREDICTED: probable leucine-rich repeat rece...    203   7e-57   
gb|KCW62548.1|  hypothetical protein EUGRSUZ_G00040                     203   7e-57   Eucalyptus grandis [rose gum]
ref|XP_007156284.1|  hypothetical protein PHAVU_003G273700g             203   1e-56   Phaseolus vulgaris [French bean]
ref|XP_010065203.1|  PREDICTED: probable leucine-rich repeat rece...    200   9e-56   
ref|XP_011464972.1|  PREDICTED: probable leucine-rich repeat rece...    200   1e-55   Fragaria vesca subsp. vesca
emb|CDX83185.1|  BnaA03g23210D                                          188   2e-55   
ref|XP_007019716.1|  Leucine-rich repeat protein kinase family pr...    199   3e-55   
ref|XP_010252252.1|  PREDICTED: probable leucine-rich repeat rece...    199   3e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010252232.1|  PREDICTED: probable leucine-rich repeat rece...    199   4e-55   Nelumbo nucifera [Indian lotus]
ref|XP_006836951.1|  hypothetical protein AMTR_s00099p00159710          199   4e-55   
ref|XP_007023753.1|  Leucine-rich repeat protein kinase family pr...    198   5e-55   
ref|XP_010682076.1|  PREDICTED: probable leucine-rich repeat rece...    198   6e-55   
ref|XP_003530535.1|  PREDICTED: probable leucine-rich repeat rece...    197   1e-54   Glycine max [soybeans]
ref|XP_011092240.1|  PREDICTED: probable leucine-rich repeat rece...    197   2e-54   
ref|XP_011092238.1|  PREDICTED: probable leucine-rich repeat rece...    196   2e-54   Sesamum indicum [beniseed]
ref|XP_009593371.1|  PREDICTED: probable leucine-rich repeat rece...    195   6e-54   Nicotiana tomentosiformis
gb|KHN40734.1|  Putative leucine-rich repeat receptor-like protei...    196   6e-54   Glycine soja [wild soybean]
gb|KJB29748.1|  hypothetical protein B456_005G116800                    193   8e-54   Gossypium raimondii
ref|XP_011464973.1|  PREDICTED: probable leucine-rich repeat rece...    195   9e-54   Fragaria vesca subsp. vesca
ref|XP_006481666.1|  PREDICTED: probable leucine-rich repeat rece...    194   2e-53   Citrus sinensis [apfelsine]
gb|KDO70764.1|  hypothetical protein CISIN_1g002121mg                   194   2e-53   Citrus sinensis [apfelsine]
gb|KJB29747.1|  hypothetical protein B456_005G116800                    194   2e-53   Gossypium raimondii
emb|CDY68959.1|  BnaCnng61190D                                          186   2e-53   Brassica napus [oilseed rape]
gb|KEH20269.1|  LRR receptor-like kinase                                194   3e-53   Medicago truncatula
ref|XP_003547844.1|  PREDICTED: probable leucine-rich repeat rece...    194   3e-53   Glycine max [soybeans]
gb|KHN40742.1|  Putative leucine-rich repeat receptor-like protei...    193   3e-53   Glycine soja [wild soybean]
gb|EPS73565.1|  hypothetical protein M569_01189                         192   1e-52   Genlisea aurea
ref|XP_008366930.1|  PREDICTED: probable leucine-rich repeat rece...    180   1e-52   
ref|XP_004137665.1|  PREDICTED: probable leucine-rich repeat rece...    192   1e-52   Cucumis sativus [cucumbers]
ref|XP_009377697.1|  PREDICTED: probable leucine-rich repeat rece...    184   3e-52   Pyrus x bretschneideri [bai li]
ref|XP_007147540.1|  hypothetical protein PHAVU_006G133200g             191   3e-52   Phaseolus vulgaris [French bean]
gb|AAF68126.1|AC010793_21  F20B17.5                                     191   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010930348.1|  PREDICTED: probable leucine-rich repeat rece...    190   4e-52   
ref|NP_178080.2|  putative serine/threonine kinase                      190   5e-52   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27543.1|  hypothetical protein AALP_AA8G397000                    184   5e-52   Arabis alpina [alpine rockcress]
ref|XP_011028445.1|  PREDICTED: probable leucine-rich repeat rece...    190   5e-52   Populus euphratica
ref|XP_002889259.1|  hypothetical protein ARALYDRAFT_477135             190   5e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_006852584.1|  hypothetical protein AMTR_s00021p00213800          190   6e-52   Amborella trichopoda
emb|CDY21455.1|  BnaC03g27420D                                          190   6e-52   Brassica napus [oilseed rape]
ref|XP_008442305.1|  PREDICTED: probable leucine-rich repeat rece...    190   6e-52   Cucumis melo [Oriental melon]
ref|XP_010065202.1|  PREDICTED: probable leucine-rich repeat rece...    189   8e-52   Eucalyptus grandis [rose gum]
ref|XP_010671953.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    189   1e-51   
ref|XP_008782739.1|  PREDICTED: probable leucine-rich repeat rece...    189   1e-51   Phoenix dactylifera
gb|KFK42372.1|  hypothetical protein AALP_AA2G247300                    189   1e-51   Arabis alpina [alpine rockcress]
emb|CDX83184.1|  BnaA03g23220D                                          189   2e-51   
ref|XP_006389866.1|  hypothetical protein EUTSA_v10018176mg             187   2e-51   
ref|XP_010275979.1|  PREDICTED: probable leucine-rich repeat rece...    188   3e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010441081.1|  PREDICTED: probable leucine-rich repeat rece...    187   4e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009128375.1|  PREDICTED: probable leucine-rich repeat rece...    187   4e-51   Brassica rapa
ref|XP_010252249.1|  PREDICTED: probable leucine-rich repeat rece...    187   6e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010252248.1|  PREDICTED: probable leucine-rich repeat rece...    187   6e-51   Nelumbo nucifera [Indian lotus]
ref|XP_009134023.1|  PREDICTED: probable leucine-rich repeat rece...    187   6e-51   Brassica rapa
emb|CDY61244.1|  BnaCnng37500D                                          187   6e-51   Brassica napus [oilseed rape]
ref|XP_006402242.1|  hypothetical protein EUTSA_v10012589mg             187   7e-51   Eutrema salsugineum [saltwater cress]
ref|XP_010442445.1|  PREDICTED: probable leucine-rich repeat rece...    187   7e-51   
ref|XP_010417632.1|  PREDICTED: probable leucine-rich repeat rece...    187   7e-51   Camelina sativa [gold-of-pleasure]
emb|CDY49740.1|  BnaA02g19320D                                          188   1e-50   Brassica napus [oilseed rape]
ref|XP_006358564.1|  PREDICTED: probable leucine-rich repeat rece...    186   1e-50   Solanum tuberosum [potatoes]
ref|XP_002323702.2|  leucine-rich repeat transmembrane protein ki...    186   1e-50   Populus trichocarpa [western balsam poplar]
ref|XP_009118911.1|  PREDICTED: probable leucine-rich repeat rece...    186   1e-50   Brassica rapa
ref|XP_011012973.1|  PREDICTED: probable leucine-rich repeat rece...    186   1e-50   Populus euphratica
ref|XP_008802221.1|  PREDICTED: probable leucine-rich repeat rece...    186   2e-50   
emb|CDY22287.1|  BnaC02g25910D                                          187   2e-50   Brassica napus [oilseed rape]
gb|EEE52938.1|  hypothetical protein OsJ_35570                          186   2e-50   Oryza sativa Japonica Group [Japonica rice]
emb|CDP08081.1|  unnamed protein product                                186   2e-50   Coffea canephora [robusta coffee]
ref|NP_001066400.1|  Os12g0210400                                       186   2e-50   
ref|XP_006300598.1|  hypothetical protein CARUB_v10019721mg             186   2e-50   
gb|KHN40741.1|  Putative leucine-rich repeat receptor-like protei...    185   3e-50   Glycine soja [wild soybean]
ref|XP_002269419.1|  PREDICTED: probable leucine-rich repeat rece...    185   3e-50   Vitis vinifera
emb|CDX83183.1|  BnaA03g23230D                                          184   3e-50   
ref|XP_009134024.1|  PREDICTED: probable leucine-rich repeat rece...    184   7e-50   Brassica rapa
ref|XP_010314121.1|  PREDICTED: probable leucine-rich repeat rece...    184   7e-50   Solanum lycopersicum
ref|XP_010441110.1|  PREDICTED: probable leucine-rich repeat rece...    173   1e-49   Camelina sativa [gold-of-pleasure]
gb|KJB57523.1|  hypothetical protein B456_009G167900                    183   1e-49   Gossypium raimondii
gb|KFK26616.1|  hypothetical protein AALP_AA8G271800                    183   1e-49   Arabis alpina [alpine rockcress]
ref|XP_010038738.1|  PREDICTED: probable leucine-rich repeat rece...    183   1e-49   Eucalyptus grandis [rose gum]
gb|KCW47574.1|  hypothetical protein EUGRSUZ_K01321                     183   2e-49   Eucalyptus grandis [rose gum]
ref|XP_003535032.1|  PREDICTED: probable leucine-rich repeat rece...    183   2e-49   Glycine max [soybeans]
ref|XP_010930467.1|  PREDICTED: probable leucine-rich repeat rece...    183   2e-49   
ref|XP_010921260.1|  PREDICTED: probable leucine-rich repeat rece...    180   3e-49   
gb|KGN59773.1|  hypothetical protein Csa_3G844910                       181   3e-49   
ref|XP_010429861.1|  PREDICTED: probable leucine-rich repeat rece...    182   4e-49   Camelina sativa [gold-of-pleasure]
ref|NP_199787.2|  leucine-rich repeat protein kinase-like protein       182   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482269.1|  PREDICTED: probable leucine-rich repeat rece...    182   4e-49   Camelina sativa [gold-of-pleasure]
dbj|BAA98164.1|  receptor protein kinase-like                           182   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007206754.1|  hypothetical protein PRUPE_ppa025198mg             176   5e-49   
ref|XP_009370844.1|  PREDICTED: probable leucine-rich repeat rece...    181   7e-49   Pyrus x bretschneideri [bai li]
ref|XP_010688349.1|  PREDICTED: probable leucine-rich repeat rece...    181   7e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007154094.1|  hypothetical protein PHAVU_003G0900000g            180   8e-49   Phaseolus vulgaris [French bean]
ref|XP_010938089.1|  PREDICTED: probable leucine-rich repeat rece...    181   9e-49   Elaeis guineensis
ref|XP_010113026.1|  putative leucine-rich repeat receptor-like p...    181   1e-48   Morus notabilis
ref|XP_004249557.1|  PREDICTED: probable leucine-rich repeat rece...    181   1e-48   Solanum lycopersicum
ref|XP_002864013.1|  leucine-rich repeat family protein                 175   1e-48   
ref|XP_010482274.1|  PREDICTED: probable leucine-rich repeat rece...    179   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009761610.1|  PREDICTED: probable leucine-rich repeat rece...    181   1e-48   Nicotiana sylvestris
ref|XP_009387132.1|  PREDICTED: probable leucine-rich repeat rece...    181   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011012970.1|  PREDICTED: probable leucine-rich repeat rece...    181   1e-48   Populus euphratica
ref|XP_007154093.1|  hypothetical protein PHAVU_003G0900000g            180   1e-48   Phaseolus vulgaris [French bean]
ref|XP_011012972.1|  PREDICTED: probable leucine-rich repeat rece...    181   2e-48   Populus euphratica
gb|KHG12756.1|  hypothetical protein F383_03913                         180   2e-48   Gossypium arboreum [tree cotton]
gb|KHN40214.1|  Putative leucine-rich repeat receptor-like protei...    179   2e-48   Glycine soja [wild soybean]
ref|XP_009761326.1|  PREDICTED: probable leucine-rich repeat rece...    180   2e-48   Nicotiana sylvestris
ref|XP_010044506.1|  PREDICTED: probable leucine-rich repeat rece...    180   2e-48   Eucalyptus grandis [rose gum]
ref|XP_009600216.1|  PREDICTED: probable leucine-rich repeat rece...    180   2e-48   Nicotiana tomentosiformis
emb|CDM81501.1|  unnamed protein product                                180   2e-48   Triticum aestivum [Canadian hard winter wheat]
emb|CDM81495.1|  unnamed protein product                                180   3e-48   Triticum aestivum [Canadian hard winter wheat]
gb|KHN40213.1|  Putative leucine-rich repeat receptor-like protei...    179   3e-48   Glycine soja [wild soybean]
ref|XP_006584124.1|  PREDICTED: probable leucine-rich repeat rece...    179   3e-48   Glycine max [soybeans]
ref|XP_010482273.1|  PREDICTED: probable leucine-rich repeat rece...    179   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010482272.1|  PREDICTED: probable leucine-rich repeat rece...    179   4e-48   Camelina sativa [gold-of-pleasure]
ref|XP_002864014.1|  leucine-rich repeat family protein                 179   4e-48   
ref|XP_006402241.1|  hypothetical protein EUTSA_v10012584mg             179   4e-48   
ref|XP_010482271.1|  PREDICTED: probable leucine-rich repeat rece...    179   5e-48   
dbj|BAJ94480.1|  predicted protein                                      179   5e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ89467.1|  predicted protein                                      179   5e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009337850.1|  PREDICTED: probable leucine-rich repeat rece...    179   5e-48   Pyrus x bretschneideri [bai li]
ref|XP_006584125.1|  PREDICTED: probable leucine-rich repeat rece...    179   5e-48   Glycine max [soybeans]
ref|XP_004960772.1|  PREDICTED: probable leucine-rich repeat rece...    179   7e-48   Setaria italica
ref|XP_006338928.1|  PREDICTED: probable leucine-rich repeat rece...    178   9e-48   Solanum tuberosum [potatoes]
ref|XP_011461103.1|  PREDICTED: probable leucine-rich repeat rece...    178   1e-47   Fragaria vesca subsp. vesca
ref|XP_009417853.1|  PREDICTED: probable leucine-rich repeat rece...    176   2e-47   
ref|XP_009365988.1|  PREDICTED: probable leucine-rich repeat rece...    177   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_009365989.1|  PREDICTED: probable leucine-rich repeat rece...    177   3e-47   
ref|XP_008804684.1|  PREDICTED: probable leucine-rich repeat rece...    174   3e-47   
ref|XP_009417851.1|  PREDICTED: probable leucine-rich repeat rece...    177   3e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009417852.1|  PREDICTED: probable leucine-rich repeat rece...    176   3e-47   
ref|XP_010922852.1|  PREDICTED: probable leucine-rich repeat rece...    177   3e-47   Elaeis guineensis
ref|XP_009365992.1|  PREDICTED: probable leucine-rich repeat rece...    177   4e-47   
ref|XP_008465342.1|  PREDICTED: probable leucine-rich repeat rece...    176   4e-47   Cucumis melo [Oriental melon]
ref|XP_009417849.1|  PREDICTED: probable leucine-rich repeat rece...    176   4e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387702.1|  PREDICTED: probable leucine-rich repeat rece...    176   4e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010484994.1|  PREDICTED: probable leucine-rich repeat rece...    175   5e-47   
gb|EYU33251.1|  hypothetical protein MIMGU_mgv1a021972mg                176   7e-47   Erythranthe guttata [common monkey flower]
ref|XP_008804670.1|  PREDICTED: probable leucine-rich repeat rece...    176   7e-47   
ref|XP_011018905.1|  PREDICTED: probable leucine-rich repeat rece...    176   8e-47   Populus euphratica
ref|NP_199786.2|  Leucine-rich repeat (LRR) family protein              171   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007208371.1|  hypothetical protein PRUPE_ppa000921mg             175   1e-46   Prunus persica
emb|CDP16125.1|  unnamed protein product                                172   1e-46   Coffea canephora [robusta coffee]
ref|XP_002308292.2|  leucine-rich repeat transmembrane protein ki...    175   1e-46   Populus trichocarpa [western balsam poplar]
ref|XP_009391654.1|  PREDICTED: probable leucine-rich repeat rece...    174   2e-46   
ref|XP_007208107.1|  hypothetical protein PRUPE_ppa000924mg             175   2e-46   Prunus persica
emb|CDY21452.1|  BnaC03g27450D                                          174   2e-46   Brassica napus [oilseed rape]
emb|CDO97683.1|  unnamed protein product                                174   2e-46   Coffea canephora [robusta coffee]
gb|EMT14100.1|  Putative LRR receptor-like serine/threonine-prote...    174   2e-46   
emb|CDY12940.1|  BnaA09g13340D                                          174   2e-46   Brassica napus [oilseed rape]
ref|XP_010682227.1|  PREDICTED: probable leucine-rich repeat rece...    174   2e-46   
ref|XP_009364675.1|  PREDICTED: probable leucine-rich repeat rece...    174   2e-46   
ref|XP_010441071.1|  PREDICTED: probable leucine-rich repeat rece...    174   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_002519985.1|  receptor protein kinase, putative                  174   3e-46   Ricinus communis
ref|XP_006279556.1|  hypothetical protein CARUB_v10025735mg             175   3e-46   
ref|XP_002467924.1|  hypothetical protein SORBIDRAFT_01g036470          174   4e-46   
ref|XP_006664421.1|  PREDICTED: probable leucine-rich repeat rece...    173   4e-46   
ref|XP_010442444.1|  PREDICTED: probable leucine-rich repeat rece...    173   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010653092.1|  PREDICTED: probable leucine-rich repeat rece...    173   5e-46   Vitis vinifera
ref|XP_009416032.1|  PREDICTED: probable leucine-rich repeat rece...    173   5e-46   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAQ58615.1|  ATP binding / kinase/ protein serine / threonine...    173   5e-46   Vitis vinifera
ref|XP_003593681.1|  Somatic embryogenesis receptor-like kinase         173   6e-46   Medicago truncatula
ref|XP_004485853.1|  PREDICTED: probable leucine-rich repeat rece...    173   6e-46   Cicer arietinum [garbanzo]
ref|XP_011077100.1|  PREDICTED: probable leucine-rich repeat rece...    172   1e-45   Sesamum indicum [beniseed]
ref|XP_008345657.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    173   1e-45   
ref|XP_010537840.1|  PREDICTED: probable leucine-rich repeat rece...    172   1e-45   Tarenaya hassleriana [spider flower]
ref|XP_006651341.1|  PREDICTED: probable leucine-rich repeat rece...    172   2e-45   
ref|XP_006385115.1|  hypothetical protein POPTR_0004s24060g             164   2e-45   
gb|KJB57522.1|  hypothetical protein B456_009G167900                    171   2e-45   Gossypium raimondii
ref|XP_008359275.1|  PREDICTED: probable leucine-rich repeat rece...    162   3e-45   
ref|XP_002311479.2|  hypothetical protein POPTR_0008s12450g             166   3e-45   
ref|NP_001242669.1|  probable leucine-rich repeat receptor-like p...    169   4e-45   Glycine max [soybeans]
emb|CDY19539.1|  BnaC09g13640D                                          170   6e-45   Brassica napus [oilseed rape]
ref|NP_199788.1|  putative leucine-rich repeat receptor-like prot...    170   7e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009113087.1|  PREDICTED: probable leucine-rich repeat rece...    170   8e-45   
ref|XP_004972229.1|  PREDICTED: probable leucine-rich repeat rece...    169   1e-44   
emb|CDY12939.1|  BnaA09g13350D                                          169   1e-44   Brassica napus [oilseed rape]
ref|XP_002864015.1|  hypothetical protein ARALYDRAFT_495037             169   1e-44   
gb|KHN48167.1|  Putative leucine-rich repeat receptor-like protei...    169   1e-44   Glycine soja [wild soybean]
ref|XP_006279961.1|  hypothetical protein CARUB_v10025827mg             169   1e-44   Capsella rubella
ref|XP_011088110.1|  PREDICTED: probable leucine-rich repeat rece...    169   2e-44   Sesamum indicum [beniseed]
ref|XP_009391655.1|  PREDICTED: probable leucine-rich repeat rece...    169   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002441283.1|  hypothetical protein SORBIDRAFT_09g023790          167   2e-44   
ref|NP_001176022.1|  Os10g0145700                                       161   2e-44   
ref|XP_006588460.1|  PREDICTED: probable leucine-rich repeat rece...    169   2e-44   Glycine max [soybeans]
ref|XP_008227086.1|  PREDICTED: probable leucine-rich repeat rece...    169   2e-44   Prunus mume [ume]
gb|EYU39493.1|  hypothetical protein MIMGU_mgv1a025586mg                168   3e-44   Erythranthe guttata [common monkey flower]
ref|XP_006371696.1|  hypothetical protein POPTR_0018s002601g            157   7e-44   
ref|XP_003593677.1|  Receptor-like protein kinase                       163   9e-44   Medicago truncatula
ref|XP_007208219.1|  hypothetical protein PRUPE_ppa018586mg             167   1e-43   
ref|XP_003541454.1|  PREDICTED: probable leucine-rich repeat rece...    166   2e-43   Glycine max [soybeans]
ref|XP_008643850.1|  PREDICTED: uncharacterized protein LOC100382...    166   2e-43   Zea mays [maize]
ref|XP_008643846.1|  PREDICTED: uncharacterized protein LOC100382...    166   2e-43   
gb|ABF95747.1|  Protein kinase domain containing protein, expressed     166   2e-43   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75182.1|  hypothetical protein OsI_11410                          166   2e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_003561670.2|  PREDICTED: probable leucine-rich repeat rece...    166   3e-43   Brachypodium distachyon [annual false brome]
ref|XP_011461107.1|  PREDICTED: probable leucine-rich repeat rece...    165   4e-43   Fragaria vesca subsp. vesca
ref|XP_011461106.1|  PREDICTED: probable leucine-rich repeat rece...    165   4e-43   Fragaria vesca subsp. vesca
gb|EMT31021.1|  Putative LRR receptor-like serine/threonine-prote...    165   4e-43   
ref|XP_004295860.1|  PREDICTED: probable leucine-rich repeat rece...    165   5e-43   Fragaria vesca subsp. vesca
ref|XP_008782792.1|  PREDICTED: probable leucine-rich repeat rece...    164   7e-43   
emb|CBI31129.3|  unnamed protein product                                164   9e-43   Vitis vinifera
ref|XP_007212514.1|  hypothetical protein PRUPE_ppa017853mg             164   1e-42   
ref|XP_011084699.1|  PREDICTED: probable leucine-rich repeat rece...    164   1e-42   Sesamum indicum [beniseed]
ref|XP_003593682.1|  Somatic embryogenesis receptor-like kinase         164   1e-42   
ref|XP_011028449.1|  PREDICTED: probable leucine-rich repeat rece...    162   2e-42   Populus euphratica
dbj|BAJ96239.1|  predicted protein                                      162   2e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008649802.1|  PREDICTED: probable leucine-rich repeat rece...    163   2e-42   Zea mays [maize]
ref|XP_010482266.1|  PREDICTED: probable leucine-rich repeat rece...    163   3e-42   
gb|KFK31438.1|  hypothetical protein AALP_AA6G111800                    162   3e-42   Arabis alpina [alpine rockcress]
ref|XP_010067427.1|  PREDICTED: probable leucine-rich repeat rece...    162   4e-42   
ref|XP_006655431.1|  PREDICTED: probable leucine-rich repeat rece...    162   4e-42   Oryza brachyantha
ref|XP_010044534.1|  PREDICTED: probable leucine-rich repeat rece...    162   5e-42   Eucalyptus grandis [rose gum]
ref|XP_011461097.1|  PREDICTED: probable leucine-rich repeat rece...    162   5e-42   Fragaria vesca subsp. vesca
ref|XP_010044526.1|  PREDICTED: probable leucine-rich repeat rece...    162   6e-42   Eucalyptus grandis [rose gum]
ref|XP_008366451.1|  PREDICTED: probable leucine-rich repeat rece...    161   8e-42   
ref|XP_009406444.1|  PREDICTED: probable leucine-rich repeat rece...    161   8e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406445.1|  PREDICTED: probable leucine-rich repeat rece...    161   8e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009335437.1|  PREDICTED: probable leucine-rich repeat rece...    161   1e-41   Pyrus x bretschneideri [bai li]
ref|XP_002864016.1|  predicted protein                                  161   1e-41   
ref|XP_010044564.1|  PREDICTED: probable leucine-rich repeat rece...    161   1e-41   Eucalyptus grandis [rose gum]
gb|EMT33703.1|  Putative LRR receptor-like serine/threonine-prote...    160   2e-41   
ref|XP_003578779.1|  PREDICTED: probable leucine-rich repeat rece...    160   2e-41   Brachypodium distachyon [annual false brome]
ref|XP_007148093.1|  hypothetical protein PHAVU_006G180200g             159   4e-41   Phaseolus vulgaris [French bean]
ref|XP_010690203.1|  PREDICTED: probable leucine-rich repeat rece...    159   4e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011466378.1|  PREDICTED: probable leucine-rich repeat rece...    159   6e-41   Fragaria vesca subsp. vesca
emb|CDP15606.1|  unnamed protein product                                159   7e-41   Coffea canephora [robusta coffee]
ref|XP_010252250.1|  PREDICTED: probable leucine-rich repeat rece...    159   7e-41   Nelumbo nucifera [Indian lotus]
dbj|BAA98166.1|  receptor protein kinase-like                           158   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002440790.1|  hypothetical protein SORBIDRAFT_09g006630          157   2e-40   
gb|EYU39755.1|  hypothetical protein MIMGU_mgv1a000835mg                157   2e-40   
ref|XP_003566120.1|  PREDICTED: probable leucine-rich repeat rece...    157   2e-40   
gb|EMT13742.1|  Putative LRR receptor-like serine/threonine-prote...    157   2e-40   
ref|XP_006429975.1|  hypothetical protein CICLE_v100110352mg            146   3e-40   
ref|XP_009417854.1|  PREDICTED: probable leucine-rich repeat rece...    157   3e-40   
ref|XP_006644901.1|  PREDICTED: probable leucine-rich repeat rece...    157   4e-40   
ref|XP_008227090.1|  PREDICTED: probable leucine-rich repeat rece...    156   7e-40   
ref|XP_010252247.1|  PREDICTED: probable leucine-rich repeat rece...    155   8e-40   
ref|XP_010252245.1|  PREDICTED: probable leucine-rich repeat rece...    155   8e-40   
ref|XP_010252244.1|  PREDICTED: probable leucine-rich repeat rece...    155   9e-40   
ref|XP_010252243.1|  PREDICTED: probable leucine-rich repeat rece...    155   1e-39   
ref|XP_010044552.1|  PREDICTED: probable leucine-rich repeat rece...    155   1e-39   
dbj|BAK05595.1|  predicted protein                                      155   1e-39   
ref|XP_010690261.1|  PREDICTED: probable leucine-rich repeat rece...    155   1e-39   
ref|XP_010233532.1|  PREDICTED: probable leucine-rich repeat rece...    155   1e-39   
ref|XP_010690267.1|  PREDICTED: probable leucine-rich repeat rece...    155   1e-39   
ref|XP_010690246.1|  PREDICTED: probable leucine-rich repeat rece...    155   2e-39   
ref|XP_007147542.1|  hypothetical protein PHAVU_006G133400g             155   2e-39   
ref|XP_010690238.1|  PREDICTED: probable leucine-rich repeat rece...    155   2e-39   
ref|XP_011028453.1|  PREDICTED: probable leucine-rich repeat rece...    154   2e-39   
gb|EAZ13939.1|  hypothetical protein OsJ_03866                          154   3e-39   
ref|XP_011028452.1|  PREDICTED: probable leucine-rich repeat rece...    154   3e-39   
ref|XP_011028451.1|  PREDICTED: probable leucine-rich repeat rece...    154   3e-39   
ref|XP_011028450.1|  PREDICTED: probable leucine-rich repeat rece...    154   3e-39   
ref|XP_010690253.1|  PREDICTED: probable leucine-rich repeat rece...    154   3e-39   
gb|EAY76270.1|  hypothetical protein OsI_04206                          154   4e-39   
dbj|BAD82283.1|  putative receptor-like protein kinase 2                154   4e-39   
ref|XP_010044547.1|  PREDICTED: probable leucine-rich repeat rece...    154   5e-39   
gb|KCW88501.1|  hypothetical protein EUGRSUZ_A00887                     153   7e-39   
gb|EEC79425.1|  hypothetical protein OsI_20397                          153   8e-39   
ref|NP_001055877.1|  Os05g0486100                                       153   8e-39   
ref|XP_003566601.1|  PREDICTED: probable leucine-rich repeat rece...    153   9e-39   
ref|XP_006655430.1|  PREDICTED: probable leucine-rich repeat rece...    152   1e-38   
ref|XP_006282275.1|  hypothetical protein CARUB_v10028556mg             152   2e-38   
ref|XP_004962484.1|  PREDICTED: probable leucine-rich repeat rece...    150   6e-38   
ref|XP_011461108.1|  PREDICTED: probable leucine-rich repeat rece...    150   8e-38   
ref|XP_007213558.1|  hypothetical protein PRUPE_ppa017796mg             149   1e-37   
ref|XP_006385109.1|  hypothetical protein POPTR_0004s240001g            148   3e-37   
ref|XP_006655181.1|  PREDICTED: probable leucine-rich repeat rece...    148   4e-37   
emb|CDM84721.1|  unnamed protein product                                147   6e-37   
gb|KCW88500.1|  hypothetical protein EUGRSUZ_A00886                     147   8e-37   
ref|XP_002441998.1|  hypothetical protein SORBIDRAFT_08g006710          147   1e-36   
ref|XP_008674899.1|  PREDICTED: probable leucine-rich repeat rece...    146   2e-36   
dbj|BAJ91189.1|  predicted protein                                      146   2e-36   
ref|XP_006385110.1|  hypothetical protein POPTR_0004s24010g             145   3e-36   
ref|NP_001131018.1|  uncharacterized LOC100192366 precursor             145   3e-36   
ref|XP_011466377.1|  PREDICTED: probable leucine-rich repeat rece...    139   2e-35   
ref|XP_010252233.1|  PREDICTED: probable leucine-rich repeat rece...    142   3e-35   
ref|XP_006385111.1|  hypothetical protein POPTR_0004s24020g             142   4e-35   
gb|EEE63180.1|  hypothetical protein OsJ_17989                          142   6e-35   
ref|XP_006281792.1|  hypothetical protein CARUB_v10027977mg             142   7e-35   
ref|XP_010682078.1|  PREDICTED: probable leucine-rich repeat rece...    141   8e-35   
ref|XP_006662853.1|  PREDICTED: probable leucine-rich repeat rece...    141   8e-35   
gb|EEC78946.1|  hypothetical protein OsI_19395                          140   2e-34   
ref|XP_004970368.1|  PREDICTED: probable leucine-rich repeat rece...    140   3e-34   
ref|XP_011466379.1|  PREDICTED: probable leucine-rich repeat rece...    129   4e-34   
gb|EEE51910.1|  hypothetical protein OsJ_33512                          139   5e-34   
gb|AAX92929.1|  At5g49760                                               139   5e-34   
gb|EEC67947.1|  hypothetical protein OsI_35675                          139   6e-34   
emb|CDM84720.1|  unnamed protein product                                139   6e-34   
ref|XP_009386322.1|  PREDICTED: probable leucine-rich repeat rece...    131   7e-34   
gb|KDO40687.1|  hypothetical protein CISIN_1g002189mg                   137   2e-33   
ref|XP_010252434.1|  PREDICTED: probable leucine-rich repeat rece...    134   7e-33   
ref|XP_008793425.1|  PREDICTED: probable leucine-rich repeat rece...    134   2e-32   
ref|XP_010233531.1|  PREDICTED: probable leucine-rich repeat rece...    130   4e-31   
ref|XP_007207226.1|  hypothetical protein PRUPE_ppa000992mg             130   8e-31   
ref|XP_004961712.1|  PREDICTED: probable leucine-rich repeat rece...    130   1e-30   
ref|XP_004961711.1|  PREDICTED: probable leucine-rich repeat rece...    130   1e-30   
emb|CDP12546.1|  unnamed protein product                                125   2e-30   
gb|EMT20931.1|  Putative LRR receptor-like serine/threonine-prote...    128   5e-30   
ref|XP_001777494.1|  predicted protein                                  128   5e-30   
gb|KEH20270.1|  leucine-rich receptor-like kinase family protein        120   4e-29   
ref|XP_010252242.1|  PREDICTED: probable leucine-rich repeat rece...    125   5e-29   
ref|XP_002315909.2|  hypothetical protein POPTR_0010s12810g             115   1e-28   
ref|XP_001760085.1|  predicted protein                                  124   2e-28   
gb|AAT01330.1|  putative receptor protein kinase                        120   2e-27   
dbj|BAA98163.1|  unnamed protein product                                116   4e-27   
ref|XP_006385117.1|  hypothetical protein POPTR_0004s24080g             119   4e-27   
ref|XP_008246057.1|  PREDICTED: probable leucine-rich repeat rece...    115   7e-27   
ref|XP_008245573.1|  PREDICTED: probable leucine-rich repeat rece...    116   5e-26   
ref|XP_010482267.1|  PREDICTED: probable leucine-rich repeat rece...    114   3e-25   
tpg|DAA57113.1|  TPA: putative transmembrane protein kinase famil...    114   4e-25   
ref|XP_008465343.1|  PREDICTED: probable leucine-rich repeat rece...    113   6e-25   
ref|XP_002962984.1|  hypothetical protein SELMODRAFT_438262             113   6e-25   
ref|XP_002993954.1|  hypothetical protein SELMODRAFT_431914             112   6e-25   
gb|KDP21807.1|  hypothetical protein JCGZ_00594                         108   7e-25   
dbj|BAF79948.1|  receptor-like kinase                                   112   2e-24   
ref|XP_002456530.1|  hypothetical protein SORBIDRAFT_03g037960          111   2e-24   
gb|KCW88498.1|  hypothetical protein EUGRSUZ_A00884                     110   2e-24   
gb|KCW88497.1|  hypothetical protein EUGRSUZ_A00884                     110   4e-24   
ref|XP_001774376.1|  predicted protein                                  110   5e-24   
emb|CAN68980.1|  hypothetical protein VITISV_004150                     108   2e-23   
gb|KFK23621.1|  hypothetical protein AALP_AAs71127U000200               100   2e-22   
ref|XP_010088707.1|  putative leucine-rich repeat receptor-like p...    104   4e-22   
gb|KCW62546.1|  hypothetical protein EUGRSUZ_G00038                     105   4e-22   
gb|AAG51067.1|AC069472_7  unknown protein; 756-145                    98.6    1e-21   
ref|XP_010442449.1|  PREDICTED: probable leucine-rich repeat rece...    103   1e-21   
ref|XP_010486908.1|  PREDICTED: polygalacturonase inhibitor 1-like      100   1e-21   
ref|XP_010464968.1|  PREDICTED: polygalacturonase inhibitor 1-like      100   2e-21   
ref|XP_008802212.1|  PREDICTED: probable leucine-rich repeat rece...    102   3e-21   
ref|NP_974291.4|  leucine-rich repeat protein FLOR1                   98.6    5e-21   
gb|AAL15279.1|  At3g12148/T23B7.11                                    98.6    5e-21   
ref|XP_008370579.1|  PREDICTED: probable leucine-rich repeat rece...    101   6e-21   
ref|XP_006298126.1|  hypothetical protein CARUB_v10014170mg           98.6    6e-21   
emb|CDY52623.1|  BnaCnng23020D                                        98.2    8e-21   
gb|EEC79423.1|  hypothetical protein OsI_20395                          101   8e-21   
gb|AAF65195.1|AF136588_1  leucine-rich repeat protein FLR1            97.4    1e-20   
ref|XP_009120892.1|  PREDICTED: polygalacturonase inhibitor 1-like    97.4    1e-20   
gb|ACX42230.1|  polygalacturonase inhibitory protein                  97.4    1e-20   
ref|XP_010534350.1|  PREDICTED: polygalacturonase inhibitor           97.4    2e-20   
ref|XP_002884889.1|  leucine-rich repeat protein FLR1                 97.1    2e-20   
ref|XP_010498562.1|  PREDICTED: polygalacturonase inhibitor 1-lik...  96.7    3e-20   
emb|CAN68981.1|  hypothetical protein VITISV_004151                   99.0    4e-20   
ref|XP_006407361.1|  hypothetical protein EUTSA_v10021132mg           95.9    6e-20   
ref|XP_010486728.1|  PREDICTED: receptor-like protein 12              94.0    1e-19   
ref|XP_006282247.1|  hypothetical protein CARUB_v10028521mg           96.7    1e-19   
ref|XP_009419865.1|  PREDICTED: probable leucine-rich repeat rece...  97.1    2e-19   
ref|XP_002322457.1|  Leucine-rich repeat receptor protein kinase ...  96.7    3e-19   
ref|NP_001060863.1|  Os08g0117700                                     96.3    3e-19   
ref|WP_028289581.1|  MULTISPECIES: hypothetical protein               93.2    3e-19   
ref|XP_011048672.1|  PREDICTED: leucine-rich repeat receptor prot...  96.7    4e-19   
ref|XP_007023749.1|  Leucine-rich repeat protein kinase family pr...  89.4    5e-19   
ref|XP_007217616.1|  hypothetical protein PRUPE_ppa016276mg           95.9    7e-19   
gb|KFK38578.1|  hypothetical protein AALP_AA3G131900                  92.0    1e-18   
ref|XP_010043840.1|  PREDICTED: probable LRR receptor-like serine...  95.1    1e-18   
ref|XP_010043831.1|  PREDICTED: probable LRR receptor-like serine...  94.7    1e-18   
dbj|BAP55140.1|  receptor protein kinase-like protein                 92.0    2e-18   
ref|XP_002993941.1|  hypothetical protein SELMODRAFT_449258           94.4    2e-18   
ref|XP_010486743.1|  PREDICTED: receptor-like protein 12              92.8    2e-18   
ref|XP_009396739.1|  PREDICTED: probable LRR receptor-like serine...  91.3    3e-18   
ref|XP_010940921.1|  PREDICTED: LRR receptor-like serine/threonin...  93.6    3e-18   
gb|EEC79424.1|  hypothetical protein OsI_20396                        89.7    3e-18   
emb|CDY08451.1|  BnaA05g26870D                                        90.5    4e-18   
ref|WP_040586508.1|  hypothetical protein                             89.7    4e-18   
ref|XP_009629750.1|  PREDICTED: receptor-like protein 12 isoform X2   91.3    4e-18   
gb|AFW86032.1|  putative leucine-rich repeat receptor-like protei...  92.0    4e-18   
gb|EMT02279.1|  Putative LRR receptor-like serine/threonine-prote...  93.2    5e-18   
ref|XP_006654549.1|  PREDICTED: probable LRR receptor-like serine...  93.2    5e-18   
gb|KFK23620.1|  hypothetical protein AALP_AAs71127U000100             92.4    5e-18   
ref|XP_008658489.1|  PREDICTED: uncharacterized protein LOC100279...  92.8    5e-18   
gb|AFW86031.1|  putative leucine-rich repeat receptor-like protei...  92.8    6e-18   
ref|XP_006282197.1|  hypothetical protein CARUB_v10028463mg           92.8    6e-18   
emb|CDY42127.1|  BnaC05g40920D                                        89.7    6e-18   
ref|XP_008376456.1|  PREDICTED: somatic embryogenesis receptor ki...  92.4    6e-18   
gb|AFW86033.1|  putative leucine-rich repeat receptor-like protei...  92.0    6e-18   
ref|XP_011461109.1|  PREDICTED: probable leucine-rich repeat rece...  92.4    6e-18   
ref|XP_009146639.1|  PREDICTED: polygalacturonase inhibitor 1-like    89.7    7e-18   
gb|EPS72502.1|  hypothetical protein M569_02256                       88.6    7e-18   
ref|XP_010276048.1|  PREDICTED: LRR receptor-like serine/threonin...  92.8    7e-18   
tpg|DAA57112.1|  TPA: putative transmembrane protein kinase famil...  92.8    8e-18   
gb|AFW86034.1|  putative leucine-rich repeat receptor-like protei...  92.4    8e-18   
emb|CDP12544.1|  unnamed protein product                              85.1    1e-17   
ref|XP_009629749.1|  PREDICTED: LRR receptor-like serine/threonin...  90.5    1e-17   
ref|XP_009125665.1|  PREDICTED: polygalacturonase inhibitor 1-lik...  89.0    1e-17   
ref|XP_008810292.1|  PREDICTED: LRR receptor-like serine/threonin...  91.7    1e-17   
ref|XP_008810291.1|  PREDICTED: LRR receptor-like serine/threonin...  91.7    1e-17   
ref|XP_009125666.1|  PREDICTED: polygalacturonase inhibitor 1-lik...  88.6    1e-17   
ref|XP_010101735.1|  Leucine-rich repeat receptor protein kinase EXS  91.3    1e-17   
ref|XP_008810290.1|  PREDICTED: LRR receptor-like serine/threonin...  91.7    1e-17   
ref|XP_004964421.1|  PREDICTED: LRR receptor-like serine/threonin...  91.7    2e-17   
gb|KDO65362.1|  hypothetical protein CISIN_1g002278mg                 91.3    2e-17   
ref|XP_006490262.1|  PREDICTED: LRR receptor-like serine/threonin...  91.3    2e-17   
ref|XP_009374517.1|  PREDICTED: probable LRR receptor-like serine...  90.5    2e-17   
ref|XP_002436407.1|  hypothetical protein SORBIDRAFT_10g001970        90.9    2e-17   
ref|XP_009370496.1|  PREDICTED: somatic embryogenesis receptor ki...  90.5    3e-17   
ref|XP_007143329.1|  hypothetical protein PHAVU_007G063200g           90.9    3e-17   
ref|XP_006659770.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  90.1    3e-17   
ref|XP_010277439.1|  PREDICTED: LRR receptor-like serine/threonin...  90.5    3e-17   
ref|XP_010277441.1|  PREDICTED: LRR receptor-like serine/threonin...  90.5    3e-17   
emb|CDY05006.1|  BnaAnng01880D                                        87.8    3e-17   
ref|XP_010043866.1|  PREDICTED: probable LRR receptor-like serine...  90.5    3e-17   
ref|NP_001047432.1|  Os02g0615800                                     90.5    4e-17   
ref|XP_010043852.1|  PREDICTED: probable LRR receptor-like serine...  90.5    4e-17   
ref|XP_010653120.1|  PREDICTED: probable LRR receptor-like serine...  90.5    4e-17   
ref|XP_010653122.1|  PREDICTED: probable LRR receptor-like serine...  90.5    4e-17   
ref|XP_006421768.1|  hypothetical protein CICLE_v10004259mg           90.5    4e-17   
ref|XP_002266206.1|  PREDICTED: probable LRR receptor-like serine...  90.1    4e-17   
emb|CDP12545.1|  unnamed protein product                              87.0    4e-17   
ref|XP_002890247.1|  hypothetical protein ARALYDRAFT_471987           90.5    4e-17   
gb|AFW74368.1|  putative leucine-rich repeat protein kinase famil...  86.7    5e-17   
ref|WP_028283510.1|  hypothetical protein                             86.7    5e-17   
ref|XP_002323096.2|  hypothetical protein POPTR_0016s14700g           87.0    5e-17   
ref|XP_004309271.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  89.7    5e-17   
ref|XP_004233963.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  85.9    5e-17   
ref|XP_008803990.1|  PREDICTED: somatic embryogenesis receptor ki...  89.4    6e-17   
dbj|BAK00073.1|  predicted protein                                    88.6    6e-17   
ref|XP_011001642.1|  PREDICTED: probable LRR receptor-like serine...  89.4    7e-17   
ref|XP_006347874.1|  PREDICTED: LRR receptor-like serine/threonin...  89.4    7e-17   
ref|XP_011001641.1|  PREDICTED: probable LRR receptor-like serine...  89.7    7e-17   
ref|XP_011001639.1|  PREDICTED: probable LRR receptor-like serine...  89.4    8e-17   
ref|XP_006656595.1|  PREDICTED: LRR receptor-like serine/threonin...  89.4    8e-17   
ref|XP_011001640.1|  PREDICTED: probable LRR receptor-like serine...  89.4    8e-17   
ref|XP_002873299.1|  hypothetical protein ARALYDRAFT_908657           89.4    8e-17   
ref|XP_008794535.1|  PREDICTED: LRR receptor-like serine/threonin...  89.0    9e-17   
ref|XP_006842576.1|  hypothetical protein AMTR_s00077p00154750        89.4    9e-17   
ref|XP_006481242.1|  PREDICTED: probable LRR receptor-like serine...  89.0    1e-16   
ref|XP_004961725.1|  PREDICTED: probable LRR receptor-like serine...  89.0    1e-16   
ref|XP_006481243.1|  PREDICTED: probable LRR receptor-like serine...  89.0    1e-16   
ref|XP_010276057.1|  PREDICTED: LRR receptor-like serine/threonin...  89.0    1e-16   
ref|XP_009136073.1|  PREDICTED: somatic embryogenesis receptor ki...  88.6    1e-16   
ref|XP_010416086.1|  PREDICTED: leucine-rich repeat receptor-like...  89.0    1e-16   
emb|CDX79173.1|  BnaA01g12400D                                        88.6    1e-16   
ref|XP_011029995.1|  PREDICTED: LRR receptor-like serine/threonin...  89.0    1e-16   
gb|EPS66497.1|  hypothetical protein M569_08274                       88.6    1e-16   
ref|NP_001237639.1|  ERECTA-like kinase                               88.6    1e-16   
ref|XP_003568234.2|  PREDICTED: probable LRR receptor-like serine...  88.6    2e-16   
ref|XP_002961907.1|  hypothetical protein SELMODRAFT_77292            86.3    2e-16   
ref|XP_007133279.1|  hypothetical protein PHAVU_011G166400g           88.6    2e-16   
ref|XP_004309048.2|  PREDICTED: probable LRR receptor-like serine...  88.6    2e-16   
ref|XP_010557932.1|  PREDICTED: polygalacturonase inhibitor-like      85.5    2e-16   
ref|XP_006588388.1|  PREDICTED: ERECTA-like kinase isoform X2         88.6    2e-16   
ref|NP_001172626.1|  Os01g0818600                                     86.7    2e-16   
ref|XP_008660396.1|  PREDICTED: somatic embryogenesis receptor ki...  87.8    2e-16   
ref|XP_010941035.1|  PREDICTED: probable leucine-rich repeat rece...  87.8    2e-16   
ref|XP_011041677.1|  PREDICTED: LRR receptor-like serine/threonin...  88.2    2e-16   
ref|XP_006588387.1|  PREDICTED: ERECTA-like kinase isoform X1         88.2    2e-16   
ref|XP_010458858.1|  PREDICTED: receptor-like protein 12 isoform X1   85.1    2e-16   
gb|AGT17158.1|  ERECTA-like 2                                         88.2    2e-16   
ref|XP_008782697.1|  PREDICTED: probable LRR receptor-like serine...  88.2    2e-16   
ref|XP_002269540.2|  PREDICTED: LRR receptor-like serine/threonin...  88.2    3e-16   



>ref|XP_009784886.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Nicotiana sylvestris]
Length=650

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  70   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  249
            RIQL  + ++I  L I A+T+ +D+ A+++L+D W+NVPP+WA G+DPCG  WEG+GC  
Sbjct  8    RIQLCFLVVWIHILAITAWTNPDDFAALQSLKDSWQNVPPNWA-GADPCGSQWEGIGCRN  66

Query  250  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  429
            SRV+S+TLSSM L+G+LSGDI+ LSELQ LDLSYNK+LTGSLP+ IG L KL NLILVGC
Sbjct  67   SRVISITLSSMSLSGQLSGDIQGLSELQTLDLSYNKELTGSLPQSIGKLTKLSNLILVGC  126

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  609
            GF G IPDSIGSL++L +LSLN N FIG IP ++G LS+LYWLDLADN+LTG++PVS G+
Sbjct  127  GFSGPIPDSIGSLTQLVFLSLNSNNFIGRIPATIGYLSKLYWLDLADNKLTGTLPVSSGS  186

Query  610  TPGLDM  627
            +PGLDM
Sbjct  187  SPGLDM  192



>ref|XP_009605195.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana tomentosiformis]
Length=957

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 161/196 (82%), Gaps = 2/196 (1%)
 Frame = +1

Query  43   MVI**TMIPR-IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCG  219
            MV+   M+PR IQL  + ++I  L I A+T+ +D+ A+++L+D W+NVPP+WA G+DPCG
Sbjct  1    MVVSLAMMPRRIQLCFLVVWIHVLAISAWTNPDDFAALQSLKDSWQNVPPNWA-GADPCG  59

Query  220  DHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLK  399
              WEG+GC  SRV+S+TLSSM L+G+LSGDI+ LSELQ LDLSYNK+LTGSLP+ IG L 
Sbjct  60   SQWEGIGCRNSRVISITLSSMSLSGQLSGDIQGLSELQTLDLSYNKELTGSLPQSIGKLT  119

Query  400  KLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQL  579
            KL NLILVGCGF G IPDSIGSL++L +LSLN N FIG IP ++G LS+LYWLDLADN+L
Sbjct  120  KLSNLILVGCGFSGPIPDSIGSLTQLVFLSLNSNNFIGRIPATIGYLSKLYWLDLADNKL  179

Query  580  TGSIPVSDGNTPGLDM  627
            TG++PVS G++PGLDM
Sbjct  180  TGTLPVSSGSSPGLDM  195



>gb|EYU33236.1| hypothetical protein MIMGU_mgv1a021943mg [Erythranthe guttata]
Length=955

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 151/189 (80%), Gaps = 1/189 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            MI  I L ++  FIQ L I A T++NDYVA+KAL+D W NVPP+W  GSDPCGD W+G+ 
Sbjct  1    MISGIHLTMLLAFIQVLSIAALTNSNDYVALKALKDTWINVPPNWV-GSDPCGDVWDGIT  59

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            C   RVVS+TL+S++LTG+LS DI  L+ELQ LDLSYNK +TGSLP  IGN+KKL +LIL
Sbjct  60   CKNDRVVSITLASINLTGQLSSDISGLTELQTLDLSYNKGMTGSLPSGIGNVKKLSSLIL  119

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            VGCGF G IP SIGSL +L+YLSLN N FIG IPPS+G L  LYWLDLADN+LTG+IPVS
Sbjct  120  VGCGFSGPIPPSIGSLQQLRYLSLNSNNFIGSIPPSIGNLLNLYWLDLADNKLTGTIPVS  179

Query  601  DGNTPGLDM  627
            DG +PGLDM
Sbjct  180  DGTSPGLDM  188



>ref|XP_009605193.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana tomentosiformis]
Length=948

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 158/187 (84%), Gaps = 2/187 (1%)
 Frame = +1

Query  70   RIQLLL-VPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  246
            RIQL+  + +F+Q LG+ A T++ DY  +++LR+ W+NVPP+W+ G+DPCGD W+G+ CN
Sbjct  6    RIQLISWLLIFMQVLGLDALTNSGDYGVLESLREEWENVPPNWS-GTDPCGDPWDGIECN  64

Query  247  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  426
             SRVV++ LSSM+L GELSGDIE LSELQILDLSYNKDLTGSLP+ IG+LK L  LILVG
Sbjct  65   NSRVVTIKLSSMNLKGELSGDIEALSELQILDLSYNKDLTGSLPQSIGSLKSLSILILVG  124

Query  427  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  606
            C F GLIPD++GSLS+L +LSLNLN F+GPIP S+G LS+LYWLDLADN+L+G +PVS G
Sbjct  125  CRFSGLIPDTVGSLSQLVFLSLNLNNFVGPIPASIGNLSKLYWLDLADNRLSGPLPVSHG  184

Query  607  NTPGLDM  627
            +TPGLDM
Sbjct  185  STPGLDM  191



>gb|EYU33238.1| hypothetical protein MIMGU_mgv1a025286mg [Erythranthe guttata]
Length=952

 Score =   229 bits (583),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 150/189 (79%), Gaps = 1/189 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            MI R+ L L+  FIQ L I A T+ ND+ ++KAL+D W N PP+W  GSDPCGD W+G+ 
Sbjct  1    MIWRVLLSLLVAFIQVLAIAALTNTNDFTSLKALKDTWGNYPPNWI-GSDPCGDVWDGIT  59

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            C   RVVS+TL+S+DL+G+LS DI  L+ELQ LDLSYNK +TG LP +IGN+ KL +LIL
Sbjct  60   CKNDRVVSITLASIDLSGQLSSDIAGLTELQTLDLSYNKRMTGPLPPQIGNVNKLSSLIL  119

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            VGCGFFG IP SIGSL +L+YLSLN N FIG IPPS+G L+ LYWLDLADN+LTG+IPVS
Sbjct  120  VGCGFFGPIPGSIGSLQQLRYLSLNSNNFIGSIPPSIGNLTNLYWLDLADNKLTGTIPVS  179

Query  601  DGNTPGLDM  627
            DG +PGLDM
Sbjct  180  DGTSPGLDM  188



>ref|XP_002303227.1| hypothetical protein POPTR_0003s03700g [Populus trichocarpa]
 gb|EEE78206.1| hypothetical protein POPTR_0003s03700g [Populus trichocarpa]
Length=374

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            M PRI + LV    Q   I A TD  D+ A+KAL+D WKNVPP+W  G+DPCG  WEG+ 
Sbjct  1    MGPRILVFLVVALSQGCTIPAMTDEADFTALKALKDIWKNVPPTWV-GADPCGSRWEGIL  59

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            C  SRV S+TL+SM L G LSGDI+ LSELQILDLSYNK L+G LP  IG+LKKL NLIL
Sbjct  60   CANSRVTSITLASMGLKGSLSGDIQSLSELQILDLSYNKGLSGPLPSAIGDLKKLTNLIL  119

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            VGC F+G IPDSIGSL  L  LSLN N F G IP S+G L+ LYWLDLADN+LTG+IPVS
Sbjct  120  VGCSFWGPIPDSIGSLPLLASLSLNSNGFTGSIPSSIGNLTSLYWLDLADNRLTGTIPVS  179

Query  601  DGNTPGLDM  627
               TPGLD+
Sbjct  180  TATTPGLDL  188



>ref|XP_004230391.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Solanum lycopersicum]
Length=959

 Score =   226 bits (577),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 155/195 (79%), Gaps = 1/195 (1%)
 Frame = +1

Query  43   MVI**TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGD  222
            MV+   MIPRI L  + + I  L I A T+ +D  A+++L+D W+NVPP+W  G+DPCG 
Sbjct  1    MVVSQAMIPRILLCFLFVLIHVLSIAARTNPDDSAALQSLKDSWQNVPPNWV-GADPCGS  59

Query  223  HWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK  402
             W+G+GC  SRVVS+TLSSM L G+LSGDI+ L+EL+ LDLSYNK+L GSLP+ IG L K
Sbjct  60   SWDGIGCRNSRVVSITLSSMSLEGQLSGDIQGLAELETLDLSYNKELKGSLPQSIGKLTK  119

Query  403  LYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLT  582
            L NLILVGCGF G IPD+IGSL++L +LSLN N FIG IP ++G L+ELYWLDLADN+LT
Sbjct  120  LSNLILVGCGFSGPIPDTIGSLTRLVFLSLNSNNFIGGIPATVGYLTELYWLDLADNKLT  179

Query  583  GSIPVSDGNTPGLDM  627
            G+IPVS+G++PGLD+
Sbjct  180  GTIPVSNGSSPGLDL  194



>gb|EYU33237.1| hypothetical protein MIMGU_mgv1a000884mg [Erythranthe guttata]
Length=951

 Score =   223 bits (569),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 150/189 (79%), Gaps = 1/189 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            MI RI L L+  FIQ L I A T++ND+ A+KAL+D W NVPP+W  GSDPCGD W+G+ 
Sbjct  1    MIWRIVLSLLLAFIQALAIGASTNSNDHAALKALKDTWTNVPPNWV-GSDPCGDVWDGIT  59

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            C   RVVS+TL+S++L G+LS DI  L+ELQ LDLSYNK +TGSLP  IG++KKL +LIL
Sbjct  60   CKNDRVVSITLASINLIGQLSSDISGLTELQTLDLSYNKGMTGSLPSGIGDVKKLSSLIL  119

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            VGCGF G IP SIGSL +L+YLSLN N FIG IPPS+G L  LYWLDLADN+LTG+IPVS
Sbjct  120  VGCGFSGPIPPSIGSLLQLRYLSLNSNNFIGSIPPSIGNLLNLYWLDLADNKLTGTIPVS  179

Query  601  DGNTPGLDM  627
            DG +PGLDM
Sbjct  180  DGTSPGLDM  188



>ref|XP_009803111.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana sylvestris]
Length=948

 Score =   223 bits (569),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 154/187 (82%), Gaps = 2/187 (1%)
 Frame = +1

Query  70   RIQLLL-VPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  246
            RIQL+  + + +Q L + A T+  DY  +++L++ W+NVPPSW  G+DPCGD WEG+ CN
Sbjct  7    RIQLITWLVISMQVLVLQALTNPGDYGVLESLKEEWENVPPSW-RGTDPCGDPWEGIECN  65

Query  247  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  426
             SRVV++ LSSM+L G+LSGDIE LSELQILDLSYNK LTGSLP+ IG+LK L  LILVG
Sbjct  66   NSRVVTIKLSSMNLKGQLSGDIEALSELQILDLSYNKGLTGSLPQSIGSLKSLSILILVG  125

Query  427  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  606
            CGF GLIPD++GSLS+L +LSLN+N FIGPIP S+G LS+LYWLDLADN+L+G +PVS G
Sbjct  126  CGFNGLIPDTVGSLSQLVFLSLNVNNFIGPIPASIGNLSKLYWLDLADNRLSGPLPVSHG  185

Query  607  NTPGLDM  627
            +TPGLDM
Sbjct  186  STPGLDM  192



>ref|XP_006358482.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=959

 Score =   223 bits (568),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 153/195 (78%), Gaps = 1/195 (1%)
 Frame = +1

Query  43   MVI**TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGD  222
            MV+   MI RI L  + + I  L I A T+ +D  A+++L+D W+NVPP+W  G+DPCG 
Sbjct  1    MVVSRAMIRRILLCFLFVLIHVLSIAARTNPDDSAALQSLKDSWQNVPPNWV-GADPCGS  59

Query  223  HWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK  402
             W+G+GC  SRVVS+TLSSM L G+LSGDI+ L+EL+ LDLSYNK+L GSLP+ IG L K
Sbjct  60   SWDGIGCRNSRVVSITLSSMSLEGQLSGDIQGLAELETLDLSYNKELKGSLPQSIGKLTK  119

Query  403  LYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLT  582
            L NLILVGCGF G IPD+IGSL++L +LSLN N FIG IP ++G L+EL+WLDLADN+LT
Sbjct  120  LSNLILVGCGFSGPIPDTIGSLTRLVFLSLNSNNFIGGIPATIGNLTELHWLDLADNKLT  179

Query  583  GSIPVSDGNTPGLDM  627
            G+IPVS+G+ PGLDM
Sbjct  180  GTIPVSNGSNPGLDM  194



>emb|CDO97682.1| unnamed protein product [Coffea canephora]
Length=953

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 150/189 (79%), Gaps = 1/189 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            M  RIQ  L+ +F+Q L + A T+  D+ A+++L+ GW+N PP+WA G+DPCG  W G+G
Sbjct  1    MFARIQPYLLVIFVQVLVVAAITNPQDFAALQSLKSGWENAPPNWA-GTDPCGSGWIGIG  59

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            C+ SRVVS+TL+S+ L+G++ GDI +LSEL  LDLSYN+ LTGSLPR IGNL KL +LIL
Sbjct  60   CSNSRVVSITLASVGLSGQVPGDIADLSELLTLDLSYNEGLTGSLPRTIGNLAKLTSLIL  119

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            VGCGF G IPD+IGS+ +L  LSLN NKFIG IPPS+G L +L+WLDLADN+L+GSIPVS
Sbjct  120  VGCGFSGQIPDTIGSMKQLYTLSLNSNKFIGQIPPSIGALPKLHWLDLADNKLSGSIPVS  179

Query  601  DGNTPGLDM  627
            +G  PGLDM
Sbjct  180  NGTAPGLDM  188



>ref|XP_004230392.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Solanum lycopersicum]
Length=951

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 155/189 (82%), Gaps = 5/189 (3%)
 Frame = +1

Query  73   IQLLLVPLFIQFLGIV----AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            +QL++  L I  + ++    A TD+ DYV +++L++ W+NVPP+W +GSDPC D WEG+ 
Sbjct  7    VQLIIFCLLIISMQVLIQLEASTDSGDYVVLESLKEEWENVPPTW-DGSDPCDDPWEGID  65

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            CN SRV+S+ LSS++L GELSGDIE LSELQILDLSYNK LTGSLP+ IGNLK L  LIL
Sbjct  66   CNNSRVISIKLSSINLKGELSGDIEGLSELQILDLSYNKGLTGSLPQSIGNLKSLSILIL  125

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            VGCGF GLIP++IGSLS+L++LSLNLN FIGPIP S+G LS+L WLDLADN+L+G +P+S
Sbjct  126  VGCGFSGLIPNTIGSLSQLEFLSLNLNNFIGPIPASVGNLSKLRWLDLADNKLSGPLPIS  185

Query  601  DGNTPGLDM  627
             G+TPGLDM
Sbjct  186  RGSTPGLDM  194



>ref|XP_009784887.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Nicotiana sylvestris]
Length=625

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = +1

Query  145  VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELS  324
             A+++L+D W+NVPP+WA G+DPCG  WEG+GC  SRV+S+TLSSM L+G+LSGDI+ LS
Sbjct  8    AALQSLKDSWQNVPPNWA-GADPCGSQWEGIGCRNSRVISITLSSMSLSGQLSGDIQGLS  66

Query  325  ELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnk  504
            ELQ LDLSYNK+LTGSLP+ IG L KL NLILVGCGF G IPDSIGSL++L +LSLN N 
Sbjct  67   ELQTLDLSYNKELTGSLPQSIGKLTKLSNLILVGCGFSGPIPDSIGSLTQLVFLSLNSNN  126

Query  505  FIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            FIG IP ++G LS+LYWLDLADN+LTG++PVS G++PGLDM
Sbjct  127  FIGRIPATIGYLSKLYWLDLADNKLTGTLPVSSGSSPGLDM  167



>ref|XP_007023744.1| Leucine-rich repeat protein kinase family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY26366.1| Leucine-rich repeat protein kinase family protein, putative isoform 
2 [Theobroma cacao]
Length=909

 Score =   217 bits (553),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = +1

Query  82   LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVV  261
            LL+ +F+Q   I A TD  D  A+K+L D W+  PPSW  G DPCGD W G+GCN SRV 
Sbjct  8    LLLVVFLQIYIIAATTDAGDSAALKSLMDEWEKAPPSWV-GGDPCGDSWVGIGCNDSRVT  66

Query  262  SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG  441
            S+TL SM L G LSGDI  LSELQ +DLSYN  LTGSLP  IGNLKKL NLILVGCGF G
Sbjct  67   SVTLPSMKLVGRLSGDISTLSELQQVDLSYNNGLTGSLPTSIGNLKKLTNLILVGCGFNG  126

Query  442  LIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL  621
             IPD+IGSLS+L++LSLN N F G IPPS+G LS LYWLDLADNQL G IPVS G+TPGL
Sbjct  127  PIPDAIGSLSQLRFLSLNSNGFTGRIPPSIGNLSNLYWLDLADNQLEGPIPVSSGSTPGL  186

Query  622  DM  627
            DM
Sbjct  187  DM  188



>gb|EPS63997.1| hypothetical protein M569_10784, partial [Genlisea aurea]
Length=390

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = +1

Query  94   LFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTL  273
            + I++  + A+T+ ND+ A+ AL+  W NVPP+W+ GSDPCG  W+G+ C  +RVVS+TL
Sbjct  7    IVIEYFVVTAWTNPNDFAALLALKSTWNNVPPNWS-GSDPCGSGWDGISCINNRVVSITL  65

Query  274  SSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPD  453
            +S++L G+LS DI  LSELQILDLSYN  +TG LP  IGNL KL +LILVGCGF G+IP 
Sbjct  66   ASINLNGQLSSDITALSELQILDLSYNPGMTGPLPTTIGNLVKLTSLILVGCGFSGVIPS  125

Query  454  SIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            SIGSL +L YLSLN N FIG IPPS+G LS LYWLDLADN+L+GSIPVS G+ PGLDM
Sbjct  126  SIGSLQQLVYLSLNSNNFIGEIPPSVGMLSNLYWLDLADNKLSGSIPVSSGSIPGLDM  183



>ref|XP_007023745.1| Leucine-rich repeat protein kinase family protein isoform 3 [Theobroma 
cacao]
 gb|EOY26367.1| Leucine-rich repeat protein kinase family protein isoform 3 [Theobroma 
cacao]
Length=758

 Score =   216 bits (550),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = +1

Query  82   LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVV  261
            LL+ +F+Q   I A TD  D  A+K+L D W+  PPSW  G DPCGD W G+GCN SRV 
Sbjct  8    LLLVVFLQIYIIAATTDAGDSAALKSLMDEWEKAPPSWV-GGDPCGDSWVGIGCNDSRVT  66

Query  262  SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG  441
            S+TL SM L G LSGDI  LSELQ +DLSYN  LTGSLP  IGNLKKL NLILVGCGF G
Sbjct  67   SVTLPSMKLVGRLSGDISTLSELQQVDLSYNNGLTGSLPTSIGNLKKLTNLILVGCGFNG  126

Query  442  LIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL  621
             IPD+IGSLS+L++LSLN N F G IPPS+G LS LYWLDLADNQL G IPVS G+TPGL
Sbjct  127  PIPDAIGSLSQLRFLSLNSNGFTGRIPPSIGNLSNLYWLDLADNQLEGPIPVSSGSTPGL  186

Query  622  DM  627
            DM
Sbjct  187  DM  188



>ref|XP_007023743.1| Leucine-rich repeat protein kinase family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY26365.1| Leucine-rich repeat protein kinase family protein, putative isoform 
1 [Theobroma cacao]
Length=955

 Score =   217 bits (553),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = +1

Query  82   LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVV  261
            LL+ +F+Q   I A TD  D  A+K+L D W+  PPSW  G DPCGD W G+GCN SRV 
Sbjct  8    LLLVVFLQIYIIAATTDAGDSAALKSLMDEWEKAPPSWV-GGDPCGDSWVGIGCNDSRVT  66

Query  262  SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG  441
            S+TL SM L G LSGDI  LSELQ +DLSYN  LTGSLP  IGNLKKL NLILVGCGF G
Sbjct  67   SVTLPSMKLVGRLSGDISTLSELQQVDLSYNNGLTGSLPTSIGNLKKLTNLILVGCGFNG  126

Query  442  LIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL  621
             IPD+IGSLS+L++LSLN N F G IPPS+G LS LYWLDLADNQL G IPVS G+TPGL
Sbjct  127  PIPDAIGSLSQLRFLSLNSNGFTGRIPPSIGNLSNLYWLDLADNQLEGPIPVSSGSTPGL  186

Query  622  DM  627
            DM
Sbjct  187  DM  188



>ref|XP_011092239.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Sesamum indicum]
Length=953

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 150/186 (81%), Gaps = 1/186 (1%)
 Frame = +1

Query  70   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  249
            RI L L+   +Q  GI A+T  +D+VA+K+L+D W+NVPP+W +G DPCG +W+G+ C+ 
Sbjct  5    RIHLCLLVALVQVFGIAAWTYTDDFVALKSLKDEWENVPPNW-DGDDPCGHNWDGISCSD  63

Query  250  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  429
            +RV+S+TL+S++L+G LS DI+ LS L+ LDLSYNK +TG LP  IGNL++L +LILVGC
Sbjct  64   TRVISITLASINLSGHLSSDIKGLSALETLDLSYNKGMTGPLPSSIGNLQELSSLILVGC  123

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  609
            GF G IP SIGSL +L YLSLN NKF+G IPPS+G LS LYWLDLADN+L+G+IPVS G+
Sbjct  124  GFSGPIPSSIGSLQQLVYLSLNSNKFVGEIPPSIGNLSNLYWLDLADNKLSGTIPVSKGS  183

Query  610  TPGLDM  627
            TPGLDM
Sbjct  184  TPGLDM  189



>ref|XP_003594434.1| Somatic embryogenesis receptor-like kinase [Medicago truncatula]
Length=986

 Score =   217 bits (553),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 137/171 (80%), Gaps = 0/171 (0%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            +V  T N+DY+A+  L+  WKNVPPSW +  DPCGDHWEG+ C+ SRV++++LSSMDL+G
Sbjct  20   VVTKTSNDDYLALSTLKYEWKNVPPSWEDSEDPCGDHWEGIECSNSRVITISLSSMDLSG  79

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            +LS +I  LSELQIL LSYNKDLTG LP EIGNLKKL NL L+ CGF G IPD+IG+L +
Sbjct  80   QLSSEIGSLSELQILVLSYNKDLTGPLPAEIGNLKKLTNLQLINCGFTGPIPDTIGNLQR  139

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            L +LSLN N+F G IPPS+G LS + WLDLA+NQL G IPVS+G TPGLDM
Sbjct  140  LVFLSLNSNRFSGRIPPSIGNLSNINWLDLAENQLEGPIPVSNGTTPGLDM  190



>gb|AES64685.2| LRR receptor-like kinase [Medicago truncatula]
Length=954

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 137/171 (80%), Gaps = 0/171 (0%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            +V  T N+DY+A+  L+  WKNVPPSW +  DPCGDHWEG+ C+ SRV++++LSSMDL+G
Sbjct  20   VVTKTSNDDYLALSTLKYEWKNVPPSWEDSEDPCGDHWEGIECSNSRVITISLSSMDLSG  79

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            +LS +I  LSELQIL LSYNKDLTG LP EIGNLKKL NL L+ CGF G IPD+IG+L +
Sbjct  80   QLSSEIGSLSELQILVLSYNKDLTGPLPAEIGNLKKLTNLQLINCGFTGPIPDTIGNLQR  139

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            L +LSLN N+F G IPPS+G LS + WLDLA+NQL G IPVS+G TPGLDM
Sbjct  140  LVFLSLNSNRFSGRIPPSIGNLSNINWLDLAENQLEGPIPVSNGTTPGLDM  190



>gb|KHG19770.1| hypothetical protein F383_03980 [Gossypium arboreum]
Length=826

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 143/185 (77%), Gaps = 1/185 (1%)
 Frame = +1

Query  73   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  252
            I +LL+   +Q     A TD  DY A+++L D W+N+PPSW  G+DPCGD W G+ C GS
Sbjct  5    IWVLLLAFSVQIYITTATTDGRDYAALRSLTDEWQNLPPSWT-GADPCGDSWVGIECTGS  63

Query  253  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  432
            RV S+TL +M+L GELSGDI  LSELQ LDLS+N++LTGSLP  IGNLKKL NLILVGCG
Sbjct  64   RVTSITLPNMNLVGELSGDIAMLSELQQLDLSFNRELTGSLPGSIGNLKKLKNLILVGCG  123

Query  433  FFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT  612
            F G IP +IGSL +L++LSLN N F G IPP++G LS LYWLD+ADNQL G IPVS+G+T
Sbjct  124  FIGQIPYTIGSLPQLRFLSLNTNGFTGHIPPTIGNLSNLYWLDMADNQLEGPIPVSNGST  183

Query  613  PGLDM  627
            PGLD+
Sbjct  184  PGLDL  188



>gb|KDO40686.1| hypothetical protein CISIN_1g002189mg [Citrus sinensis]
Length=955

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 144/187 (77%), Gaps = 2/187 (1%)
 Frame = +1

Query  70   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDG-WKNVPPSWAEGSDPCGDHWEGVGCN  246
            + ++ L+ +++QFL I A T++ND+V +KAL+D  W+N PP+W + +DPCGD+WEG+GC 
Sbjct  4    KRKVFLLSVYLQFLIIAAVTNDNDFVILKALKDDIWENEPPNW-KNNDPCGDNWEGIGCT  62

Query  247  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  426
             SRV S+TLS M L G+LSGDI  L+EL  LDLS NKDL G LP  IGNLKKL NL+LVG
Sbjct  63   NSRVTSITLSGMGLKGQLSGDITGLTELHTLDLSNNKDLRGPLPTTIGNLKKLSNLMLVG  122

Query  427  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  606
            C F G IPDSIGSL +L  LSLN N F G +PPS+G LS LYWLDL DN+L G IPVSDG
Sbjct  123  CSFSGPIPDSIGSLQELVLLSLNSNGFSGRVPPSIGNLSNLYWLDLTDNKLEGEIPVSDG  182

Query  607  NTPGLDM  627
            N+PGLDM
Sbjct  183  NSPGLDM  189



>ref|XP_006431373.1| hypothetical protein CICLE_v10000176mg [Citrus clementina]
 gb|ESR44613.1| hypothetical protein CICLE_v10000176mg [Citrus clementina]
Length=955

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 144/187 (77%), Gaps = 2/187 (1%)
 Frame = +1

Query  70   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDG-WKNVPPSWAEGSDPCGDHWEGVGCN  246
            + ++ L+ +++QFL I A T++ND+V +KAL+D  W+N PP+W + +DPCGD+WEG+GC 
Sbjct  4    KRKVFLLSVYLQFLIIAAVTNDNDFVILKALKDDIWENEPPNW-KNNDPCGDNWEGIGCT  62

Query  247  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  426
             SRV S+TLS M L G+LSGDI  L+EL  LDLS NKDL G LP  IGNLKKL NL+LVG
Sbjct  63   NSRVTSITLSGMGLKGQLSGDITGLTELHTLDLSNNKDLRGPLPTTIGNLKKLSNLMLVG  122

Query  427  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  606
            C F G IPDSIGSL +L  LSLN N F G +PPS+G LS LYWLDL DN+L G IPVSDG
Sbjct  123  CSFSGPIPDSIGSLQELVLLSLNSNGFSGRVPPSIGNLSNLYWLDLTDNKLEGEIPVSDG  182

Query  607  NTPGLDM  627
            N+PGLDM
Sbjct  183  NSPGLDM  189



>ref|XP_006470792.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Citrus sinensis]
Length=955

 Score =   215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 144/187 (77%), Gaps = 2/187 (1%)
 Frame = +1

Query  70   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDG-WKNVPPSWAEGSDPCGDHWEGVGCN  246
            + ++ L+ +++QFL I A T++ND+V +KAL+D  W+N PP+W + +DPCGD+WEG+GC 
Sbjct  4    KRKVFLLSVYLQFLIIAAVTNDNDFVILKALKDDIWENEPPNW-KNNDPCGDNWEGIGCT  62

Query  247  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  426
             SRV S+TLS M L G+LSGDI  L+EL  LDLS N DL G LP  IGNLKKL NL+LVG
Sbjct  63   NSRVTSITLSGMGLKGQLSGDITGLTELHTLDLSNNNDLRGPLPTTIGNLKKLSNLMLVG  122

Query  427  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  606
            C F G IPDSIGSL +L  LSLN N F G IPPS+G LS+LYWLDL DN+L G IPVSDG
Sbjct  123  CSFSGPIPDSIGSLQELVLLSLNSNGFSGRIPPSIGNLSKLYWLDLTDNKLEGEIPVSDG  182

Query  607  NTPGLDM  627
            N+PGLDM
Sbjct  183  NSPGLDM  189



>gb|KJB68018.1| hypothetical protein B456_010G221900 [Gossypium raimondii]
Length=710

 Score =   213 bits (541),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 142/185 (77%), Gaps = 1/185 (1%)
 Frame = +1

Query  73   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  252
            I +LL+   +Q     A TD  DY A+++L D W+N+PP+W E +DPCGD W G+ C GS
Sbjct  14   IWVLLLAFSVQIYITTATTDGRDYAALRSLTDEWQNLPPTWTE-ADPCGDSWVGIECTGS  72

Query  253  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  432
            RV S+TL +M+L GELSGDI  LSELQ LDLS+N++LTG LP  IGNLKKL NLILVGCG
Sbjct  73   RVTSITLPNMNLVGELSGDIAMLSELQQLDLSFNRELTGPLPGSIGNLKKLKNLILVGCG  132

Query  433  FFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT  612
            F G IP +IGSL +L++LSLN N F G IPP++G LS LYWLD+ADNQL G IPVS+G+T
Sbjct  133  FIGQIPYTIGSLPQLRFLSLNTNGFTGHIPPTIGNLSNLYWLDMADNQLEGPIPVSNGST  192

Query  613  PGLDM  627
            PGLD+
Sbjct  193  PGLDL  197



>gb|KJB68015.1| hypothetical protein B456_010G221900 [Gossypium raimondii]
 gb|KJB68017.1| hypothetical protein B456_010G221900 [Gossypium raimondii]
Length=736

 Score =   213 bits (542),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 142/185 (77%), Gaps = 1/185 (1%)
 Frame = +1

Query  73   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  252
            I +LL+   +Q     A TD  DY A+++L D W+N+PP+W E +DPCGD W G+ C GS
Sbjct  14   IWVLLLAFSVQIYITTATTDGRDYAALRSLTDEWQNLPPTWTE-ADPCGDSWVGIECTGS  72

Query  253  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  432
            RV S+TL +M+L GELSGDI  LSELQ LDLS+N++LTG LP  IGNLKKL NLILVGCG
Sbjct  73   RVTSITLPNMNLVGELSGDIAMLSELQQLDLSFNRELTGPLPGSIGNLKKLKNLILVGCG  132

Query  433  FFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT  612
            F G IP +IGSL +L++LSLN N F G IPP++G LS LYWLD+ADNQL G IPVS+G+T
Sbjct  133  FIGQIPYTIGSLPQLRFLSLNTNGFTGHIPPTIGNLSNLYWLDMADNQLEGPIPVSNGST  192

Query  613  PGLDM  627
            PGLD+
Sbjct  193  PGLDL  197



>ref|XP_002519381.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF42998.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=960

 Score =   214 bits (545),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 141/186 (76%), Gaps = 1/186 (1%)
 Frame = +1

Query  70   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  249
            RI L L+ + +Q   I A T+  D  A+ AL+D W+N PPSW +G+DPCGD WEG+ C  
Sbjct  11   RILLFLLFVSLQICNIAAVTNTADSSALNALKDIWQNTPPSW-KGADPCGDKWEGIECTN  69

Query  250  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  429
             RV S+TLSS+ +TG+LSGDI  L ELQILDLSYNK L G+LP  IGNLKKL NLILVGC
Sbjct  70   LRVTSITLSSIGITGQLSGDISNLQELQILDLSYNKGLEGTLPESIGNLKKLTNLILVGC  129

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  609
            GF G IP+SIGSL +L +LSLN N F G IPPS+G L++LYWLDLADN+L G IPVS G 
Sbjct  130  GFSGPIPNSIGSLQQLVFLSLNSNGFSGGIPPSIGNLAKLYWLDLADNKLEGRIPVSTGT  189

Query  610  TPGLDM  627
            TPGL+M
Sbjct  190  TPGLNM  195



>gb|KJB68014.1| hypothetical protein B456_010G221900 [Gossypium raimondii]
Length=947

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 142/185 (77%), Gaps = 1/185 (1%)
 Frame = +1

Query  73   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  252
            I +LL+   +Q     A TD  DY A+++L D W+N+PP+W E +DPCGD W G+ C GS
Sbjct  14   IWVLLLAFSVQIYITTATTDGRDYAALRSLTDEWQNLPPTWTE-ADPCGDSWVGIECTGS  72

Query  253  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  432
            RV S+TL +M+L GELSGDI  LSELQ LDLS+N++LTG LP  IGNLKKL NLILVGCG
Sbjct  73   RVTSITLPNMNLVGELSGDIAMLSELQQLDLSFNRELTGPLPGSIGNLKKLKNLILVGCG  132

Query  433  FFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT  612
            F G IP +IGSL +L++LSLN N F G IPP++G LS LYWLD+ADNQL G IPVS+G+T
Sbjct  133  FIGQIPYTIGSLPQLRFLSLNTNGFTGHIPPTIGNLSNLYWLDMADNQLEGPIPVSNGST  192

Query  613  PGLDM  627
            PGLD+
Sbjct  193  PGLDL  197



>ref|XP_011028448.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Populus euphratica]
Length=888

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 142/189 (75%), Gaps = 1/189 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            M  RI + LV   IQ     A T+N+D+ A+KAL+D W+NVPPSW  GSDPCG  W+G+ 
Sbjct  1    MGSRILVFLVVALIQVCTTPAVTNNDDFNALKALKDIWENVPPSWV-GSDPCGSRWDGIL  59

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            C  SRV S+TL+SM L G LSGDI  LSELQILDLSYN +L+G LP  IG+LKKL +LIL
Sbjct  60   CTNSRVTSITLASMGLKGTLSGDISNLSELQILDLSYNPELSGPLPPAIGDLKKLTSLIL  119

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            V C F G IPD+IGSL +L YLSLN N F G IPPSLG L +LYWLDLADN+LTG+IPVS
Sbjct  120  VSCRFSGPIPDTIGSLPQLTYLSLNSNGFTGSIPPSLGNLDKLYWLDLADNRLTGNIPVS  179

Query  601  DGNTPGLDM  627
             G TPGLD+
Sbjct  180  TGTTPGLDL  188



>ref|XP_011028446.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Populus euphratica]
Length=958

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 142/189 (75%), Gaps = 1/189 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            M  RI + LV   IQ     A T+N+D+ A+KAL+D W+NVPPSW  GSDPCG  W+G+ 
Sbjct  1    MGSRILVFLVVALIQVCTTPAVTNNDDFNALKALKDIWENVPPSWV-GSDPCGSRWDGIL  59

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            C  SRV S+TL+SM L G LSGDI  LSELQILDLSYN +L+G LP  IG+LKKL +LIL
Sbjct  60   CTNSRVTSITLASMGLKGTLSGDISNLSELQILDLSYNPELSGPLPPAIGDLKKLTSLIL  119

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            V C F G IPD+IGSL +L YLSLN N F G IPPSLG L +LYWLDLADN+LTG+IPVS
Sbjct  120  VSCRFSGPIPDTIGSLPQLTYLSLNSNGFTGSIPPSLGNLDKLYWLDLADNRLTGNIPVS  179

Query  601  DGNTPGLDM  627
             G TPGLD+
Sbjct  180  TGTTPGLDL  188



>ref|XP_010657900.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like protein kinase At5g49770 [Vitis vinifera]
Length=980

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 147/186 (79%), Gaps = 4/186 (2%)
 Frame = +1

Query  76   QLLLVPLFIQFLGIVAF---TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  246
            +L+LV L I F+ I A    T+ +D  A+ AL+D W+N PPSW  G DPCG  WEG+GC 
Sbjct  4    RLILVSLLIVFIQISATWARTNTDDATALVALKDLWENYPPSWV-GFDPCGSSWEGIGCY  62

Query  247  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  426
              RV+S+ L+SM L G LSGD+++LSELQILDLSYNK+LTG++P  IG+LKKL NLILVG
Sbjct  63   NQRVISIILTSMGLKGGLSGDLDQLSELQILDLSYNKNLTGNIPASIGSLKKLTNLILVG  122

Query  427  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  606
            C F G IPD+IGSL++L +LSLN N F G IPPS+G LS+LYWLDLADNQLTG+IP+S+G
Sbjct  123  CSFSGPIPDTIGSLTELVFLSLNSNSFSGGIPPSIGNLSKLYWLDLADNQLTGTIPISNG  182

Query  607  NTPGLD  624
            +TPGLD
Sbjct  183  STPGLD  188



>ref|XP_010682082.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Beta vulgaris subsp. vulgaris]
Length=966

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 146/190 (77%), Gaps = 0/190 (0%)
 Frame = +1

Query  58   TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  237
            +M  +I   L+ + +Q   I + TD+ND VA+ +L+  W+NVPPSW    DPCG+HWEG+
Sbjct  19   SMSLKIAFCLLLICVQLSYITSDTDSNDAVALSSLKALWENVPPSWNGFLDPCGNHWEGI  78

Query  238  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  417
             CN SRV+S+TLSSM L G+LSGDI++LSELQ LDLSYNK LT SLP  IG L KL NLI
Sbjct  79   VCNNSRVISITLSSMQLEGKLSGDIQQLSELQTLDLSYNKGLTSSLPEAIGKLAKLTNLI  138

Query  418  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  597
            L+ C F G IPDSIGSLS+L++LSLN N F G IP S+G LS+LYWLDLA+N+LTG++PV
Sbjct  139  LIDCNFIGKIPDSIGSLSELRFLSLNSNGFSGTIPRSIGSLSKLYWLDLAENKLTGTLPV  198

Query  598  SDGNTPGLDM  627
            S+G  PGLD+
Sbjct  199  SNGTEPGLDL  208



>ref|XP_010252241.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Nelumbo nucifera]
Length=955

 Score =   212 bits (540),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            M  +IQ  L+ +  Q     A T++ND  A+ ++R  WKN P +W EGSDPCG  W G+ 
Sbjct  1    MDKKIQACLLVVLFQISFSGAQTNSNDVAALNSIRLLWKNTPSNW-EGSDPCGGGWVGIT  59

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            CN SRVVS+TLSSM L G+LSGDI+ LSELQ LDLSYNK L GSLP  IG+L KL NLIL
Sbjct  60   CNNSRVVSITLSSMGLKGQLSGDIQSLSELQALDLSYNKGLNGSLPVSIGSLTKLSNLIL  119

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            VGC F G IPD+IGSL +L +LSLN N F G IPPS+G LS+LYWLDLADN+LTG+IPVS
Sbjct  120  VGCSFSGPIPDTIGSLKQLAFLSLNSNSFTGEIPPSIGNLSKLYWLDLADNKLTGTIPVS  179

Query  601  DGNTPGLDM  627
            +G+TPGLDM
Sbjct  180  NGSTPGLDM  188



>gb|KCW62551.1| hypothetical protein EUGRSUZ_G00043, partial [Eucalyptus grandis]
Length=945

 Score =   211 bits (538),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 134/169 (79%), Gaps = 1/169 (1%)
 Frame = +1

Query  121  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  300
            A T+  D+ AIK L   W+N PP+W  G DPCG+ W+G+GC  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFSAIKGLMSDWQNTPPNWV-GIDPCGNGWDGIGCKNSRITSITLSSMGLTGSL  79

Query  301  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  480
             GDI +LSELQILDLSYNKDLTGSLP +IGNL KL NL+LVGCG +G IPDSIGSL  L 
Sbjct  80   PGDIGQLSELQILDLSYNKDLTGSLPVQIGNLVKLTNLLLVGCGLYGPIPDSIGSLQNLV  139

Query  481  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +LSLN N F G IPP++G LS LYWLDLADNQLTGSIPVS+G+ PGLDM
Sbjct  140  FLSLNSNGFSGLIPPTIGNLSRLYWLDLADNQLTGSIPVSNGSNPGLDM  188



>ref|XP_006385116.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|ERP62913.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=958

 Score =   211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            M  RI + LV   IQ     A T+N+D+ A+KAL+D W+NVPP+W  G+DPCG  W+G+ 
Sbjct  1    MGSRILVFLVVALIQVCTTPAVTNNDDFNALKALKDVWENVPPTWV-GADPCGSRWDGIL  59

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            C  SRV S+TL+SM L G LSGDI  LSELQILDLSYN +L+G LP  IGNLK L +LIL
Sbjct  60   CTNSRVTSITLASMRLKGTLSGDISNLSELQILDLSYNTELSGPLPPAIGNLKMLTSLIL  119

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            VGC F G +PDSIGSL +L YLSLN N F G IPPSLG L  LYWLDLADN+LTG+IPVS
Sbjct  120  VGCRFSGPVPDSIGSLPRLTYLSLNSNGFTGTIPPSLGNLDNLYWLDLADNRLTGTIPVS  179

Query  601  DGNTPGLDM  627
               TPGLD+
Sbjct  180  TETTPGLDL  188



>ref|XP_010065204.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=955

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 134/169 (79%), Gaps = 1/169 (1%)
 Frame = +1

Query  121  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  300
            A T+  D+ AIK L   W+N PP+W  G DPCG+ W+G+GC  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFSAIKGLMSDWQNTPPNWV-GIDPCGNGWDGIGCKNSRITSITLSSMGLTGSL  79

Query  301  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  480
             GDI +LSELQILDLSYNKDLTGSLP +IGNL KL NL+LVGCG +G IPDSIGSL  L 
Sbjct  80   PGDIGQLSELQILDLSYNKDLTGSLPVQIGNLVKLTNLLLVGCGLYGPIPDSIGSLQNLV  139

Query  481  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +LSLN N F G IPP++G LS LYWLDLADNQLTGSIPVS+G+ PGLDM
Sbjct  140  FLSLNSNGFSGLIPPTIGNLSRLYWLDLADNQLTGSIPVSNGSNPGLDM  188



>ref|XP_004486417.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Cicer arietinum]
Length=953

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 140/187 (75%), Gaps = 1/187 (1%)
 Frame = +1

Query  70   RIQLLLVPLF-IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  246
            R+ + L  LF   F+ +V  T N DY+A+  L+  WKN PPSW    DPCGDHWEG+ C 
Sbjct  4    RVLVFLHLLFSYLFVVVVTKTSNEDYLALLTLKYEWKNTPPSWEGSEDPCGDHWEGIECI  63

Query  247  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  426
             SRV +++L+SMDL+G+LS DI  LSELQIL LSYNK+LTG L  EIGNLKKL NL L+ 
Sbjct  64   NSRVTTISLASMDLSGQLSADIGLLSELQILVLSYNKNLTGPLHAEIGNLKKLTNLQLIN  123

Query  427  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  606
            CGF G IPD+IG+L +L +LSLN N+F G IPP++G LS +YWLDLA+NQL G IP+S+G
Sbjct  124  CGFIGPIPDTIGNLQRLVFLSLNSNRFSGKIPPAIGNLSSIYWLDLAENQLEGRIPISNG  183

Query  607  NTPGLDM  627
             TPGLDM
Sbjct  184  TTPGLDM  190



>ref|XP_006385112.1| hypothetical protein POPTR_0004s24030g [Populus trichocarpa]
 gb|ERP62909.1| hypothetical protein POPTR_0004s24030g [Populus trichocarpa]
Length=959

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 142/190 (75%), Gaps = 2/190 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  237
            M  RI + LV   IQ      A T+N+D+ A+KAL+D W NVPP+W  G+DPCG  W+G+
Sbjct  1    MGSRILVFLVVALIQVCTTTPAVTNNDDFNALKALKDVWDNVPPTWV-GADPCGSRWDGI  59

Query  238  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  417
             C  SRV S+TL+SM L G LSGDI  LSELQILDLSYN +LTGSLP  IG+LKKL NLI
Sbjct  60   VCTNSRVTSITLASMGLKGTLSGDISLLSELQILDLSYNTELTGSLPLAIGDLKKLTNLI  119

Query  418  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  597
            LV C F G IPD+IGSLS+L  LSLN N+F G IPPSLG L +L+WLDLADN LTG+IPV
Sbjct  120  LVRCRFSGPIPDAIGSLSQLTDLSLNSNRFSGSIPPSLGNLDKLFWLDLADNMLTGTIPV  179

Query  598  SDGNTPGLDM  627
            S G TPGLD+
Sbjct  180  STGTTPGLDL  189



>emb|CBI29612.3| unnamed protein product [Vitis vinifera]
Length=2030

 Score =   212 bits (540),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 147/186 (79%), Gaps = 4/186 (2%)
 Frame = +1

Query  76   QLLLVPLFIQFLGIVAF---TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  246
            +L+LV L I F+ I A    T+ +D  A+ AL+D W+N PPSW  G DPCG  WEG+GC 
Sbjct  4    RLILVSLLIVFIQISATWARTNTDDATALVALKDLWENYPPSWV-GFDPCGSSWEGIGCY  62

Query  247  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  426
              RV+S+ L+SM L G LSGD+++LSELQILDLSYNK+LTG++P  IG+LKKL NLILVG
Sbjct  63   NQRVISIILTSMGLKGGLSGDLDQLSELQILDLSYNKNLTGNIPASIGSLKKLTNLILVG  122

Query  427  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  606
            C F G IPD+IGSL++L +LSLN N F G IPPS+G LS+LYWLDLADNQLTG+IP+S+G
Sbjct  123  CSFSGPIPDTIGSLTELVFLSLNSNSFSGGIPPSIGNLSKLYWLDLADNQLTGTIPISNG  182

Query  607  NTPGLD  624
            +TPGLD
Sbjct  183  STPGLD  188


 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 129/178 (72%), Gaps = 3/178 (2%)
 Frame = +1

Query  94    LFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTL  273
             LF   L +    D  D  A  AL+   KN+P +W  G+DPC + WEG+GC+  RV+S+TL
Sbjct  1099  LFESSLSLAHIYDFGD--ATTALKSLLKNLPFTWV-GADPCVNGWEGIGCSNGRVISITL  1155

Query  274   SSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPD  453
             +SMDL GELS D + LSEL+ILDLSYNK LTG++P  IG+LK L NLIL+GC F G IPD
Sbjct  1156  ASMDLKGELSEDFQGLSELKILDLSYNKGLTGNIPASIGSLKSLTNLILMGCSFSGQIPD  1215

Query  454   SIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
             +IGSL+ L  LSLN N F G IPPS+G L  L WLD+ +NQ+TG+IP+S+G TPGLDM
Sbjct  1216  TIGSLTNLVVLSLNSNSFSGVIPPSIGNLYNLNWLDITENQITGTIPISNGGTPGLDM  1273



>gb|KJB68016.1| hypothetical protein B456_010G221900 [Gossypium raimondii]
Length=943

 Score =   209 bits (532),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 135/185 (73%), Gaps = 5/185 (3%)
 Frame = +1

Query  73   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  252
            I +LL+   +Q     A TD  DY A+++L D W+N+PP+W E +DPCGD W G+ C GS
Sbjct  14   IWVLLLAFSVQIYITTATTDGRDYAALRSLTDEWQNLPPTWTE-ADPCGDSWVGIECTGS  72

Query  253  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  432
            RV S+TL +M+L GELSGDI  LSELQ LDLS+N++LTG LP  IGNLKKL NLILVGCG
Sbjct  73   RVTSITLPNMNLVGELSGDIAMLSELQQLDLSFNRELTGPLPGSIGNLKKLKNLILVGCG  132

Query  433  FFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT  612
            F G IP +IG        SLN N F G IPP++G LS LYWLD+ADNQL G IPVS+G+T
Sbjct  133  FIGQIPYTIG----SLPQSLNTNGFTGHIPPTIGNLSNLYWLDMADNQLEGPIPVSNGST  188

Query  613  PGLDM  627
            PGLD+
Sbjct  189  PGLDL  193



>ref|XP_006358481.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=947

 Score =   209 bits (532),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 152/189 (80%), Gaps = 9/189 (5%)
 Frame = +1

Query  73   IQLLLVPLFIQFLGIV----AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            IQL++  L I  + ++    A T++ DYV ++ L++ W+N+PPSW +GSDPC D WEG+ 
Sbjct  7    IQLIIFCLLIISMQVLVQLGASTNSGDYVVLEPLKEEWENIPPSW-DGSDPCNDPWEGID  65

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            CN SRV+S+ LSS++L GELSGDIE LSELQILDLSYNK LTGSLP+ IGNLK L  LIL
Sbjct  66   CNNSRVISIKLSSINLKGELSGDIEGLSELQILDLSYNKGLTGSLPQSIGNLKSLSILIL  125

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            VGCGF GLIP++IGSLS+L+YLSLNLN FIGPIP S+G LS+L+WLDLADN+L+G +PVS
Sbjct  126  VGCGFSGLIPNTIGSLSQLEYLSLNLNNFIGPIPASVGNLSKLHWLDLADNKLSGPLPVS  185

Query  601  DGNTPGLDM  627
                PGLDM
Sbjct  186  ----PGLDM  190



>gb|KEH37006.1| LRR receptor-like kinase [Medicago truncatula]
Length=942

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +1

Query  142  YVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEEL  321
            Y+A+  L+  WKNVPPSW +  DPCGDHWEG+ C+ SRV++++LSSMDL+G+LS +I  L
Sbjct  17   YLALSTLKYEWKNVPPSWEDSEDPCGDHWEGIECSNSRVITISLSSMDLSGQLSSEIGSL  76

Query  322  SELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnln  501
            SELQIL LSYNKDLTG LP EIGNLKKL NL L+ CGF G IPD+IG+L +L +LSLN N
Sbjct  77   SELQILVLSYNKDLTGPLPAEIGNLKKLTNLQLINCGFTGPIPDTIGNLQRLVFLSLNSN  136

Query  502  kFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +F G IPPS+G LS + WLDLA+NQL G IPVS+G TPGLDM
Sbjct  137  RFSGRIPPSIGNLSNINWLDLAENQLEGPIPVSNGTTPGLDM  178



>ref|XP_011092237.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Sesamum indicum]
Length=943

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 145/186 (78%), Gaps = 2/186 (1%)
 Frame = +1

Query  70   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  249
            RI   L+ + +Q  G  A T+ +D+VA++AL+D WKN+PPSW +G DPCG+ W+G+ C+ 
Sbjct  5    RILCSLLVVLVQVFGTAARTNTDDFVALEALKDVWKNLPPSW-DGDDPCGNDWDGISCSD  63

Query  250  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  429
             RV S++L SM+L G+LS DI++LS L ILDLSYN +L G+LP  IGNLKKL  LILVGC
Sbjct  64   DRVTSISLGSMNLNGQLSSDIQKLSALVILDLSYN-NLNGALPTSIGNLKKLTTLILVGC  122

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  609
            G  G IPDSIGSL +L+ LSLN N F+GPIPPS+G LS+LY LDL DN+L+G+IPVS G+
Sbjct  123  GLSGRIPDSIGSLPELQLLSLNSNNFVGPIPPSIGNLSKLYLLDLTDNKLSGTIPVSKGS  182

Query  610  TPGLDM  627
            TPGLDM
Sbjct  183  TPGLDM  188



>ref|XP_006358480.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=960

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 146/195 (75%), Gaps = 2/195 (1%)
 Frame = +1

Query  43   MVI**TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGD  222
            MV+   M+ RI +  + + IQ L + A T+  D  A+K+L+D W   P +W  G DPCG 
Sbjct  1    MVVSMAMMLRIFVSFLVVLIQVLSVAARTNPVDSAALKSLKDSWYG-PSNWT-GEDPCGS  58

Query  223  HWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK  402
             WEGVGC  SRV+S+TLSSMDL G+LSGD++ LSEL+ LDLSYNKDLTG L + IG L K
Sbjct  59   SWEGVGCRNSRVISITLSSMDLNGQLSGDVQGLSELETLDLSYNKDLTGYLSQSIGKLTK  118

Query  403  LYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLT  582
            L NLILVGCGF G IPDSIGSL++L +LSLN NKF G IP ++G L+ELYWLDL+DNQ+ 
Sbjct  119  LSNLILVGCGFSGPIPDSIGSLTQLFFLSLNSNKFTGGIPATIGYLTELYWLDLSDNQIE  178

Query  583  GSIPVSDGNTPGLDM  627
            G+IPVS G+ PGLDM
Sbjct  179  GNIPVSSGSNPGLDM  193



>ref|XP_010065205.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=955

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = +1

Query  121  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  300
            A T+  D+ AI+ L   W++ PP+W  G+DPCG+ W+G+GC  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFSAIEGLMSYWQHTPPNWV-GTDPCGNGWDGIGCTNSRITSITLSSMGLTGSL  79

Query  301  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  480
             GDI +LSEL+ILDLSYN+ LTGSLP +IGNL KL NLILVGCGF G IPDSIGSL  L 
Sbjct  80   PGDIVQLSELRILDLSYNRGLTGSLPAQIGNLMKLTNLILVGCGFSGQIPDSIGSLQNLV  139

Query  481  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +LSLN N+F G IPP++G LS LYWLDLADNQLTGSIPVS+G+ PGLDM
Sbjct  140  FLSLNSNEFSGLIPPTIGNLSRLYWLDLADNQLTGSIPVSNGSNPGLDM  188



>ref|XP_010682075.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=959

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 140/186 (75%), Gaps = 1/186 (1%)
 Frame = +1

Query  70   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  249
            RI L +  + I+   I A T++ D  A+ AL  GW+N+PP+W  G DPCG+ WEG+ CN 
Sbjct  12   RIGLFVAFICIKIGDIAAQTNSQDSSALVALTSGWRNLPPNWT-GRDPCGNRWEGITCND  70

Query  250  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  429
            SR+ ++TL++M LTG+L+GD+  LSELQILDLSYN+ LTG LP+ IG L +L +LIL+GC
Sbjct  71   SRITAITLANMGLTGQLTGDLASLSELQILDLSYNRGLTGPLPQSIGRLSRLTSLILIGC  130

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  609
            GF G IPDSIGSL  +  LSLN N F GP+P ++G +  LYWLDLADNQL+GSIPVS G+
Sbjct  131  GFSGRIPDSIGSLELVDNLSLNENNFTGPVPATIGNMLNLYWLDLADNQLSGSIPVSSGD  190

Query  610  TPGLDM  627
            TPGLD+
Sbjct  191  TPGLDL  196



>gb|KCW62550.1| hypothetical protein EUGRSUZ_G00041 [Eucalyptus grandis]
Length=933

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 134/169 (79%), Gaps = 1/169 (1%)
 Frame = +1

Query  121  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  300
            A T+  D+ AI  L+  W+N PP+W  G+DPCG+ W+G+ C  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFSAIMGLKSDWQNTPPNWV-GTDPCGNGWDGIHCTNSRITSITLSSMGLTGSL  79

Query  301  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  480
            SGDI +LS+LQILDLSYNK LTGSLP +IGNL KL NLILVGCGF G IPDSIGSL  L 
Sbjct  80   SGDIGQLSKLQILDLSYNKGLTGSLPVQIGNLMKLTNLILVGCGFSGQIPDSIGSLHNLV  139

Query  481  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +LSLN N+F G IPP++G LS LYWLDLADNQLTGSIPVS+G+  GLDM
Sbjct  140  FLSLNSNEFSGLIPPTIGNLSRLYWLDLADNQLTGSIPVSNGSNFGLDM  188



>ref|XP_010521415.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Tarenaya hassleriana]
Length=957

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 143/189 (76%), Gaps = 4/189 (2%)
 Frame = +1

Query  70   RIQLLLVPLF---IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            R++ LL+ L    +Q   + + T++ D   +KAL + WKN PP+W +GSDPCG  W G+ 
Sbjct  6    RVRTLLLVLMMASVQICSVTSQTNSGDSAGLKALMNEWKNFPPNW-KGSDPCGSGWVGIS  64

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            C   RV S++L++M+L G LSGDI  LSELQILDLSYN  LTG+LP  IG LKKL NLIL
Sbjct  65   CTNGRVTSISLANMNLKGTLSGDISALSELQILDLSYNLGLTGTLPSAIGQLKKLKNLIL  124

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            VGCGF G IP+SIGSLS+L YLSLN N+F G IPPSLGQLS+LYW D+ADN++ GSIPVS
Sbjct  125  VGCGFAGPIPESIGSLSQLVYLSLNSNQFSGRIPPSLGQLSDLYWFDIADNRIEGSIPVS  184

Query  601  DGNTPGLDM  627
            DG +PGLDM
Sbjct  185  DGTSPGLDM  193



>ref|XP_010067941.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=947

 Score =   206 bits (525),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 134/169 (79%), Gaps = 1/169 (1%)
 Frame = +1

Query  121  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  300
            A T+  D+ AI  L+  W+N PP+W  G+DPCG+ W+G+ C  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFSAIMGLKSDWQNTPPNWV-GTDPCGNGWDGIHCTNSRITSITLSSMGLTGSL  79

Query  301  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  480
            SGDI +LS+LQILDLSYNK LTGSLP +IGNL KL NLILVGCGF G IPDSIGSL  L 
Sbjct  80   SGDIGQLSKLQILDLSYNKGLTGSLPVQIGNLMKLTNLILVGCGFSGQIPDSIGSLHNLV  139

Query  481  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +LSLN N+F G IPP++G LS LYWLDLADNQLTGSIPVS+G+  GLDM
Sbjct  140  FLSLNSNEFSGLIPPTIGNLSRLYWLDLADNQLTGSIPVSNGSNFGLDM  188



>gb|KCW62549.1| hypothetical protein EUGRSUZ_G00041 [Eucalyptus grandis]
Length=940

 Score =   206 bits (525),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 134/169 (79%), Gaps = 1/169 (1%)
 Frame = +1

Query  121  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  300
            A T+  D+ AI  L+  W+N PP+W  G+DPCG+ W+G+ C  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFSAIMGLKSDWQNTPPNWV-GTDPCGNGWDGIHCTNSRITSITLSSMGLTGSL  79

Query  301  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  480
            SGDI +LS+LQILDLSYNK LTGSLP +IGNL KL NLILVGCGF G IPDSIGSL  L 
Sbjct  80   SGDIGQLSKLQILDLSYNKGLTGSLPVQIGNLMKLTNLILVGCGFSGQIPDSIGSLHNLV  139

Query  481  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +LSLN N+F G IPP++G LS LYWLDLADNQLTGSIPVS+G+  GLDM
Sbjct  140  FLSLNSNEFSGLIPPTIGNLSRLYWLDLADNQLTGSIPVSNGSNFGLDM  188



>ref|XP_010088710.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
 gb|EXB36891.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
Length=1000

 Score =   207 bits (526),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 145/189 (77%), Gaps = 5/189 (3%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            M  ++QL L+ +F +   I A  +N+D++ +K+L   WKN PP+W +GSDPCG  WEG+ 
Sbjct  67   MDQKLQLFLLLVFSKTFFITA--ENSDFLGLKSLE--WKNTPPNW-KGSDPCGSEWEGID  121

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            C  SRV S+TLSS+ L G+LSG+I++LSEL+ LDLSYNK LTG LP  IGNLKKL NLIL
Sbjct  122  CTNSRVTSITLSSLGLEGQLSGEIDQLSELEALDLSYNKKLTGLLPESIGNLKKLSNLIL  181

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            VGCGF+G IP +IGSL +L +LSLN N+F G IPP++G LS+LYWLDLADN + G IP+S
Sbjct  182  VGCGFYGQIPGTIGSLQELVFLSLNSNRFTGLIPPAIGNLSKLYWLDLADNNIEGMIPIS  241

Query  601  DGNTPGLDM  627
            DG T GLDM
Sbjct  242  DGKTLGLDM  250



>ref|XP_011088111.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Sesamum indicum]
Length=952

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 138/170 (81%), Gaps = 1/170 (1%)
 Frame = +1

Query  118  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE  297
             A+TD  D+ A+++L+D W NVPP+W+ G+DPCGD W G+ C  +RVVS+TL+S++L+G+
Sbjct  20   AAWTDPYDFAALRSLKDIWDNVPPNWS-GADPCGDGWSGISCINNRVVSITLASINLSGQ  78

Query  298  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  477
            LS DI +L+ELQ LDLSYN+ +TG LP  IGN  KL +LILVGCGF G IP SIGSL +L
Sbjct  79   LSSDIAKLAELQTLDLSYNEGMTGPLPSAIGNFPKLTSLILVGCGFSGQIPPSIGSLQQL  138

Query  478  kylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
             YLSLN NKF+G IPP++G LS LYWLDLADN+L+G IPVSDG+TPGLDM
Sbjct  139  VYLSLNSNKFVGEIPPTIGNLSNLYWLDLADNKLSGKIPVSDGSTPGLDM  188



>gb|KCW62545.1| hypothetical protein EUGRSUZ_G00037, partial [Eucalyptus grandis]
Length=937

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 129/169 (76%), Gaps = 1/169 (1%)
 Frame = +1

Query  121  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  300
            A T+  D  A+  L   W+N PP+W  G+DPCGD+W G+ CN SRV S+ LSS  LTG L
Sbjct  21   AATNPYDLSALTGLMTDWQNAPPNWV-GTDPCGDNWVGIRCNNSRVTSIILSSAGLTGSL  79

Query  301  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  480
            SGDI +LSELQILDLSYNK LTGSLP +IGNL KL   ILVGCGFFG IPDSIG L  L 
Sbjct  80   SGDIGQLSELQILDLSYNKGLTGSLPEQIGNLIKLTRWILVGCGFFGQIPDSIGYLQNLV  139

Query  481  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            YL+LN N+F GPIP  +G LS LYWLDLADNQLTGSIP+S+G+ PGLDM
Sbjct  140  YLALNSNRFSGPIPAIIGNLSTLYWLDLADNQLTGSIPISNGSNPGLDM  188



>ref|XP_010682077.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=954

 Score =   204 bits (519),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 140/190 (74%), Gaps = 3/190 (2%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            M+ RI L L  + I   G  A T N D VA+KAL +  K++P SW  G DPCG  WEG+ 
Sbjct  2    MLLRILLSLAFICIHVWGTTAQT-NEDGVALKALIEDRKSLPESWT-GEDPCGSRWEGIT  59

Query  241  CNGSRVVSLTLSSMDLTGELS-GDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  417
            CN SR++++TL+SM LTG+LS GD+  LSELQ LDLSYNK  TGSLP  IG+L KL +LI
Sbjct  60   CNNSRIITITLASMGLTGQLSTGDLTSLSELQTLDLSYNKGFTGSLPSNIGDLSKLTSLI  119

Query  418  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  597
            LVGCGF G IPDS+GSL KL  LSLN N FIG +P S+G L  LYWLDL+DNQLTGSIPV
Sbjct  120  LVGCGFSGRIPDSVGSLKKLITLSLNSNSFIGEVPASIGNLKHLYWLDLSDNQLTGSIPV  179

Query  598  SDGNTPGLDM  627
            SDG+ PGLD+
Sbjct  180  SDGSKPGLDL  189



>ref|XP_010533231.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Tarenaya hassleriana]
Length=954

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 132/177 (75%), Gaps = 1/177 (1%)
 Frame = +1

Query  97   FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  276
            F++   + + TD+ D   +KAL DGWKN PP+W +GSDPCG +W G+ C   RV S+ LS
Sbjct  16   FVEICSVASQTDSRDSAGLKALMDGWKNFPPNW-QGSDPCGANWVGISCTNGRVTSIALS  74

Query  277  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  456
            +MDL G L GDI  LSELQILDLSYN  L G+L   IG LKKL NLILVGC F G IPD+
Sbjct  75   NMDLEGTLPGDISALSELQILDLSYNPSLAGTLSPGIGQLKKLKNLILVGCSFTGAIPDA  134

Query  457  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            IGSL++L YLSLN N+F G IP +LGQLS LYW D+ADNQ+ GSIPVSDG +PGLDM
Sbjct  135  IGSLTQLVYLSLNSNQFSGRIPATLGQLSNLYWFDIADNQIEGSIPVSDGTSPGLDM  191



>ref|XP_010065206.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
 gb|KCW62547.1| hypothetical protein EUGRSUZ_G00039 [Eucalyptus grandis]
Length=958

 Score =   203 bits (517),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 130/169 (77%), Gaps = 1/169 (1%)
 Frame = +1

Query  121  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  300
            A T+  D+ AIK L   W+N PP+W  G+DPCG  W+G+ C  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFGAIKGLMSDWQNTPPNWV-GTDPCGGDWDGIVCTNSRITSITLSSMGLTGSL  79

Query  301  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  480
             GDI +LSELQILDLSYN+ LTGSLP +IGNL KL NLILVGCGF G IPDSIGSL  L 
Sbjct  80   PGDIGQLSELQILDLSYNRGLTGSLPTQIGNLMKLTNLILVGCGFSGRIPDSIGSLQNLV  139

Query  481  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +LSLN N F G IPP++G LS LYWLDLADNQLTGSIPVS G+  GLDM
Sbjct  140  FLSLNSNGFSGQIPPTIGNLSRLYWLDLADNQLTGSIPVSKGSEFGLDM  188



>gb|KCW62548.1| hypothetical protein EUGRSUZ_G00040, partial [Eucalyptus grandis]
Length=933

 Score =   203 bits (517),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = +1

Query  148  AIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSE  327
            AI+ L   W++ PP+W  G+DPCG+ W+G+GC  SR+ S+TLSSM LTG L GDI +LSE
Sbjct  22   AIEGLMSYWQHTPPNWV-GTDPCGNGWDGIGCTNSRITSITLSSMGLTGSLPGDIVQLSE  80

Query  328  LQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkF  507
            L+ILDLSYN+ LTGSLP +IGNL KL NLILVGCGF G IPDSIGSL  L +LSLN N+F
Sbjct  81   LRILDLSYNRGLTGSLPAQIGNLMKLTNLILVGCGFSGQIPDSIGSLQNLVFLSLNSNEF  140

Query  508  IGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
             G IPP++G LS LYWLDLADNQLTGSIPVS+G+ PGLDM
Sbjct  141  SGLIPPTIGNLSRLYWLDLADNQLTGSIPVSNGSNPGLDM  180



>ref|XP_007156284.1| hypothetical protein PHAVU_003G273700g [Phaseolus vulgaris]
 gb|ESW28278.1| hypothetical protein PHAVU_003G273700g [Phaseolus vulgaris]
Length=965

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 139/187 (74%), Gaps = 5/187 (3%)
 Frame = +1

Query  82   LLVPLFIQFL-----GIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  246
            L V LF+ FL      I ++T+  D VA+++L+D W N PPSW    DPCG+ WEGV CN
Sbjct  4    LCVLLFLGFLWAEIHVISSYTETQDVVALRSLKDEWHNTPPSWDRSDDPCGEPWEGVTCN  63

Query  247  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  426
             SRV SL LS+M L G+LSGDI +LSEL+ LDLS+N+DLTGSL  E+G L KL  LIL G
Sbjct  64   KSRVTSLGLSTMGLKGKLSGDIGQLSELRSLDLSFNRDLTGSLSPELGELSKLNILILAG  123

Query  427  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  606
            CGF G IPD +G+LS+L +L+LN N F G IPPSLG+LS++YWLDLADNQLTG IPVS  
Sbjct  124  CGFSGNIPDELGNLSELSFLALNSNNFTGKIPPSLGKLSKIYWLDLADNQLTGPIPVSTS  183

Query  607  NTPGLDM  627
             +PGLD+
Sbjct  184  TSPGLDL  190



>ref|XP_010065203.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=929

 Score =   200 bits (509),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 122/152 (80%), Gaps = 1/152 (1%)
 Frame = +1

Query  172  WKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSY  351
            W+N PP+W  G+DPCGD+W G+ CN SRV S+ LSS  LTG LSGDI +LSELQILDLSY
Sbjct  4    WQNAPPNWV-GTDPCGDNWVGIRCNNSRVTSIILSSAGLTGSLSGDIGQLSELQILDLSY  62

Query  352  NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSL  531
            NK LTGSLP +IGNL KL   ILVGCGFFG IPDSIG L  L YL+LN N+F GPIP  +
Sbjct  63   NKGLTGSLPEQIGNLIKLTRWILVGCGFFGQIPDSIGYLQNLVYLALNSNRFSGPIPAII  122

Query  532  GQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            G LS LYWLDLADNQLTGSIP+S+G+ PGLDM
Sbjct  123  GNLSTLYWLDLADNQLTGSIPISNGSNPGLDM  154



>ref|XP_011464972.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
Length=962

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 136/191 (71%), Gaps = 2/191 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEG-SDPCGDHWEG  234
            M  R Q+ L+ +F  FL +    T   D + +  L+  W N PPSW    SDPC D W+G
Sbjct  1    MDHRTQVFLLLIFAPFLVLANHVTSPQDVMGLTFLKQLWNNTPPSWGTRLSDPCEDDWDG  60

Query  235  VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  414
            + C   RV+SL L SM+LTG LSGDI++ SELQILDLSYNK LTG LP EIG+LKKLYN+
Sbjct  61   IRCTNMRVISLILPSMNLTGTLSGDIDQFSELQILDLSYNKGLTGPLPTEIGSLKKLYNI  120

Query  415  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIP  594
            ILVGC F GLIP SIGSL +L +LSLN N+F G IP S+G LS+LYWLDLADN L G IP
Sbjct  121  ILVGCSFSGLIPASIGSLQELIFLSLNSNRFSGRIPSSIGNLSKLYWLDLADNNLEGPIP  180

Query  595  VSDGNTPGLDM  627
            VSDG  PGLDM
Sbjct  181  VSDGVEPGLDM  191



>emb|CDX83185.1| BnaA03g23210D [Brassica napus]
Length=247

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 138/184 (75%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +LL+ LF Q L + A T+  D  A++AL+  W   P +W EG+DPCG  W G+ C+ +RV
Sbjct  9    MLLIFLFFQILSVSALTNGFDGSALQALKAEWTKPPSNW-EGADPCGTSWVGITCSNNRV  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            VS++L ++++ G+LSGDI  LSELQILDLSYN  LTG LP  IG LKKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSGDIAALSELQILDLSYNTGLTGPLPPNIGELKKLKNLILVGCSFT  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  615
            G IP SIG L +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++PVS+G ++P
Sbjct  128  GQIPQSIGQLEQLIYLSLNLNQFSGTIPASIGRLSKLYWFDIADNQIEGTLPVSNGTSSP  187

Query  616  GLDM  627
            GLDM
Sbjct  188  GLDM  191



>ref|XP_007019716.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007019717.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY16941.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY16942.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=963

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            I AFTD +D  A+++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M L G
Sbjct  20   ISAFTDPHDAAALQSLKDSWQNTPPSWDKSDDPCGAPWEGVTCNSSRVTALGLSTMGLKG  79

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            +LSGDI EL+EL+ LDLS+N+DLTGSL   +G+L+KL  LIL GCGF G IP+ +G L++
Sbjct  80   KLSGDIGELTELRSLDLSFNRDLTGSLSPRLGDLEKLNILILAGCGFTGNIPEELGKLAE  139

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            L +L+LN N F G IPPSLG LS+LYWLDLADNQL GSIPVS   +PGLD+
Sbjct  140  LSFLALNSNNFTGRIPPSLGTLSKLYWLDLADNQLMGSIPVSTPTSPGLDL  190



>ref|XP_010252252.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nelumbo nucifera]
Length=953

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 136/190 (72%), Gaps = 2/190 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            M  RI+  L+ +  Q     A TD  D  A+ + +  WKN PP+W    DPC  +W G+ 
Sbjct  1    MDQRIKAFLLVVLFQVSSAAAQTDPQDAAALNSFKRLWKNTPPNW-NNPDPCNGNWVGIT  59

Query  241  CNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  417
            CN + RV+S+TLSSM L G+LSGDI  LSELQ LDLSYNK LTGSLP  IG+L KL NLI
Sbjct  60   CNSNFRVISITLSSMGLEGQLSGDIGSLSELQTLDLSYNKGLTGSLPEAIGSLMKLSNLI  119

Query  418  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  597
            L+GC F G IPD+IGSL +L +LSLN N F G IPPS+G LS+LYWLDLADN+LTG+IPV
Sbjct  120  LLGCSFSGPIPDAIGSLKQLVFLSLNSNSFSGEIPPSIGNLSKLYWLDLADNKLTGTIPV  179

Query  598  SDGNTPGLDM  627
            S G TPGLDM
Sbjct  180  SSGGTPGLDM  189



>ref|XP_010252232.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Nelumbo nucifera]
Length=984

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 128/169 (76%), Gaps = 0/169 (0%)
 Frame = +1

Query  121  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  300
            A TD  D  A+++L   W+N+PPSW +  DPCG  WEGV C  SR+ +L+LS+M L G L
Sbjct  53   ASTDTEDVAALRSLMSHWQNIPPSWGKTDDPCGTPWEGVSCRNSRITALSLSTMGLKGTL  112

Query  301  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  480
            SGDI + +EL  LDLSYNK+LTG L   IG+L+KL  LIL GCGF G IP  IG+L+KL 
Sbjct  113  SGDIGQFTELTTLDLSYNKELTGPLSPRIGDLQKLNILILAGCGFTGTIPTEIGNLAKLT  172

Query  481  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +L+LN N FIG IPPSLG LS+LYWLDLADNQLTGS+PVSD N+PGLD+
Sbjct  173  FLALNSNNFIGGIPPSLGSLSQLYWLDLADNQLTGSLPVSDNNSPGLDL  221



>ref|XP_006836951.1| hypothetical protein AMTR_s00099p00159710 [Amborella trichopoda]
 gb|ERM99804.1| hypothetical protein AMTR_s00099p00159710 [Amborella trichopoda]
Length=951

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 136/188 (72%), Gaps = 4/188 (2%)
 Frame = +1

Query  67   PRIQLLLVPLFIQFLGIVAFTDNN-DYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGC  243
            P IQ  ++    Q   I     N  D   + +L++ W+NVPP+W +G DPC + W+G+ C
Sbjct  7    PCIQFFVI--LCQLCAIYGQETNPFDGAVLTSLQNVWQNVPPTW-KGGDPCLNQWDGISC  63

Query  244  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV  423
            NGSRV ++ LS+M L G L+GDI  LSELQ LDLSYNKDLTGSLP+ IGNLKKL NLILV
Sbjct  64   NGSRVTAIKLSTMGLKGTLTGDIGSLSELQYLDLSYNKDLTGSLPQSIGNLKKLTNLILV  123

Query  424  GCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD  603
            GC F G IP  IGSL +L +LSLN N F G IPPS+G LS+LYWLDLADNQLTGSIP+S 
Sbjct  124  GCSFSGTIPAQIGSLQELVFLSLNSNGFTGEIPPSIGSLSKLYWLDLADNQLTGSIPIST  183

Query  604  GNTPGLDM  627
              +PGLDM
Sbjct  184  PTSPGLDM  191



>ref|XP_007023753.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY26375.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
Length=956

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 134/186 (72%), Gaps = 5/186 (3%)
 Frame = +1

Query  82   LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVV  261
            LL+ +FIQ   +   TD  D  A+K+L   W+NVPPSW  G DPCGD W G+ C  SRV 
Sbjct  8    LLLVVFIQIYIVAPTTDFGDSTALKSLVAEWENVPPSWV-GGDPCGDGWVGISCTDSRVT  66

Query  262  SLTLSSMDLTGELSGDIEELSELQ----ILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  429
            S+ L SM+L G LSGDI  LSELQ      DLSYN+ LTGSLP  IGNLK L NLILVGC
Sbjct  67   SIILPSMNLVGRLSGDISTLSELQQTSMFRDLSYNQGLTGSLPASIGNLKNLTNLILVGC  126

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  609
            GF G IPDSIGSLS+L++LSLN N F G IPPS+G LS L WLDLADN L G IPVS+G+
Sbjct  127  GFNGPIPDSIGSLSQLRFLSLNSNGFTGRIPPSIGNLSNLVWLDLADNHLEGPIPVSNGS  186

Query  610  TPGLDM  627
            TPGLDM
Sbjct  187  TPGLDM  192



>ref|XP_010682076.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=945

 Score =   198 bits (503),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 127/160 (79%), Gaps = 1/160 (1%)
 Frame = +1

Query  148  AIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSE  327
            A+ AL  GW+N+PP+W  G DPCG+ WEG+ CN SR+ ++TL++M LTG+L+GD+  LSE
Sbjct  24   ALVALTSGWRNLPPNWT-GRDPCGNRWEGITCNDSRITAITLANMGLTGQLTGDLASLSE  82

Query  328  LQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkF  507
            LQILDLSYN+ LTG LP+ IG L +L +LIL+GCGF G IPDSIGSL  +  LSLN N F
Sbjct  83   LQILDLSYNRGLTGPLPQSIGRLSRLTSLILIGCGFSGRIPDSIGSLELVDNLSLNENNF  142

Query  508  IGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
             GP+P ++G +  LYWLDLADNQL+GSIPVS G+TPGLD+
Sbjct  143  TGPVPATIGNMLNLYWLDLADNQLSGSIPVSSGDTPGLDL  182



>ref|XP_003530535.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Glycine max]
Length=969

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 130/171 (76%), Gaps = 0/171 (0%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            I +FTD  D VA+++L+D W++ PPSW +  DPCG  WEGV CN SRV SL LS+M L G
Sbjct  20   ISSFTDTRDVVALRSLKDAWQHTPPSWDKSDDPCGAPWEGVTCNKSRVTSLGLSTMGLKG  79

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            +L+GDI +L+EL+ LDLS+N+DLTG L  ++G+L  L  LIL GC F G IPD +G LS+
Sbjct  80   KLTGDIGQLTELRSLDLSFNRDLTGPLSPQLGDLSNLNILILAGCSFSGNIPDDLGKLSE  139

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            L +L+LN N F G IPPSLG LS+LYWLDLADNQLTG IPVS  NTPGLD+
Sbjct  140  LSFLALNSNNFTGKIPPSLGNLSKLYWLDLADNQLTGPIPVSTSNTPGLDL  190



>ref|XP_011092240.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Sesamum indicum]
Length=934

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 135/161 (84%), Gaps = 1/161 (1%)
 Frame = +1

Query  145  VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELS  324
            VA+K+L+D W+NVPP+W +G DPCG +W+G+ C+ +RV+S+TL+S++L+G LS DI+ LS
Sbjct  11   VALKSLKDEWENVPPNW-DGDDPCGHNWDGISCSDTRVISITLASINLSGHLSSDIKGLS  69

Query  325  ELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnk  504
             L+ LDLSYNK +TG LP  IGNL++L +LILVGCGF G IP SIGSL +L YLSLN NK
Sbjct  70   ALETLDLSYNKGMTGPLPSSIGNLQELSSLILVGCGFSGPIPSSIGSLQQLVYLSLNSNK  129

Query  505  FIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            F+G IPPS+G LS LYWLDLADN+L+G+IPVS G+TPGLDM
Sbjct  130  FVGEIPPSIGNLSNLYWLDLADNKLSGTIPVSKGSTPGLDM  170



>ref|XP_011092238.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Sesamum indicum]
Length=964

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 135/161 (84%), Gaps = 1/161 (1%)
 Frame = +1

Query  145  VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELS  324
            VA+K+L+D W+NVPP+W +G DPCG +W+G+ C+ +RV+S+TL+S++L+G LS DI+ LS
Sbjct  41   VALKSLKDEWENVPPNW-DGDDPCGHNWDGISCSDTRVISITLASINLSGHLSSDIKGLS  99

Query  325  ELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnk  504
             L+ LDLSYNK +TG LP  IGNL++L +LILVGCGF G IP SIGSL +L YLSLN NK
Sbjct  100  ALETLDLSYNKGMTGPLPSSIGNLQELSSLILVGCGFSGPIPSSIGSLQQLVYLSLNSNK  159

Query  505  FIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            F+G IPPS+G LS LYWLDLADN+L+G+IPVS G+TPGLDM
Sbjct  160  FVGEIPPSIGNLSNLYWLDLADNKLSGTIPVSKGSTPGLDM  200



>ref|XP_009593371.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana tomentosiformis]
Length=951

 Score =   195 bits (496),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 133/188 (71%), Gaps = 1/188 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            M  R Q+ L+    Q L I+  T++ND  A+ A++  W N+PP+W EGSDPCG  WEG+ 
Sbjct  4    MGSRSQVFLLIFASQILAILGQTNSNDVTALFAIKSSWNNLPPNW-EGSDPCGSSWEGIV  62

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            C  SR+ S+ LS M L G   GD+  L+ LQILDLS N  L G+LP  IGNLK L  LIL
Sbjct  63   CKDSRITSIKLSGMGLEGNQFGDLSSLTALQILDLSNNVGLKGTLPSSIGNLKNLTTLIL  122

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            VGC FFG IP+SIGSL +L ++SL  N F GPIPPS+G LS+L WLDL+DN+L+G+IPVS
Sbjct  123  VGCSFFGPIPESIGSLQQLVFISLTSNSFTGPIPPSIGNLSKLSWLDLSDNKLSGTIPVS  182

Query  601  DGNTPGLD  624
             G+TPGLD
Sbjct  183  KGSTPGLD  190



>gb|KHN40734.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=969

 Score =   196 bits (497),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            I +FTD  D VA+++L+D W++ PPSW +  DPCG  WEGV CN SRV SL LS+M L G
Sbjct  20   ISSFTDTRDVVALRSLKDAWQHTPPSWDKSDDPCGAPWEGVTCNKSRVTSLGLSTMGLKG  79

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            +L+GDI +L+EL+ LDLS+N+DLTG L  ++G+L  L  LIL GC F G IPD +G LS+
Sbjct  80   KLTGDIGQLTELRSLDLSFNRDLTGPLSPQLGDLSNLNILILAGCSFSGNIPDDLGKLSE  139

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            L +L+LN N F G IPPSLG LS+LYWLDLADNQLTG IPVS   TPGLD+
Sbjct  140  LSFLALNSNNFTGKIPPSLGNLSKLYWLDLADNQLTGPIPVSTSTTPGLDL  190



>gb|KJB29748.1| hypothetical protein B456_005G116800 [Gossypium raimondii]
Length=701

 Score =   193 bits (491),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            + A TD +D  A+++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M L G
Sbjct  20   LSAVTDPHDAAALQSLKDSWQNTPPSWVKSDDPCGAPWEGVTCNSSRVTALGLSTMGLKG  79

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            +LSGDI  L+EL+ LDLS+N+DLTGSL   +G+L+KL  LIL GCGF G IP+ +G+L++
Sbjct  80   KLSGDIGGLTELRSLDLSFNRDLTGSLSPRLGDLEKLNILILAGCGFTGNIPEELGNLAE  139

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            L +L+LN N F G IPPSLG+LS+LYWLDLADNQL G+IPVS   +PGLD+
Sbjct  140  LSFLALNSNNFTGKIPPSLGKLSKLYWLDLADNQLVGAIPVSTPTSPGLDL  190



>ref|XP_011464973.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
 ref|XP_011464974.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
Length=955

 Score =   195 bits (495),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 137/190 (72%), Gaps = 2/190 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIVAF-TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  237
            M  R Q+ L+ ++   L +    T   D   +K+L   W N PPSW    DPC D W+G+
Sbjct  1    MDQRTQVFLLLIYAPVLVLSNHQTSIPDVTGLKSLMALWTNTPPSWG-ARDPCEDSWDGI  59

Query  238  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  417
            GC   RVVSLTLSSM+L+G LSGDI++LSELQILDLSYNK L+G LP +IG+L KL N+I
Sbjct  60   GCTNMRVVSLTLSSMNLSGSLSGDIQQLSELQILDLSYNKGLSGPLPTQIGSLTKLTNII  119

Query  418  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  597
            LVGC F GLIP SIGSL +L++LSLN N+F G IP S+G LS+LYWLDLADN L G IPV
Sbjct  120  LVGCSFSGLIPASIGSLQELRFLSLNANRFSGKIPSSIGNLSKLYWLDLADNNLEGPIPV  179

Query  598  SDGNTPGLDM  627
            SDG  PGLDM
Sbjct  180  SDGVEPGLDM  189



>ref|XP_006481666.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Citrus sinensis]
Length=964

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 137/184 (74%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVA-FTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR  255
            L+ + LF   + +++  TD+ D  A+++L+D W+N PP+W    DPCG  WEGV CN SR
Sbjct  7    LIFIALFSFHIQLISSATDSRDAAALQSLKDAWQNTPPTWKNSDDPCGS-WEGVTCNNSR  65

Query  256  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  435
            V +L LS+M LTG+LSGDI  L+EL+ LDLSYN  LTGSL   IG+L+KL  LIL GCGF
Sbjct  66   VTALGLSTMGLTGKLSGDIGGLTELRSLDLSYNGGLTGSLSPRIGDLQKLNILILAGCGF  125

Query  436  FGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP  615
             G IPD IG+L++L +L+LN N F G IPPSLG+LS+LYWLDLADNQLTGSIPVS   +P
Sbjct  126  TGNIPDEIGNLAELSFLALNSNNFSGRIPPSLGKLSQLYWLDLADNQLTGSIPVSTITSP  185

Query  616  GLDM  627
            GLD 
Sbjct  186  GLDQ  189



>gb|KDO70764.1| hypothetical protein CISIN_1g002121mg [Citrus sinensis]
Length=964

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 137/184 (74%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVA-FTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR  255
            L+ + LF   + +++  TD+ D  A+++L+D W+N PP+W    DPCG  WEGV CN SR
Sbjct  7    LIFIALFSFHIQLISSATDSRDAAALQSLKDAWQNTPPTWKNSDDPCGS-WEGVTCNNSR  65

Query  256  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  435
            V +L LS+M LTG+LSGDI  L+EL+ LDLSYN  LTGSL   IG+L+KL  LIL GCGF
Sbjct  66   VTALGLSTMGLTGKLSGDIGGLTELRSLDLSYNGGLTGSLSPRIGDLQKLNILILAGCGF  125

Query  436  FGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP  615
             G IPD IG+L++L +L+LN N F G IPPSLG+LS+LYWLDLADNQLTGSIPVS   +P
Sbjct  126  TGNIPDEIGNLAELSFLALNSNNFSGRIPPSLGKLSQLYWLDLADNQLTGSIPVSTITSP  185

Query  616  GLDM  627
            GLD 
Sbjct  186  GLDQ  189



>gb|KJB29747.1| hypothetical protein B456_005G116800 [Gossypium raimondii]
Length=965

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            + A TD +D  A+++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M L G
Sbjct  20   LSAVTDPHDAAALQSLKDSWQNTPPSWVKSDDPCGAPWEGVTCNSSRVTALGLSTMGLKG  79

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            +LSGDI  L+EL+ LDLS+N+DLTGSL   +G+L+KL  LIL GCGF G IP+ +G+L++
Sbjct  80   KLSGDIGGLTELRSLDLSFNRDLTGSLSPRLGDLEKLNILILAGCGFTGNIPEELGNLAE  139

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            L +L+LN N F G IPPSLG+LS+LYWLDLADNQL G+IPVS   +PGLD+
Sbjct  140  LSFLALNSNNFTGKIPPSLGKLSKLYWLDLADNQLVGAIPVSTPTSPGLDL  190



>emb|CDY68959.1| BnaCnng61190D, partial [Brassica napus]
Length=359

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 134/184 (73%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +LL+ L  QFL + A T+  D  A++AL+  W   P SW  G+DPCG +W G+ C   RV
Sbjct  25   MLLILLCFQFLSVSALTNGFDASALQALKADWTKYPESWV-GADPCGTNWVGITCTNDRV  83

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            VS++L ++D+ G+LS DI  L+ELQILDLSYN  LTG LP  IG LKKL NLILV C F 
Sbjct  84   VSISLGNLDVEGKLSSDIASLTELQILDLSYNTGLTGPLPSNIGQLKKLKNLILVACSFS  143

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  615
            G IP+SIG L +L YLSLNLN+F G IP S+G+LS LYW D+ADNQ+ G++PVS+G ++P
Sbjct  144  GQIPESIGDLEQLIYLSLNLNQFSGRIPASIGRLSNLYWFDIADNQIEGTLPVSNGTSSP  203

Query  616  GLDM  627
            GLDM
Sbjct  204  GLDM  207



>gb|KEH20269.1| LRR receptor-like kinase [Medicago truncatula]
Length=966

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 135/188 (72%), Gaps = 0/188 (0%)
 Frame = +1

Query  64   IPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGC  243
            I  + L L+ L+ Q   I + TD  D  A+++L+D W+N PPSW +  DPCG  WEGV C
Sbjct  3    IQSVFLFLLFLWAQIHLIFSITDPQDVAALRSLKDIWENTPPSWDKSDDPCGAPWEGVTC  62

Query  244  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV  423
            N SRV SL LS+M L G+LSGDI  L+EL+ LDLS+NKDL G +  E+G+L KL  LIL 
Sbjct  63   NKSRVTSLGLSTMGLKGKLSGDIGGLTELRSLDLSFNKDLMGPISPELGDLSKLNILILA  122

Query  424  GCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD  603
            GC F G IPD +G LS+L +L+LN N F G IPPSLG+LS+LYWLDLADNQLTG +PVS 
Sbjct  123  GCSFSGNIPDKLGDLSELSFLALNSNNFTGKIPPSLGKLSKLYWLDLADNQLTGPLPVST  182

Query  604  GNTPGLDM  627
              TPGLD+
Sbjct  183  STTPGLDL  190



>ref|XP_003547844.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Glycine max]
 gb|KHN01903.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=967

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 136/185 (74%), Gaps = 0/185 (0%)
 Frame = +1

Query  73   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  252
            + L L  L+ +   I +FTD  D VA+++L+D W+N PPSW +  DPCG  WEGV CN S
Sbjct  6    VLLFLGLLWAEIHVISSFTDTQDVVALRSLKDVWQNTPPSWDKADDPCGAPWEGVTCNKS  65

Query  253  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  432
            RV SL LS+M L G+L+GDI +L+EL+ LDLS+N+ LTG L  ++G+L  L  LIL GC 
Sbjct  66   RVTSLGLSTMGLKGKLTGDIGQLTELRSLDLSFNRGLTGPLSPQLGDLSNLNILILAGCS  125

Query  433  FFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT  612
            F G IPD +G+LS+L +L+LN N F G IPPSLG+LS+LYWLDLADNQLTG IPVS   T
Sbjct  126  FGGNIPDELGNLSELSFLALNSNNFTGKIPPSLGKLSKLYWLDLADNQLTGPIPVSTSTT  185

Query  613  PGLDM  627
            PGLD+
Sbjct  186  PGLDL  190



>gb|KHN40742.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=954

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 137/186 (74%), Gaps = 1/186 (1%)
 Frame = +1

Query  70   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  249
            R+ +L++  F   L +   T   D  A+ AL + W+N PP+W +G+DPCG  W+G+ C  
Sbjct  4    RVIVLILLFFTHLLIVFTKTSPQDSAALLALVNEWQNTPPNW-DGTDPCGAGWDGIECTN  62

Query  250  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  429
            SR+ S++L+SMDL+G+L+ DI  LSEL ILDLSYNK LTG LP +IGNL+KL NL+++ C
Sbjct  63   SRITSISLASMDLSGQLTSDIGSLSELLILDLSYNKKLTGPLPNDIGNLRKLRNLLVINC  122

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  609
            GF G IP +IG+L +L +LSLN N F GPIP ++G LS +YWLDLA+NQL G IP+S+G 
Sbjct  123  GFTGPIPVTIGNLERLVFLSLNSNGFTGPIPAAIGNLSNVYWLDLAENQLEGPIPISNGT  182

Query  610  TPGLDM  627
            TPGLDM
Sbjct  183  TPGLDM  188



>gb|EPS73565.1| hypothetical protein M569_01189, partial [Genlisea aurea]
Length=957

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 134/188 (71%), Gaps = 1/188 (1%)
 Frame = +1

Query  64   IPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGC  243
            I RI  +L+ + IQ L + A+T+ ND  A+ AL++ W NVPPSW  G DPC   W+G+ C
Sbjct  7    ISRIDFILLAVLIQILVVGAWTNPNDRTALLALKEQWSNVPPSWV-GPDPCNSAWDGIRC  65

Query  244  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV  423
              S VVS+TL S  L G L  DI   SELQILDLSYN  LTG LP +IGNL KL NLILV
Sbjct  66   INSSVVSITLVSYSLKGYLPSDITLFSELQILDLSYNTRLTGPLPDKIGNLWKLRNLILV  125

Query  424  GCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD  603
            GCGF G IP SIGSL +L +LSLN N FIG IP S+G LS LYWLD+ADN+L+GSIPVS 
Sbjct  126  GCGFSGPIPSSIGSLQQLVFLSLNSNNFIGEIPNSIGLLSTLYWLDIADNKLSGSIPVSK  185

Query  604  GNTPGLDM  627
             + PGLD+
Sbjct  186  ESLPGLDL  193



>ref|XP_008366930.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Malus domestica]
Length=223

 Score =   180 bits (457),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 124/176 (70%), Gaps = 0/176 (0%)
 Frame = +1

Query  97   FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  276
            F +   I + TD +D  A+++L+  W NVPPSW + SDPCG  WEGV CN SRV +L LS
Sbjct  15   FSRLHVISSVTDPDDASALQSLKQTWSNVPPSWDKSSDPCGAQWEGVTCNDSRVTALGLS  74

Query  277  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  456
            ++++ G++ GDI  LSEL+ LDLS+NK LTGSL   +G+L KL  LIL GC F G IP  
Sbjct  75   AINVKGKIEGDIGGLSELRSLDLSFNKGLTGSLSPRLGDLSKLNILILAGCSFTGSIPSE  134

Query  457  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
            +G+L +L +L+LN N F G IP S G+LS LYWLDLADNQLTG IPVS    PGLD
Sbjct  135  LGNLKELTFLALNTNNFTGSIPASFGKLSNLYWLDLADNQLTGPIPVSTAVAPGLD  190



>ref|XP_004137665.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Cucumis sativus]
 ref|XP_004160329.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Cucumis sativus]
 gb|KGN58673.1| hypothetical protein Csa_3G727910 [Cucumis sativus]
Length=966

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 133/190 (70%), Gaps = 1/190 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  237
            M P   LLL   F   +    +FTD  D  A+++LR+ W+N PPSW    DPCG  WEGV
Sbjct  1    MSPVETLLLFAFFYAGIDTAGSFTDPRDSAALESLRNEWQNTPPSWGASIDPCGTPWEGV  60

Query  238  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  417
             C  SRV +L LS+M L G+L GDI  L+EL+ LDLS+NKDLTGS+   +G+L+ L  LI
Sbjct  61   ACINSRVTALRLSTMGLKGKLGGDIGGLTELKSLDLSFNKDLTGSISPALGDLQNLSILI  120

Query  418  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  597
            L GCGF G IP+ +G+LS L +L+LN N F G IPPSLG+LS LYWLDLADNQLTGS+PV
Sbjct  121  LAGCGFSGSIPEQLGNLSNLSFLALNSNNFTGTIPPSLGKLSNLYWLDLADNQLTGSLPV  180

Query  598  SDGNTPGLDM  627
            S   TPGLD+
Sbjct  181  STSETPGLDL  190



>ref|XP_009377697.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=385

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 123/170 (72%), Gaps = 0/170 (0%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            I + T  +D  A+++LR  W NVPPSW + +DPCG+ WEG+ CNGSRV +L LS M++ G
Sbjct  18   ISSSTHLDDANALQSLRQTWINVPPSWDKSNDPCGESWEGITCNGSRVTALGLSGMNVEG  77

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            ++ GDI  LSEL+ LDLS+NK LTGSL   +G+L  L  LIL GC F G+IP  +G L +
Sbjct  78   KIEGDIAGLSELRFLDLSFNKGLTGSLSPRLGDLSNLNILILAGCSFSGIIPSELGKLGE  137

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
            L +L+LN N F G IP SLG LS LYWLDLADNQLTG +PVS G TPGLD
Sbjct  138  LTFLALNTNNFTGSIPASLGNLSNLYWLDLADNQLTGPLPVSSGTTPGLD  187



>ref|XP_007147540.1| hypothetical protein PHAVU_006G133200g [Phaseolus vulgaris]
 gb|ESW19534.1| hypothetical protein PHAVU_006G133200g [Phaseolus vulgaris]
Length=944

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = +1

Query  118  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE  297
            VA     D+  +K+L D W+   P+W EGSDPC D W G+ C  SRVVS++L+ + LTG+
Sbjct  20   VAQDITKDFQVLKSLSDSWQGQIPNW-EGSDPCQD-WYGINCRNSRVVSISLTDIGLTGK  77

Query  298  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  477
            LSGDI  LSEL  LDLSYN+ LTG LP+EIGNLKKL  L LVGCGF G IPD IGSL  L
Sbjct  78   LSGDIGSLSELDSLDLSYNRGLTGPLPQEIGNLKKLTKLTLVGCGFTGRIPDEIGSLQHL  137

Query  478  kylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            ++LSLN N F GPIPPS+G LS L WLDLADNQL GSIPVS G TPGLDM
Sbjct  138  EFLSLNSNNFAGPIPPSIGNLSNLTWLDLADNQLDGSIPVSSGTTPGLDM  187



>gb|AAF68126.1|AC010793_21 F20B17.5 [Arabidopsis thaliana]
Length=980

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 133/193 (69%), Gaps = 3/193 (2%)
 Frame = +1

Query  58   TMIPRIQLLLVPL---FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHW  228
            T+    +LLL+     F  F  I + TD  D  A+++L D W N PPSW    DPCG  W
Sbjct  6    TVTATSRLLLICFAYSFTVFSMISSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPW  65

Query  229  EGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY  408
            EGV CN SR+ +L LS+M L G LSGDI EL+EL+ LDLS+N+ LTGSL   +G+L+KL 
Sbjct  66   EGVSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNRGLTGSLTSRLGDLQKLN  125

Query  409  NLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGS  588
             LIL GCGF G IP+ +G L  L +L+LN N F G IP SLG L+++YWLDLADNQLTG 
Sbjct  126  ILILAGCGFTGTIPNELGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGP  185

Query  589  IPVSDGNTPGLDM  627
            IP+S G++PGLD+
Sbjct  186  IPISSGSSPGLDL  198



>ref|XP_010930348.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=952

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 124/169 (73%), Gaps = 1/169 (1%)
 Frame = +1

Query  121  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  300
            A TD  D   + +L   W N P +W  GSDPCGD W G+ C  SRV+S+TLSS+ LTG L
Sbjct  21   ADTDPQDAAVLNSLASSWDNTPSNWI-GSDPCGDKWVGISCTNSRVISITLSSLGLTGTL  79

Query  301  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  480
            SGDI+ L+ELQ LDLSYNK LTG +P  IG+L KL NLILVGC F G IP  IG+L +L 
Sbjct  80   SGDIQSLNELQALDLSYNKGLTGGIPASIGSLSKLVNLILVGCSFSGEIPPEIGNLPRLV  139

Query  481  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +LSLN N F G IP +LG LS+LYW DLADN+LTG+IPVSDGN PGLD+
Sbjct  140  FLSLNSNSFTGSIPKTLGNLSKLYWFDLADNKLTGTIPVSDGNKPGLDL  188



>ref|NP_178080.2| putative serine/threonine kinase [Arabidopsis thaliana]
 dbj|BAC42504.1| unknown protein [Arabidopsis thaliana]
 gb|ACN59279.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE36273.1| putative serine/threonine kinase [Arabidopsis thaliana]
Length=971

 Score =   190 bits (483),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 133/193 (69%), Gaps = 3/193 (2%)
 Frame = +1

Query  58   TMIPRIQLLLVPL---FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHW  228
            T+    +LLL+     F  F  I + TD  D  A+++L D W N PPSW    DPCG  W
Sbjct  6    TVTATSRLLLICFAYSFTVFSMISSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPW  65

Query  229  EGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY  408
            EGV CN SR+ +L LS+M L G LSGDI EL+EL+ LDLS+N+ LTGSL   +G+L+KL 
Sbjct  66   EGVSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNRGLTGSLTSRLGDLQKLN  125

Query  409  NLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGS  588
             LIL GCGF G IP+ +G L  L +L+LN N F G IP SLG L+++YWLDLADNQLTG 
Sbjct  126  ILILAGCGFTGTIPNELGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGP  185

Query  589  IPVSDGNTPGLDM  627
            IP+S G++PGLD+
Sbjct  186  IPISSGSSPGLDL  198



>gb|KFK27543.1| hypothetical protein AALP_AA8G397000 [Arabis alpina]
Length=401

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 133/187 (71%), Gaps = 2/187 (1%)
 Frame = +1

Query  70   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  249
            R  + ++  F Q   + A T+  D  A+KAL+ GW   P SW EGSDPCG +W G+ CN 
Sbjct  6    RAFMFMILFFFQISYVSAVTNGLDVYALKALKSGWSKFPESW-EGSDPCGTNWIGITCNN  64

Query  250  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  429
             RVVS++L + +L G+LS  I  LSEL ILDLSYN  L+G LP  IG+LKKL NL+LVGC
Sbjct  65   DRVVSISLVNFNLEGKLSSYISFLSELHILDLSYNTGLSGPLPPNIGDLKKLTNLVLVGC  124

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-  606
             F G IP+SIGSL +L YLSLN N+F G IP S+GQLS+LYW D+ DNQ+ G +P+S+G 
Sbjct  125  TFSGQIPESIGSLEQLMYLSLNSNQFSGTIPASIGQLSKLYWFDITDNQIEGKLPISNGT  184

Query  607  NTPGLDM  627
            ++PGLDM
Sbjct  185  SSPGLDM  191



>ref|XP_011028445.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Populus euphratica]
Length=952

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 125/176 (71%), Gaps = 1/176 (1%)
 Frame = +1

Query  100  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSS  279
            +Q L I A TD+ND  A+ +L+  WKN PP+W+ G DPCG  WEG+GC GSR+ S+ LS 
Sbjct  14   LQVLVITAATDSNDLSALNSLKSNWKNTPPNWS-GFDPCGGRWEGIGCTGSRITSIVLSG  72

Query  280  MDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSI  459
            M L+G LSGDI    ELQ LDLS N  LTG LP  I NLKKL NL LV C F G IPD I
Sbjct  73   MGLSGTLSGDIGNFPELQTLDLSQNNGLTGILPPAIVNLKKLENLFLVDCNFNGPIPDEI  132

Query  460  GslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            GSL+ L  LSL  N F GPIPPS+G++S L  LDL DN+L+G+IPVSDG +PGLD+
Sbjct  133  GSLTHLVSLSLASNNFNGPIPPSIGKMSNLSLLDLTDNKLSGTIPVSDGTSPGLDL  188



>ref|XP_002889259.1| hypothetical protein ARALYDRAFT_477135 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65518.1| hypothetical protein ARALYDRAFT_477135 [Arabidopsis lyrata subsp. 
lyrata]
Length=971

 Score =   190 bits (483),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 132/191 (69%), Gaps = 1/191 (1%)
 Frame = +1

Query  58   TMIPRIQLL-LVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  234
            T I R+ L+     F  F  I + TD  D  A+++L D W N PPSW    DPCG  WEG
Sbjct  8    TAISRLLLIGFAYSFTVFSIISSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPWEG  67

Query  235  VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  414
            V CN SR+ +L LS+M L G LSGDI EL+EL+ LDLS+N+ LTGSL   +G+L+KL  L
Sbjct  68   VSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNRGLTGSLTSRLGDLQKLNIL  127

Query  415  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIP  594
            IL GCGF G IP+ +G L  L +L+LN N F G IP SLG L+++YWLDLADNQLTG IP
Sbjct  128  ILAGCGFTGSIPNELGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGPIP  187

Query  595  VSDGNTPGLDM  627
            +S G++PGLD+
Sbjct  188  ISSGSSPGLDL  198



>ref|XP_006852584.1| hypothetical protein AMTR_s00021p00213800 [Amborella trichopoda]
 gb|ERN14051.1| hypothetical protein AMTR_s00021p00213800 [Amborella trichopoda]
Length=962

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 134/185 (72%), Gaps = 1/185 (1%)
 Frame = +1

Query  73   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  252
            + L L+    QF  I+  TD  D  A+ AL+   +N PP+W+ G+DPCG +W+GV C+ S
Sbjct  6    VLLFLLSTGFQFHLILGITDPGDGAAMIALKSYMQNTPPNWS-GADPCGSNWDGVSCSNS  64

Query  253  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  432
            RV++L LS+M L G L GDI  L+ELQ LDLS+N+DL GS+P+ I NLKKL  LIL GC 
Sbjct  65   RVIALKLSTMGLRGFLPGDIGSLTELQFLDLSFNQDLGGSIPKSIENLKKLTTLILAGCS  124

Query  433  FFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT  612
            F G IPD +GSL +L +L+LN NKF G IP SLG+LS+LYW DLADNQLTG +PVSDG  
Sbjct  125  FSGTIPDELGSLQELAFLALNTNKFTGRIPASLGKLSKLYWFDLADNQLTGGLPVSDGIN  184

Query  613  PGLDM  627
            PGLDM
Sbjct  185  PGLDM  189



>emb|CDY21455.1| BnaC03g27420D [Brassica napus]
Length=953

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 139/184 (76%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +LL+ LF Q L + A T+  D  A++AL+  W   P SW EG+DPCG  W G+ C+ +RV
Sbjct  9    MLLIFLFFQILSVSALTNGFDGPALQALKAEWTKPPSSW-EGADPCGTSWVGITCSNNRV  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            VS++L ++++ G+LSGDI  LSELQILDLSYN  LTG LP  IG LKKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSGDIAALSELQILDLSYNTGLTGPLPPNIGELKKLKNLILVGCSFT  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  615
            G IP+SIG L +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++PVS+G ++P
Sbjct  128  GQIPESIGQLEQLIYLSLNLNQFSGTIPASIGRLSKLYWFDIADNQIEGTLPVSNGTSSP  187

Query  616  GLDM  627
            GLDM
Sbjct  188  GLDM  191



>ref|XP_008442305.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Cucumis melo]
Length=965

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 132/190 (69%), Gaps = 1/190 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  237
            M P   LLL   F        +FTD  D  A+++LR+ W+N PPSW    DPCG  WEGV
Sbjct  1    MSPVETLLLFAFFYAGQDTAGSFTDPRDSAALESLRNEWQNTPPSWGASIDPCGTPWEGV  60

Query  238  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  417
             C  SRV +L LS+M L G+L GDI  L+EL+ LDLS+NKDLTGS+   +G+L+ L  LI
Sbjct  61   ACINSRVTALRLSTMGLKGKLGGDIGGLTELKSLDLSFNKDLTGSISPALGDLQNLSILI  120

Query  418  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  597
            L GCGF G IP+ +G+LS L +L+LN N F G IPPSLG+LS LYWLDLADNQLTGS+PV
Sbjct  121  LAGCGFSGSIPEQLGNLSNLSFLALNSNNFTGTIPPSLGKLSNLYWLDLADNQLTGSLPV  180

Query  598  SDGNTPGLDM  627
            S   TPGLD+
Sbjct  181  STSETPGLDL  190



>ref|XP_010065202.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=975

 Score =   189 bits (481),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 127/169 (75%), Gaps = 1/169 (1%)
 Frame = +1

Query  121  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  300
            A T+  D+ AI  L   W+  PP+W  G+DPCG++W G+ CN SRV S+ LSS  LTG L
Sbjct  41   AATNPYDFSAIMGLMTDWQIAPPNWV-GNDPCGNNWVGIVCNNSRVTSIILSSAGLTGPL  99

Query  301  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  480
            SGDI +LSELQ LDLS NK LTGSLP +IGNL KL +LILVGCGF G IPDS+GSL  L 
Sbjct  100  SGDIGQLSELQFLDLSNNKGLTGSLPEQIGNLMKLTHLILVGCGFSGQIPDSVGSLQNLV  159

Query  481  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +LSLN N+F G IP  +G LS LYWLDLADNQLTGSIPVS+G+  GLDM
Sbjct  160  HLSLNSNRFTGLIPAIIGNLSRLYWLDLADNQLTGSIPVSNGSNSGLDM  208



>ref|XP_010671953.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like protein kinase At5g49770 [Beta vulgaris subsp. 
vulgaris]
Length=945

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 140/186 (75%), Gaps = 5/186 (3%)
 Frame = +1

Query  79   LLLVPLFIQFLG-IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGC--NG  249
            LL+V  F  ++G I A T++ D+ A+ AL   W+N+PPSW  G + C   WEG+ C  NG
Sbjct  6    LLVVGFFCIYVGNIAAQTNSRDHAALVALTTDWENLPPSWT-GQNSCTS-WEGITCDANG  63

Query  250  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  429
            +R++++TL+SM L+G+L+GD+  LSELQILDLSYN+ LTGSLP +IG L +L NLIL+GC
Sbjct  64   TRIIAITLASMQLSGQLTGDLVFLSELQILDLSYNRGLTGSLPGDIGQLSRLTNLILLGC  123

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  609
               G IPDSIG L +L  LSLN N+F GP+P S+G L+ L+WLDL DN+LTGSIPVS G+
Sbjct  124  SLSGRIPDSIGLLQQLVSLSLNSNRFSGPVPASIGNLTNLFWLDLTDNRLTGSIPVSSGD  183

Query  610  TPGLDM  627
            TPGLD+
Sbjct  184  TPGLDL  189



>ref|XP_008782739.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
Length=960

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            TD  D  A+++L DGW+N PPSW +  DPCG  WEGV C  SRV  L LS+M L G LSG
Sbjct  23   TDPTDAAALRSLMDGWQNTPPSWGQSDDPCGTPWEGVNCINSRVTVLKLSTMGLKGTLSG  82

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            DI +LSELQ LDLSYN +L G L   IGNLKK+  LILVGC F G IP+ +G+L KL YL
Sbjct  83   DIGQLSELQTLDLSYNNELGGPLASNIGNLKKITTLILVGCSFSGQIPEELGNLEKLSYL  142

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            ++N NKF G IP SLG LS LYWLD+ADNQL+G IPVSD   PGLD 
Sbjct  143  AINSNKFTGRIPASLGTLSNLYWLDVADNQLSGPIPVSDNGAPGLDQ  189



>gb|KFK42372.1| hypothetical protein AALP_AA2G247300 [Arabis alpina]
Length=970

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 130/191 (68%), Gaps = 1/191 (1%)
 Frame = +1

Query  58   TMIPRIQLL-LVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  234
            T IPR  L+     F  F    + TD  D  A+++L D W N PPSW    DPCG  WEG
Sbjct  6    TAIPRFLLICFAYCFTVFSMTSSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPWEG  65

Query  235  VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  414
            V CN SR+ +L LS+M L G LSGDI EL+EL+ LDLS+N  LTGSL   +G+L+KL  L
Sbjct  66   VSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNPGLTGSLTSRLGDLQKLNIL  125

Query  415  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIP  594
            IL GCGF G IP+ +G L  L +L+LN N F G IP +LG L+++YWLDLADNQLTG IP
Sbjct  126  ILAGCGFTGSIPNELGYLKDLSFLALNSNNFTGKIPSALGNLTKVYWLDLADNQLTGPIP  185

Query  595  VSDGNTPGLDM  627
            +S G++PGLD+
Sbjct  186  ISSGSSPGLDL  196



>emb|CDX83184.1| BnaA03g23220D [Brassica napus]
Length=953

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 138/184 (75%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +LL+ LF Q L + A T+  D  A++AL+  W   P +W EG+DPCG  W G+ C+ +RV
Sbjct  9    MLLIFLFFQILSVSALTNGFDGSALQALKAEWTKPPSNW-EGADPCGTSWVGITCSNNRV  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            VS++L ++++ G+LSGDI  LSELQILDLSYN  LTG LP  IG LKKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSGDIAALSELQILDLSYNTGLTGPLPPNIGELKKLKNLILVGCSFT  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  615
            G IP SIG L +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++PVS+G ++P
Sbjct  128  GQIPQSIGQLEQLIYLSLNLNQFSGTIPASIGRLSKLYWFDIADNQIEGTLPVSNGTSSP  187

Query  616  GLDM  627
            GLDM
Sbjct  188  GLDM  191



>ref|XP_006389866.1| hypothetical protein EUTSA_v10018176mg [Eutrema salsugineum]
 gb|ESQ27152.1| hypothetical protein EUTSA_v10018176mg [Eutrema salsugineum]
Length=756

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 125/177 (71%), Gaps = 0/177 (0%)
 Frame = +1

Query  97   FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  276
            F  F  + + TD  D  AI++L D W N PPSW    DPCG  WEGV CN SR+ +L LS
Sbjct  23   FTVFSMVSSVTDPRDAAAIRSLMDQWDNTPPSWGGSDDPCGTPWEGVSCNDSRITALGLS  82

Query  277  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  456
            +M L G LSGDI EL+EL+ LDLS+N  LTGSL   +G+L+KL  LIL GCGF G IP+ 
Sbjct  83   TMGLKGRLSGDIGELAELRSLDLSFNPGLTGSLTSRLGDLQKLNILILAGCGFTGSIPNE  142

Query  457  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +G L  L +L+LN N F G IP SLG L+++YWLDLADNQLTG IP+S G++PGLD+
Sbjct  143  LGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGPIPISSGSSPGLDL  199



>ref|XP_010275979.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nelumbo nucifera]
Length=964

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 136/189 (72%), Gaps = 2/189 (1%)
 Frame = +1

Query  64   IPRIQLLLVPLFIQFLGIVAF-TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            IP + LL V  + +   + +  TD  D VA+++L++ W+N PPSW + +DPCG  WEGV 
Sbjct  4    IPAV-LLFVVCYAELHHMASSDTDTQDAVALQSLKEQWQNTPPSWGKSNDPCGAPWEGVT  62

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            C  SRV +L LS+M+L G LSGDI + +EL+ LDLS+N+ LTGSL   IG+L+KL  LIL
Sbjct  63   CTNSRVTALRLSTMNLKGTLSGDIGQFTELRSLDLSFNRGLTGSLSPRIGDLQKLNILIL  122

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
             GC F G IP  +G+L++L +L+LN N F G IPPSLG LS+LYWLDLADNQLTG IPVS
Sbjct  123  AGCSFTGSIPKELGNLAQLSFLALNSNNFTGGIPPSLGTLSKLYWLDLADNQLTGVIPVS  182

Query  601  DGNTPGLDM  627
               +PGLD+
Sbjct  183  TDKSPGLDL  191



>ref|XP_010441081.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=952

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 136/193 (70%), Gaps = 5/193 (3%)
 Frame = +1

Query  61   MIPRIQL--LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  234
            M  RI L  LL+ L +Q   +   TD  D  A++ L+  W  +  SW +GSDPCG+HW G
Sbjct  1    MSSRIGLFKLLILLVVQVCSVSTTTDGADSSALQVLKSEWTALSKSW-KGSDPCGNHWVG  59

Query  235  VGCNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN  411
            + CN + RVVS+ LS+++L G L  DI  LSEL+ILDLSYN  L+G+LP  IGNLK L N
Sbjct  60   ITCNNNNRVVSIMLSNLNLKGNLPADISTLSELEILDLSYNTGLSGALPSSIGNLKNLRN  119

Query  412  LILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSI  591
            LIL+GCGF G IP+SIGSL KL  LSLN N F G IP S+G+LSELYW D+ DNQ+ GSI
Sbjct  120  LILMGCGFSGQIPESIGSLEKLTTLSLNSNHFSGTIPASIGRLSELYWFDITDNQIEGSI  179

Query  592  PVSDG-NTPGLDM  627
            PVSDG + PGLDM
Sbjct  180  PVSDGISLPGLDM  192



>ref|XP_009128375.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=976

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 124/177 (70%), Gaps = 0/177 (0%)
 Frame = +1

Query  97   FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  276
            F  F  + + TD  D  A+++L D W N PPSW    DPCG  WEGV CN SR+ +L LS
Sbjct  23   FTVFSMVSSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPWEGVSCNNSRITALGLS  82

Query  277  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  456
            +M L G LSGDI ELSEL+ LDLS+N  LTGSL   + +L+KL  LIL GCGF G IP+ 
Sbjct  83   TMGLKGRLSGDIGELSELRSLDLSFNPGLTGSLTSRLRDLQKLNILILAGCGFTGSIPNE  142

Query  457  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            IG L  L +L+LN N F G IP SLG LS++YWLDLADNQLTG IP+S G++PGLD+
Sbjct  143  IGYLKDLSFLALNSNNFTGKIPASLGNLSKVYWLDLADNQLTGPIPISSGSSPGLDL  199



>ref|XP_010252249.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Nelumbo nucifera]
Length=915

 Score =   187 bits (474),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 134/186 (72%), Gaps = 5/186 (3%)
 Frame = +1

Query  82   LLVPLFIQFLGIVAF---TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  252
            LL+ + IQ     A    TD ND  A+ + +  WKN PP+W E SDPC   W GV CN S
Sbjct  12   LLLVVLIQISSAAAQQAPTDPNDAAALNSFKLMWKNRPPNW-ENSDPCVGGWVGVTCNNS  70

Query  253  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE-IGNLKKLYNLILVGC  429
            +V+S+ LSSM L G+LSGDI  L+ELQ LDLSYN+ L G LP E IG+LKKL NLILVGC
Sbjct  71   QVISIKLSSMGLEGQLSGDIGALTELQTLDLSYNRGLNGPLPAEAIGSLKKLSNLILVGC  130

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  609
             F G IP +IG L +L +LSLN N F G IPPS+G+LS+LYWLD+ADN+L+G+IPVS  +
Sbjct  131  SFSGRIPSTIGDLEELVFLSLNSNSFTGEIPPSIGKLSKLYWLDIADNKLSGTIPVSSSS  190

Query  610  TPGLDM  627
            TPGLDM
Sbjct  191  TPGLDM  196



>ref|XP_010252248.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Nelumbo nucifera]
Length=959

 Score =   187 bits (475),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 134/186 (72%), Gaps = 5/186 (3%)
 Frame = +1

Query  82   LLVPLFIQFLGIVAF---TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  252
            LL+ + IQ     A    TD ND  A+ + +  WKN PP+W E SDPC   W GV CN S
Sbjct  12   LLLVVLIQISSAAAQQAPTDPNDAAALNSFKLMWKNRPPNW-ENSDPCVGGWVGVTCNNS  70

Query  253  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE-IGNLKKLYNLILVGC  429
            +V+S+ LSSM L G+LSGDI  L+ELQ LDLSYN+ L G LP E IG+LKKL NLILVGC
Sbjct  71   QVISIKLSSMGLEGQLSGDIGALTELQTLDLSYNRGLNGPLPAEAIGSLKKLSNLILVGC  130

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  609
             F G IP +IG L +L +LSLN N F G IPPS+G+LS+LYWLD+ADN+L+G+IPVS  +
Sbjct  131  SFSGRIPSTIGDLEELVFLSLNSNSFTGEIPPSIGKLSKLYWLDIADNKLSGTIPVSSSS  190

Query  610  TPGLDM  627
            TPGLDM
Sbjct  191  TPGLDM  196



>ref|XP_009134023.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=953

 Score =   187 bits (475),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 137/184 (74%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +LL+ LF Q L + A T+  D  A++AL+  W   P +W EG+DPCG  W G+ C+ +RV
Sbjct  9    MLLIFLFFQILSVSALTNGFDGSALQALKAEWTKPPSNW-EGADPCGTSWVGITCSNNRV  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            VS++L ++++ G+LSGDI  LSELQILDLSYN  LTG LP  IG LKKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSGDIAALSELQILDLSYNTGLTGPLPPNIGELKKLKNLILVGCSFT  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  615
            G IP SIG L +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++P S+G ++P
Sbjct  128  GQIPQSIGQLEQLIYLSLNLNQFSGTIPASIGRLSKLYWFDIADNQIEGTLPASNGTSSP  187

Query  616  GLDM  627
            GLDM
Sbjct  188  GLDM  191



>emb|CDY61244.1| BnaCnng37500D [Brassica napus]
Length=953

 Score =   187 bits (474),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 135/184 (73%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +LL+ L  QFL + A T+  D  A++AL+  W   P +W  G+DPCG +W G+ C   RV
Sbjct  9    MLLILLCFQFLSVSALTNGFDASALQALKADWTKYPENWV-GADPCGTNWVGITCTNDRV  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            VS++L ++D+ G+LS DI  L+ELQILDLSYN +LTG LP  IG LKKL NLILV C F 
Sbjct  68   VSISLGNLDVEGKLSSDIASLTELQILDLSYNTELTGPLPSNIGQLKKLKNLILVACSFS  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  615
            G IP+SIG L +L YLSLNLN+F G IP S+G+LS LYW D+ADNQ+ G+IPVS+G ++P
Sbjct  128  GQIPESIGDLEQLIYLSLNLNQFSGRIPASIGRLSNLYWFDIADNQIEGTIPVSNGTSSP  187

Query  616  GLDM  627
            GLDM
Sbjct  188  GLDM  191



>ref|XP_006402242.1| hypothetical protein EUTSA_v10012589mg [Eutrema salsugineum]
 gb|ESQ43695.1| hypothetical protein EUTSA_v10012589mg [Eutrema salsugineum]
Length=953

 Score =   187 bits (474),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 137/184 (74%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +LL+ LF Q   + A T+  D  A++AL+  W   P SW EG+DPCG +W G+ C+  RV
Sbjct  9    MLLILLFFQTCSVSALTNGLDASALQALKAEWTTSPDSW-EGADPCGTNWVGITCSNDRV  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            VS++L ++++ G+LS DI  L ELQILDLSYN  LTG LP  IG LKKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSADIAALPELQILDLSYNTGLTGPLPPNIGQLKKLRNLILVGCSFT  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  615
            G IP+SIG+L +L YLSLNLNKF G IP S+G+LS+LYW D+ADNQ+ GSIPVS+G ++P
Sbjct  128  GQIPESIGNLEQLIYLSLNLNKFSGTIPASIGRLSKLYWFDIADNQIEGSIPVSNGTSSP  187

Query  616  GLDM  627
            GLDM
Sbjct  188  GLDM  191



>ref|XP_010442445.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Camelina sativa]
 ref|XP_010442446.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Camelina sativa]
Length=950

 Score =   187 bits (474),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 136/193 (70%), Gaps = 5/193 (3%)
 Frame = +1

Query  61   MIPRIQL--LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  234
            M  RI L  LL+ L +Q   + A TD +D  A++ L+  W  +  SW +GSDPCG+HW G
Sbjct  1    MSSRIGLFKLLILLVVQVCSVSAITDGSDSSALQVLKSEWTALSKSW-KGSDPCGNHWVG  59

Query  235  VGCNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN  411
            + CN + RVVS+ LS+++L G L  DI  LSEL+ILDLSYN  L+G+LP  IGNLK L  
Sbjct  60   ITCNNNNRVVSIMLSNLNLKGNLPADISTLSELEILDLSYNTGLSGALPSSIGNLKHLKR  119

Query  412  LILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSI  591
            LIL+GCGF G IP+SIGS+ KL  LSLN N F G IP S+G+LSELYW D+ DNQ+ G I
Sbjct  120  LILMGCGFSGQIPESIGSVEKLTTLSLNSNHFSGTIPASIGRLSELYWFDITDNQIEGKI  179

Query  592  PVSDG-NTPGLDM  627
            PVSDG + PGLDM
Sbjct  180  PVSDGISLPGLDM  192



>ref|XP_010417632.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=973

 Score =   187 bits (475),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 129/191 (68%), Gaps = 1/191 (1%)
 Frame = +1

Query  58   TMIPRIQLLLVPLFIQFLGIVA-FTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  234
            T   R+ L+       F  + +  TD  D  ++++L D W N PPSW    DPCG  WEG
Sbjct  8    TATSRLLLICFAYSFTFFSMTSSVTDPRDAASLRSLMDQWDNTPPSWGGSEDPCGTPWEG  67

Query  235  VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  414
            V CN SR+ +L LS+M L G LSGDI EL+EL+ LDLS+N  LTGSL   +G+L+KL  L
Sbjct  68   VSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNPGLTGSLTSRLGDLQKLNIL  127

Query  415  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIP  594
            IL GCGF G IP+ IG L  L +L+LN N F G IP SLG L+++YWLDLADNQLTG IP
Sbjct  128  ILAGCGFTGSIPNEIGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGPIP  187

Query  595  VSDGNTPGLDM  627
            +S G++PGLD+
Sbjct  188  ISSGSSPGLDL  198



>emb|CDY49740.1| BnaA02g19320D [Brassica napus]
Length=1396

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 124/177 (70%), Gaps = 0/177 (0%)
 Frame = +1

Query  97   FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  276
            F  F  + + TD  D  A+++L D W N PPSW    DPCG  WEGV CN SR+ +L LS
Sbjct  472  FTVFSMVSSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPWEGVSCNNSRITALGLS  531

Query  277  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  456
            +M L G LSGDI ELSEL+ LDLS+N  LTGSL   + +L+KL  LIL GCGF G IP+ 
Sbjct  532  TMGLKGRLSGDIGELSELRSLDLSFNPGLTGSLTSRLRDLQKLNILILAGCGFTGSIPNE  591

Query  457  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            IG L  L +L+LN N F G IP SLG LS++YWLDLADNQLTG IP+S G++PGLD+
Sbjct  592  IGYLKDLSFLALNSNNFTGKIPASLGNLSKVYWLDLADNQLTGPIPISSGSSPGLDL  648



>ref|XP_006358564.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=950

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 130/188 (69%), Gaps = 1/188 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            M  R  + L+    Q L I+  T++ND  A+ +L+  W N+PP+W EGSDPCG  W G+ 
Sbjct  4    MGSRSHVFLLIFVSQILAILGQTNSNDATALFSLKSSWNNLPPNW-EGSDPCGSSWAGIV  62

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            C+ SRV S+ LS M L G   GD+  L+ LQILDLS N  L G+LP  IGNLK L  LIL
Sbjct  63   CDNSRVTSIKLSGMGLEGNQFGDLSSLTALQILDLSNNVGLKGTLPPSIGNLKNLTTLIL  122

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            VGC FFG IP+SIGSL +L ++SL  N F GPIPPS+G LS+L WLDL+DN++ G+IP+S
Sbjct  123  VGCSFFGPIPESIGSLQQLVFISLTSNSFTGPIPPSIGNLSKLSWLDLSDNKINGTIPIS  182

Query  601  DGNTPGLD  624
             G+T GLD
Sbjct  183  QGSTLGLD  190



>ref|XP_002323702.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF05463.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=978

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            I + TD +D  A+++L+  W+N PPSW +  DPCG  WEGV C+ SR+ +L LS+M+L G
Sbjct  24   IFSDTDPSDAAALQSLKKQWQNTPPSWGQSHDPCGAPWEGVTCSNSRITALGLSTMNLKG  83

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            +LSGDI  L+EL+ LDLS+N +LTGSL    G+L KL  LIL GCGF G IPD +G+L++
Sbjct  84   KLSGDIGGLTELRSLDLSFNTNLTGSLTPRFGDLLKLNILILAGCGFSGSIPDELGNLAE  143

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            L +L+LN N F G IPPSLG+LS+LYWLDLADNQLTG IP+S   TPGLD+
Sbjct  144  LSFLALNSNNFSGGIPPSLGKLSKLYWLDLADNQLTGPIPISKNTTPGLDL  194



>ref|XP_009118911.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=940

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 134/184 (73%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +LL+ L  QFL + A T+  D  A++AL+  W   P SW  G+DPCG +W G+ C   RV
Sbjct  9    MLLILLCFQFLSVSALTNGFDASALQALKADWTKYPESWV-GADPCGTNWVGITCTNDRV  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            VS++L ++D+ G+LS DI  L+ELQILDLSYN  LTG LP  IG LKKL NLILV C F 
Sbjct  68   VSISLGNLDVEGKLSSDIASLTELQILDLSYNTGLTGPLPSNIGQLKKLKNLILVACSFS  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  615
            G IP+SIG L +L YLSLNLN+F G IP S+G+LS LYW D+ADNQ+ G++PVS+G ++P
Sbjct  128  GQIPESIGDLEQLIYLSLNLNQFSGRIPASIGRLSNLYWFDIADNQIEGTLPVSNGTSSP  187

Query  616  GLDM  627
            GLDM
Sbjct  188  GLDM  191



>ref|XP_011012973.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Populus euphratica]
Length=978

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 134/183 (73%), Gaps = 5/183 (3%)
 Frame = +1

Query  94   LFIQFLG-----IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            LF+ F       I + TD +D  A+++L+  W+N PPSW +  DPCG  WEGV C+ SR+
Sbjct  12   LFLTFFTSGIHLIFSDTDPSDAAALQSLKRQWQNTPPSWGQSPDPCGAPWEGVTCSNSRI  71

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
             +L LS+M+L G+LSGDI  L+EL+ LDLS+N +LTGSL   +G+L KL  LIL GCGF 
Sbjct  72   TALGLSTMNLKGKLSGDIGGLTELRSLDLSFNTNLTGSLTPRLGDLLKLNILILAGCGFS  131

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  618
            G IPD +G+L++L +L+LN N F G IPPSLG+LS+LYWLDLADNQLTG IP+S   TPG
Sbjct  132  GSIPDELGNLAELSFLALNSNNFSGGIPPSLGKLSKLYWLDLADNQLTGPIPISKNTTPG  191

Query  619  LDM  627
            LD+
Sbjct  192  LDL  194



>ref|XP_008802221.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
Length=967

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 127/169 (75%), Gaps = 1/169 (1%)
 Frame = +1

Query  121  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  300
            A TD  D  A+ +L   W+N P +W  GSDPCG++W G+ C  SRV+S+TLSS+ L G L
Sbjct  37   AETDPQDAAALNSLASLWENTPSNWI-GSDPCGNNWVGISCTNSRVISITLSSLGLIGTL  95

Query  301  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  480
            SGDI+ L+ELQ LDLSYNK L G +P  IG+L KL NLILVGC F G IP  IG+L++L 
Sbjct  96   SGDIQSLNELQALDLSYNKGLNGGIPASIGSLSKLVNLILVGCSFSGKIPPEIGNLARLV  155

Query  481  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +LSLN N F G IP ++G LS+LYWLD+ADN+LTG+IPVSDGN PGLD+
Sbjct  156  FLSLNSNGFTGSIPETVGNLSKLYWLDMADNKLTGTIPVSDGNKPGLDL  204



>emb|CDY22287.1| BnaC02g25910D [Brassica napus]
Length=1719

 Score =   187 bits (475),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 124/177 (70%), Gaps = 0/177 (0%)
 Frame = +1

Query  97   FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  276
            F  F  + + TD  D  A+++L D W N PPSW    DPCG  WEGV CN SR+ +L LS
Sbjct  381  FTVFSMVSSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPWEGVSCNSSRITALGLS  440

Query  277  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  456
            +M L G LSGDI ELSEL+ LDLS+N  LTGSL   + +L+KL  LIL GCGF G IP+ 
Sbjct  441  TMGLKGRLSGDIGELSELRSLDLSFNPGLTGSLTSRLRDLQKLNILILAGCGFTGSIPNE  500

Query  457  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            IG L  L +L+LN N F G IP SLG LS++YWLDLADNQLTG IP+S G++PGLD+
Sbjct  501  IGYLKDLSFLALNSNNFTGKIPASLGNLSKVYWLDLADNQLTGPIPISSGSSPGLDL  557


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  505  FIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            F G IP SLG LS++YWLDLADNQLTG IP+S G++PGLD+
Sbjct  916  FTGKIPASLGNLSKVYWLDLADNQLTGPIPISSGSSPGLDL  956



>gb|EEE52938.1| hypothetical protein OsJ_35570 [Oryza sativa Japonica Group]
Length=967

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 128/186 (69%), Gaps = 1/186 (1%)
 Frame = +1

Query  67   PRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  246
            P I + L+ + +Q     A T+  D   +  L   W + P +WA G+DPCGD W G+ C 
Sbjct  5    PWIIIFLLIVLVQAFVASADTNAQDTSGLNGLAGSWGSAPSNWA-GNDPCGDKWIGIICT  63

Query  247  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  426
            G+RV S+ LSS  L+G LSGDI+ LSELQ LDLSYNK+L G LP  IG L KL NLILVG
Sbjct  64   GNRVTSIRLSSFGLSGTLSGDIQSLSELQYLDLSYNKNLNGPLPSTIGTLSKLQNLILVG  123

Query  427  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  606
            CGF G IP  IG LS L +LSLN NKF G IPPSLG LS+LYW DLADNQLTG +P+S+ 
Sbjct  124  CGFTGEIPKEIGQLSNLIFLSLNSNKFTGSIPPSLGGLSKLYWFDLADNQLTGGLPISNA  183

Query  607  NTPGLD  624
             +PGLD
Sbjct  184  TSPGLD  189



>emb|CDP08081.1| unnamed protein product [Coffea canephora]
Length=962

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 132/185 (71%), Gaps = 2/185 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            L  + +  +F GI ++TD  D   +++L+D W+N PP+W +  DPCG  WEGV CN SRV
Sbjct  8    LFYLVMSARFRGIFSYTDPRDVAVLRSLKDQWQNTPPNWGKSDDPCGAPWEGVSCNNSRV  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
             +L LSSM L+G+L+GDI  L+EL  LDLS+N+ LTGSL   IG+L+ L  LIL GC F 
Sbjct  68   TALGLSSMGLSGKLNGDIGGLTELISLDLSFNRGLTGSLSPRIGDLQNLSILILAGCSFN  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG--NT  612
            G +P  +G+L++L +L+LN N F G IPPSLG+LS LYWLDLADNQLTG IPVS     T
Sbjct  128  GNVPSELGNLAQLSFLALNSNNFTGGIPPSLGKLSHLYWLDLADNQLTGPIPVSSSMTET  187

Query  613  PGLDM  627
            PGLD+
Sbjct  188  PGLDL  192



>ref|NP_001066400.1| Os12g0210400 [Oryza sativa Japonica Group]
 gb|ABA96703.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29419.1| Os12g0210400 [Oryza sativa Japonica Group]
 dbj|BAG91081.1| unnamed protein product [Oryza sativa Japonica Group]
Length=967

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 128/186 (69%), Gaps = 1/186 (1%)
 Frame = +1

Query  67   PRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  246
            P I + L+ + +Q     A T+  D   +  L   W + P +WA G+DPCGD W G+ C 
Sbjct  5    PWIIIFLLIVLVQAFVASADTNAQDTSGLNGLAGSWGSAPSNWA-GNDPCGDKWIGIICT  63

Query  247  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  426
            G+RV S+ LSS  L+G LSGDI+ LSELQ LDLSYNK+L G LP  IG L KL NLILVG
Sbjct  64   GNRVTSIRLSSFGLSGTLSGDIQSLSELQYLDLSYNKNLNGPLPSTIGTLSKLQNLILVG  123

Query  427  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  606
            CGF G IP  IG LS L +LSLN NKF G IPPSLG LS+LYW DLADNQLTG +P+S+ 
Sbjct  124  CGFTGEIPKEIGQLSNLIFLSLNSNKFTGSIPPSLGGLSKLYWFDLADNQLTGGLPISNA  183

Query  607  NTPGLD  624
             +PGLD
Sbjct  184  TSPGLD  189



>ref|XP_006300598.1| hypothetical protein CARUB_v10019721mg, partial [Capsella rubella]
 gb|EOA33496.1| hypothetical protein CARUB_v10019721mg, partial [Capsella rubella]
Length=982

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 133/198 (67%), Gaps = 3/198 (2%)
 Frame = +1

Query  43   MVI**TMIPRIQLLLVPL---FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDP  213
            MV   T+    +LLL+     F  F    + TD  D  ++++L D W N PPSW    DP
Sbjct  9    MVASNTVTATSRLLLICFSYSFTVFSLTSSVTDPRDAASLRSLMDQWDNTPPSWGGSDDP  68

Query  214  CGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGN  393
            CG  WEGV CN SR+ +L LS+M L G LSGDI EL+EL+ LDLS+N  LTGSL   +G+
Sbjct  69   CGTPWEGVSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNPGLTGSLTSRLGD  128

Query  394  LKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADN  573
            L+KL  LIL GCGF G IP+ +G L  L +L+LN N F G IP SLG L+++YWLDLADN
Sbjct  129  LQKLNILILAGCGFTGSIPNELGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADN  188

Query  574  QLTGSIPVSDGNTPGLDM  627
            QLTG IP+S G++PGLD+
Sbjct  189  QLTGPIPISSGSSPGLDL  206



>gb|KHN40741.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=945

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = +1

Query  118  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE  297
            VA   N+D+  +K+LR  W +  P+W EGSDPC D WEG+ C  SRV+S++LS + LTG 
Sbjct  22   VAQDVNSDFAVLKSLRGSWLSPTPNW-EGSDPCKD-WEGIKCKNSRVISISLSDIGLTGH  79

Query  298  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  477
            LSGDI  LSEL+ILDLSYN+ LTGSLP+EIGNLKKL  L+LVGCGF G IPD IG L +L
Sbjct  80   LSGDIGSLSELEILDLSYNRGLTGSLPQEIGNLKKLLKLVLVGCGFTGRIPDEIGFLEQL  139

Query  478  kylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
             +LSLN N F+GPIPPS+G LS L WLDLADNQL GSIPVS G T GLDM
Sbjct  140  VFLSLNSNNFVGPIPPSIGNLSNLTWLDLADNQLDGSIPVSSGTTSGLDM  189



>ref|XP_002269419.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Vitis vinifera]
Length=944

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 139/188 (74%), Gaps = 8/188 (4%)
 Frame = +1

Query  76   QLLLVPL---FIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGC  243
            +L+LV L   FIQF     A T+ +D  A+K+L    KN+P +W  G+DPC + WEG+GC
Sbjct  4    RLILVSLLIVFIQFNSATWASTNTDDATALKSL---LKNLPFTWV-GADPCVNGWEGIGC  59

Query  244  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV  423
            +  RV+S+TL+SMDL GELS D + LSEL+ILDLSYNK LTG++P  IG+LK L NLIL+
Sbjct  60   SNGRVISITLASMDLKGELSEDFQGLSELKILDLSYNKGLTGNIPASIGSLKSLTNLILM  119

Query  424  GCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD  603
            GC F G IPD+IGSL+ L  LSLN N F G IPPS+G L  L WLD+ +NQ+TG+IP+S+
Sbjct  120  GCSFSGQIPDTIGSLTNLVVLSLNSNSFSGVIPPSIGNLYNLNWLDITENQITGTIPISN  179

Query  604  GNTPGLDM  627
            G TPGLDM
Sbjct  180  GGTPGLDM  187



>emb|CDX83183.1| BnaA03g23230D [Brassica napus]
Length=812

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 133/184 (72%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +LL+ LF Q   + A T+  D  A++AL+  W   P SW +G DPCG  W G+ C   RV
Sbjct  9    MLLIFLFFQIFSVSALTNGFDGAALQALKAEWTKPPSSW-DGDDPCGTSWVGITCISDRV  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            VS++L ++++ G+LSGDI  LSELQILDLSYN  LTG LP  IG  KKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSGDIAALSELQILDLSYNTGLTGPLPPNIGETKKLKNLILVGCSFT  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT-P  615
            G IP+SIG L +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++PVS+G + P
Sbjct  128  GQIPESIGKLEQLIYLSLNLNQFSGTIPASIGRLSKLYWFDIADNQIEGTLPVSNGTSLP  187

Query  616  GLDM  627
            GLDM
Sbjct  188  GLDM  191



>ref|XP_009134024.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=899

 Score =   184 bits (466),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 133/184 (72%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +LL+ LF Q   + A T+  D  A++AL+  W   P SW +G DPCG  W G+ C   RV
Sbjct  9    MLLIFLFFQIFSVSALTNGFDGAALQALKAEWTKPPSSW-DGDDPCGTSWVGITCISDRV  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            VS++L ++++ G+LSGDI  LSELQILDLSYN  LTG LP  IG  KKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSGDIAALSELQILDLSYNTGLTGPLPPNIGETKKLKNLILVGCSFT  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT-P  615
            G IP+SIG L +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++PVS+G + P
Sbjct  128  GQIPESIGKLEQLIYLSLNLNQFSGTIPASIGRLSKLYWFDIADNQIEGTLPVSNGTSLP  187

Query  616  GLDM  627
            GLDM
Sbjct  188  GLDM  191



>ref|XP_010314121.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Solanum lycopersicum]
Length=950

 Score =   184 bits (467),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 129/188 (69%), Gaps = 1/188 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            M  R  + L+    Q L I+  T++ND  A+ AL+  W N+PP+W EGSDPCG  W G+ 
Sbjct  4    MGSRSHVFLLIFVSQILAILGQTNSNDATALFALKSSWNNLPPNW-EGSDPCGSSWAGLI  62

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            C+ SRV S+ LS M L G   GD+  L+ LQILDLS N  L G+LP  IGNLK L  LIL
Sbjct  63   CDNSRVTSIKLSGMGLEGNQFGDLSSLAALQILDLSNNVGLKGTLPPSIGNLKNLTTLIL  122

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            VGC FFG IP+SIGSL +L ++SL  N F GPIPPS+G LS+L WLDL+DN++ G+IP+S
Sbjct  123  VGCSFFGPIPESIGSLQQLVFISLTSNSFTGPIPPSIGNLSKLSWLDLSDNKINGTIPIS  182

Query  601  DGNTPGLD  624
             G+  GLD
Sbjct  183  QGSALGLD  190



>ref|XP_010441110.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=247

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 133/184 (72%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +LL+ LF Q   + A T++ D VA+ AL+      P +W +G DPCG +W G+ C+  RV
Sbjct  9    MLLILLFFQISSVSALTNSIDAVALLALKSELTGTPKNW-KGFDPCGTNWVGISCSNGRV  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            V+++LS+++L G+LS DI  LSEL  LDL+ N ++TG LP  IGNLKKL  L L+GCGF 
Sbjct  68   VNISLSNLNLQGKLSADISTLSELVTLDLTSNSNITGPLPPNIGNLKKLTELNLMGCGFD  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  615
            G IP+SIG+L KL  LSLN NKF G IP S+G+LS+LYW D+ADNQ+ G IPVS+G ++P
Sbjct  128  GQIPESIGNLEKLTKLSLNSNKFNGKIPASMGRLSKLYWFDIADNQIEGEIPVSNGTSSP  187

Query  616  GLDM  627
            GLDM
Sbjct  188  GLDM  191



>gb|KJB57523.1| hypothetical protein B456_009G167900 [Gossypium raimondii]
Length=959

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 128/183 (70%), Gaps = 2/183 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            L LV +      + A TD +D  +++A+   WKNVP +W  G DPC D W G+GC GSRV
Sbjct  7    LFLVVVLFHIYIVAAETDPDDNSSLRAVMSEWKNVPSNWGRG-DPCDDKWVGIGCTGSRV  65

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
             SL L +M L G L GDI  LSEL+ LDLSYNK L G LP  + NLKKL NLILVGCGF 
Sbjct  66   TSLNLPNMKLEGRLVGDIFFLSELKELDLSYNKGLRGILPPAVQNLKKLENLILVGCGFS  125

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN-TP  615
            G IPD+IGSL +L+ LSLN N F G IPPS+G LS L WLD+ADNQL G IPVS+G+ TP
Sbjct  126  GQIPDTIGSLPQLRILSLNSNAFSGNIPPSIGNLSTLNWLDMADNQLEGEIPVSNGSTTP  185

Query  616  GLD  624
            GLD
Sbjct  186  GLD  188



>gb|KFK26616.1| hypothetical protein AALP_AA8G271800 [Arabis alpina]
Length=952

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 136/184 (74%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +LL+ LF     + A T+  D  A++AL+  W   P  W EGSDPCG +W G+ C   R+
Sbjct  9    MLLILLFFHICYVSALTNGLDASALQALKSEWTRSPEGW-EGSDPCGTNWVGITCINDRI  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            VS+++++++L G+LSGDI  L+ELQILDLS++  L+G LP  IG+LKKL NLILVGC F 
Sbjct  68   VSISVANLNLEGKLSGDISALTELQILDLSFSTGLSGPLPPNIGDLKKLRNLILVGCSFS  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  615
            G IPDSIGSL +L YLSLN N+F G IP S+G+LS+LYW D+ADNQL G IPVS+G ++P
Sbjct  128  GQIPDSIGSLEQLIYLSLNSNQFSGTIPASIGRLSKLYWFDIADNQLEGEIPVSNGASSP  187

Query  616  GLDM  627
            GLDM
Sbjct  188  GLDM  191



>ref|XP_010038738.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=959

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 130/185 (70%), Gaps = 1/185 (1%)
 Frame = +1

Query  70   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  249
            R+   L  L      I +FTD  D  A++ALR  W+N PPSWA+  DPCG  W+GV CN 
Sbjct  3    RLVFFLAILLAGIHVICSFTDPGDSAALQALRGIWQNTPPSWAK-DDPCGVPWDGVTCNN  61

Query  250  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  429
             RV +L LSSM++ G LSGDI  L+EL+ LDLS+N+DLTGSL   +G+L  L  LIL GC
Sbjct  62   LRVTALGLSSMNIKGSLSGDIGGLTELRSLDLSFNQDLTGSLTARLGDLSNLNTLILQGC  121

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  609
            GF G IPD +G LS+L +L+LN NKF G IP SLG LS+L WLDLA+NQLTGSIP+S  N
Sbjct  122  GFTGNIPDELGKLSQLTFLALNNNKFTGSIPASLGNLSQLSWLDLAENQLTGSIPLSHNN  181

Query  610  TPGLD  624
             PGLD
Sbjct  182  NPGLD  186



>gb|KCW47574.1| hypothetical protein EUGRSUZ_K01321 [Eucalyptus grandis]
Length=955

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 130/185 (70%), Gaps = 1/185 (1%)
 Frame = +1

Query  70   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  249
            R+   L  L      I +FTD  D  A++ALR  W+N PPSWA+  DPCG  W+GV CN 
Sbjct  3    RLVFFLAILLAGIHVICSFTDPGDSAALQALRGIWQNTPPSWAK-DDPCGVPWDGVTCNN  61

Query  250  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  429
             RV +L LSSM++ G LSGDI  L+EL+ LDLS+N+DLTGSL   +G+L  L  LIL GC
Sbjct  62   LRVTALGLSSMNIKGSLSGDIGGLTELRSLDLSFNQDLTGSLTARLGDLSNLNTLILQGC  121

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  609
            GF G IPD +G LS+L +L+LN NKF G IP SLG LS+L WLDLA+NQLTGSIP+S  N
Sbjct  122  GFTGNIPDELGKLSQLTFLALNNNKFTGSIPASLGNLSQLSWLDLAENQLTGSIPLSHNN  181

Query  610  TPGLD  624
             PGLD
Sbjct  182  NPGLD  186



>ref|XP_003535032.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Glycine max]
Length=945

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = +1

Query  118  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE  297
            VA   N+D++ +K+LR  W +  P+W EGSDPC D WEG+ C  SRV+S++L  + LTG 
Sbjct  22   VAQDVNSDFLVLKSLRGSWLSPTPNW-EGSDPCKD-WEGIKCKNSRVISISLPDIGLTGH  79

Query  298  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  477
            LSGDI  LSEL+ILDLSYN+ LTGSLP+EIGNLKKL  L+LVGCGF G IPD IG L +L
Sbjct  80   LSGDIGSLSELEILDLSYNRGLTGSLPQEIGNLKKLLKLVLVGCGFTGRIPDEIGFLEQL  139

Query  478  kylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
             +LSLN N F+GPIPPS+G LS L WLDLADNQL GSIPVS G T GLDM
Sbjct  140  VFLSLNSNNFVGPIPPSIGNLSNLTWLDLADNQLDGSIPVSSGTTSGLDM  189



>ref|XP_010930467.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=970

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 126/169 (75%), Gaps = 1/169 (1%)
 Frame = +1

Query  121  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  300
            A TD  D  A+ +L   W+N P +W  GSDPCGD+W G+ CN S V+++TLSS+ L G L
Sbjct  37   AETDPQDADALISLASSWENPPSNWI-GSDPCGDNWVGISCNNSHVIAITLSSLGLIGTL  95

Query  301  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  480
            SGDI+ L+EL+ LDLSYNK LTG +P  IG+L KL NL+LV C F G IP  IG+L +L 
Sbjct  96   SGDIQSLNELRALDLSYNKGLTGGIPASIGSLSKLINLVLVDCSFSGEIPREIGNLPRLV  155

Query  481  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +L+LN N F G IP +LG LS+LYWLDLADN+LTG+IPVSDGN PGLD+
Sbjct  156  FLALNSNSFTGTIPETLGNLSKLYWLDLADNKLTGTIPVSDGNKPGLDL  204



>ref|XP_010921260.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=602

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 129/184 (70%), Gaps = 1/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVA-FTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR  255
            LLL+ +F+  L + +  TD  D   +++L   W+N PP+W +  DPCG  W GV C+ SR
Sbjct  5    LLLLLVFVAGLQVSSGTTDLTDAAVLRSLMGEWQNTPPNWGQSDDPCGTPWIGVNCSNSR  64

Query  256  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  435
            V  L LS+M L G LSGDI +LSELQILDLSYNK+L G LP  IGNLKK+  LIL+GC F
Sbjct  65   VTVLKLSTMGLKGTLSGDIGQLSELQILDLSYNKELGGQLPANIGNLKKINTLILIGCNF  124

Query  436  FGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP  615
             G IP+ +G++  L +L+LN NKF G IP SLG LS LY LD+ADNQL+G IP+S+  TP
Sbjct  125  GGEIPEELGNIGNLSFLALNSNKFTGRIPASLGTLSHLYLLDVADNQLSGPIPISNNGTP  184

Query  616  GLDM  627
            GLD 
Sbjct  185  GLDQ  188



>gb|KGN59773.1| hypothetical protein Csa_3G844910 [Cucumis sativus]
Length=771

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 132/183 (72%), Gaps = 1/183 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAF-TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR  255
            L++  LF+ F  + A  TD+ D   +++L+DGW+N PPSW   +DPCG  W+GV C  SR
Sbjct  41   LVVSLLFLDFFYLAASSTDSRDSSVLQSLKDGWQNTPPSWGTSNDPCGTPWDGVICKNSR  100

Query  256  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  435
            VV+L LSSM L G+L GDI  L+EL+ LDL+ N+DL GS+ R +GNL KL  LIL  CGF
Sbjct  101  VVALKLSSMGLKGKLGGDIGGLTELRSLDLAANRDLVGSISRALGNLLKLDTLILSTCGF  160

Query  436  FGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP  615
             G IP+ +G+LS+L +LSL  N F G IP +LG+LS+LYWLDLADNQLTG++PVS   + 
Sbjct  161  SGKIPEELGNLSELTFLSLYSNSFTGTIPATLGKLSKLYWLDLADNQLTGALPVSTSGSS  220

Query  616  GLD  624
            GLD
Sbjct  221  GLD  223



>ref|XP_010429861.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=973

 Score =   182 bits (462),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 128/191 (67%), Gaps = 1/191 (1%)
 Frame = +1

Query  58   TMIPRIQLLLVPLFIQFLGIVA-FTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  234
            T   R+ L+        L + +  TD  D  ++++L D W N PPSW    DPCG  WEG
Sbjct  8    TATSRLLLICFAYSFSVLSMTSSVTDPRDAASLRSLMDQWDNTPPSWGGSDDPCGTPWEG  67

Query  235  VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  414
            V CN SR+ +L LS+M L G LSGDI EL+EL+ LD+S+N  LTGSL   +G+L KL  L
Sbjct  68   VSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDISFNPGLTGSLTSRLGDLPKLNIL  127

Query  415  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIP  594
            IL GCGF G IP+ IG L  L +L+LN N F G IP SLG L+++YWLDLADNQLTG IP
Sbjct  128  ILAGCGFTGSIPNEIGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGPIP  187

Query  595  VSDGNTPGLDM  627
            +S G++PGLD+
Sbjct  188  ISSGSSPGLDL  198



>ref|NP_199787.2| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 dbj|BAC41801.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|AAP21294.1| At5g49760 [Arabidopsis thaliana]
 gb|ACN59388.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED95854.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=953

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 131/184 (71%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            LLL+  F Q   + A T+  D  A+ AL+  W   P  W EGSDPCG +W G+ C   RV
Sbjct  9    LLLILFFFQICSVSALTNGLDASALNALKSEWTTPPDGW-EGSDPCGTNWVGITCQNDRV  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            VS++L ++DL G+L  DI  LSEL+ILDLSYN  L+G LP  IGNL KL NLILVGC F 
Sbjct  68   VSISLGNLDLEGKLPADISFLSELRILDLSYNPKLSGPLPPNIGNLGKLRNLILVGCSFS  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT-P  615
            G IP+SIG+L +L YLSLNLNKF G IPPS+G LS+LYW D+ADNQ+ G +PVS+G + P
Sbjct  128  GQIPESIGTLKELIYLSLNLNKFSGTIPPSIGLLSKLYWFDIADNQIEGELPVSNGTSAP  187

Query  616  GLDM  627
            GLDM
Sbjct  188  GLDM  191



>ref|XP_010482269.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=955

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 135/184 (73%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            ++L+ LF     +   T+  D  A++A++  W   P +W EGSDPCG +W G+ C+  R+
Sbjct  13   MILILLFFHICCVYGLTNGPDATALQAVKSEWTKFPKNW-EGSDPCGTNWVGITCSNDRI  71

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            VS++L ++DL G+LS DI  LSELQILDL+ N +LTG LP  IGNLKKL  L L+GCGF 
Sbjct  72   VSISLGNVDLEGKLSADIAALSELQILDLTSNPNLTGPLPPNIGNLKKLVILNLMGCGFS  131

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  615
            G IP+SIGSL +L  LSLN NKFIG IP S+G+LS+L+WLD+ADNQ+ G +PVS+G ++P
Sbjct  132  GQIPESIGSLEQLTTLSLNSNKFIGTIPASIGRLSQLFWLDIADNQIEGKLPVSNGTSSP  191

Query  616  GLDM  627
            GLDM
Sbjct  192  GLDM  195



>dbj|BAA98164.1| receptor protein kinase-like [Arabidopsis thaliana]
Length=941

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 131/184 (71%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            LLL+  F Q   + A T+  D  A+ AL+  W   P  W EGSDPCG +W G+ C   RV
Sbjct  9    LLLILFFFQICSVSALTNGLDASALNALKSEWTTPPDGW-EGSDPCGTNWVGITCQNDRV  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            VS++L ++DL G+L  DI  LSEL+ILDLSYN  L+G LP  IGNL KL NLILVGC F 
Sbjct  68   VSISLGNLDLEGKLPADISFLSELRILDLSYNPKLSGPLPPNIGNLGKLRNLILVGCSFS  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT-P  615
            G IP+SIG+L +L YLSLNLNKF G IPPS+G LS+LYW D+ADNQ+ G +PVS+G + P
Sbjct  128  GQIPESIGTLKELIYLSLNLNKFSGTIPPSIGLLSKLYWFDIADNQIEGELPVSNGTSAP  187

Query  616  GLDM  627
            GLDM
Sbjct  188  GLDM  191



>ref|XP_007206754.1| hypothetical protein PRUPE_ppa025198mg [Prunus persica]
 gb|EMJ07953.1| hypothetical protein PRUPE_ppa025198mg [Prunus persica]
Length=416

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 124/171 (73%), Gaps = 0/171 (0%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            I + TD ND   + +L++ W+N PPSW + +DPC   WEGV CN SRV  L LS++ L G
Sbjct  21   ISSVTDPNDAAVLLSLKNSWQNTPPSWDKSNDPCDSRWEGVTCNNSRVSGLGLSNISLKG  80

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            +L GDI  L EL+ LDLS+N  LTG L   +GNLK L  LIL GC F G IPD +G+L++
Sbjct  81   KLYGDIGGLIELKSLDLSFNPGLTGPLSPRLGNLKNLSILILAGCSFNGEIPDELGNLAE  140

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            L +L+LN N F G IPPSLG+LS+LYWLDLADNQLTG+IP+S  ++PGLD+
Sbjct  141  LSFLALNSNNFSGVIPPSLGKLSKLYWLDLADNQLTGTIPISTYHSPGLDL  191



>ref|XP_009370844.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=959

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 123/171 (72%), Gaps = 0/171 (0%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            I + T  +D  A+++LR  W NVPPSW + +DPCG+ WEG+ C+GSRV +L LS M++ G
Sbjct  18   ISSSTHLDDANALQSLRQKWINVPPSWDKSNDPCGESWEGITCHGSRVTALGLSGMNVEG  77

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            ++ GDI  LSEL+ LDLS+NK LTGSL   +G+L  L  LIL GC F G+IP  +G L +
Sbjct  78   KIEGDIAGLSELRFLDLSFNKGLTGSLSPRLGDLSNLNILILAGCSFSGIIPSELGKLGE  137

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            L +L+LN N F G IP SLG LS LYWLDLADNQLTG +PVS G TPGLD 
Sbjct  138  LTFLALNTNNFTGSIPASLGNLSNLYWLDLADNQLTGPLPVSSGTTPGLDQ  188



>ref|XP_010688349.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Beta vulgaris subsp. vulgaris]
Length=962

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 132/186 (71%), Gaps = 0/186 (0%)
 Frame = +1

Query  70   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  249
            R+ LL +  F +   I+  TD+ D  A+ +L+  W+N PPSW++  DPC   WEGV CN 
Sbjct  5    RVLLLCLLGFAKVNLILCLTDSGDAAALHSLKAQWQNTPPSWSKSDDPCAAPWEGVTCNK  64

Query  250  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  429
            SR+ +L LS+M L G+LSGDI  L+EL+ LDLS+N+ LTGSL   +G+L+KL  LIL GC
Sbjct  65   SRITALGLSTMGLKGKLSGDIGGLTELRSLDLSFNRGLTGSLTPRLGDLQKLNILILAGC  124

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  609
             F G IP  +G+L++L +L+LN N   G IP SLG LS+LYWLDLADNQL+GSIP S  N
Sbjct  125  SFSGSIPMELGNLAELSFLALNSNNLTGEIPHSLGNLSKLYWLDLADNQLSGSIPTSTPN  184

Query  610  TPGLDM  627
            TPGLD+
Sbjct  185  TPGLDL  190



>ref|XP_007154094.1| hypothetical protein PHAVU_003G0900000g, partial [Phaseolus vulgaris]
 gb|ESW26088.1| hypothetical protein PHAVU_003G0900000g, partial [Phaseolus vulgaris]
Length=797

 Score =   180 bits (456),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 120/166 (72%), Gaps = 2/166 (1%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            T + D+  + +L   WKN  P W  GSDPC D WEG+ C  +RV S+TLSS    G LSG
Sbjct  23   TADEDFTTLMSLMSTWKNTSPDWV-GSDPCED-WEGIKCKNTRVTSITLSSTGFGGPLSG  80

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            DI  LSEL+ILDLSYNKD TG LP  IG L+KL  LILVGC F G IPDSIG+L +L +L
Sbjct  81   DIGSLSELEILDLSYNKDFTGPLPESIGELRKLSTLILVGCNFNGPIPDSIGNLQELLFL  140

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
            SLN N+F GPIPPS+G LS+LYWLDLADNQL GSIPVS  +  GLD
Sbjct  141  SLNSNRFSGPIPPSIGSLSKLYWLDLADNQLEGSIPVSGDDIFGLD  186



>ref|XP_010938089.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=986

 Score =   181 bits (459),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 129/184 (70%), Gaps = 1/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGI-VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR  255
            LLL+  F+  L +    TD  D  A+++L D W+N PP+W +  DPCG  W GV C+GSR
Sbjct  29   LLLLLAFVSGLRVGYGITDPTDAAALRSLIDTWQNTPPNWGQSDDPCGTPWVGVSCHGSR  88

Query  256  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  435
            V +LTLS+M L G LSGDI +LSELQ LDLSYN +L G L   IGNLKKL  LIL+GC F
Sbjct  89   VTALTLSTMGLKGILSGDIGQLSELQSLDLSYNNELGGPLTANIGNLKKLATLILLGCSF  148

Query  436  FGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP  615
             G IPD +G+L KL YL+LN NKF G IP SLG LS LY LD++DNQL+G IP+S+   P
Sbjct  149  SGQIPDELGNLGKLSYLALNSNKFTGSIPASLGTLSNLYCLDVSDNQLSGPIPISNNGAP  208

Query  616  GLDM  627
            GLD 
Sbjct  209  GLDQ  212



>ref|XP_010113026.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
 gb|EXC35197.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
Length=964

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 129/186 (69%), Gaps = 0/186 (0%)
 Frame = +1

Query  70   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  249
            ++QLLL  +      + ++T+ ND   + +L++ W+N PPSW E  DPCG  WEGV CN 
Sbjct  5    KLQLLLAFVCAGIYLVSSYTNPNDVAVLHSLKEAWENTPPSWEESDDPCGGQWEGVKCND  64

Query  250  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  429
            SRV +L+LS+M L G+L GDI  L EL+ LDLSYNKDLTG L   +G+L+ L  LIL GC
Sbjct  65   SRVTALSLSTMGLKGKLDGDIGGLIELRSLDLSYNKDLTGPLSPRLGDLQNLNILILAGC  124

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  609
             F G IP+ +G+L  L +L+LN N F G IP +LG+LS +YW D++DNQLTGS+P+S   
Sbjct  125  RFSGKIPEELGNLKSLSFLALNSNNFTGSIPATLGKLSNVYWFDVSDNQLTGSLPISTPT  184

Query  610  TPGLDM  627
            T GLD+
Sbjct  185  TSGLDL  190



>ref|XP_004249557.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Solanum lycopersicum]
Length=964

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 123/171 (72%), Gaps = 0/171 (0%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            I   TD  D   +++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M L G
Sbjct  20   IYTVTDPRDVTILRSLKDQWENTPPSWQKSDDPCGTSWEGVTCNNSRVTALGLSTMGLRG  79

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            +LSGDI  L+EL  LDLS+N+ LTGSL   IG+L+KL  LIL GC F G IP  +G LS+
Sbjct  80   KLSGDIGGLTELISLDLSFNRGLTGSLSPRIGDLQKLNILILAGCSFSGSIPRELGRLSE  139

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            L +L+LN N F G IP +LG LS+LYWLDLADNQLTG IPVS  ++PGLD+
Sbjct  140  LSFLALNSNNFTGEIPRTLGNLSKLYWLDLADNQLTGPIPVSTFSSPGLDL  190



>ref|XP_002864013.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40272.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=428

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 137/194 (71%), Gaps = 6/194 (3%)
 Frame = +1

Query  61   MIPRIQ----LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHW  228
            M  RI+    +L+V  F Q   + AFT+  +  A++AL++ W   P SW EGSDPCG +W
Sbjct  1    MSSRIEALSFMLVVFFFFQRCYVSAFTNGLEASALRALKNEWTRSPKSW-EGSDPCGTNW  59

Query  229  EGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY  408
             G+ C  +RVVS++L + +L G LS  I  LSEL+ILDLS+N  LTG LP  IGNLKKL 
Sbjct  60   VGITCTNNRVVSISLVNHNLEGTLSEYISALSELEILDLSFNTGLTGPLPPNIGNLKKLK  119

Query  409  NLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGS  588
            NLILVGCGF G IP+S+GSL +L  L+LN NKF G IP S+G+LS+L W D+ DN++ G 
Sbjct  120  NLILVGCGFSGQIPESVGSLEQLIKLALNSNKFNGTIPASVGRLSKLDWFDIDDNRIEGE  179

Query  589  IPVSDG-NTPGLDM  627
            +P+S+G ++PGLDM
Sbjct  180  LPISNGTSSPGLDM  193



>ref|XP_010482274.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X4 [Camelina sativa]
Length=800

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 128/178 (72%), Gaps = 3/178 (2%)
 Frame = +1

Query  100  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS-RVVSLTLS  276
            +Q   + A  D +D  A++ L+  W  +  SW +GSDPCG+HW G+ CN + RVVS+ LS
Sbjct  16   VQVCSVSAIPDGSDSSALQVLKSEWTALSKSW-KGSDPCGNHWVGITCNNNNRVVSIMLS  74

Query  277  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  456
            +++L G L  DI  LSEL+ILDLSYN  L+G+LP  IGNLK L +LIL+GCGF G IP+S
Sbjct  75   NLNLKGNLPADISTLSELEILDLSYNTGLSGALPSSIGNLKNLKSLILMGCGFSGQIPES  134

Query  457  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTPGLDM  627
            IGSL KL  LSLN N F G IP S+G+LSELYW D+ DNQ+ G IPVSDG + PGLDM
Sbjct  135  IGSLEKLTTLSLNSNHFSGTIPASIGRLSELYWFDITDNQIEGKIPVSDGISLPGLDM  192



>ref|XP_009761610.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770, partial [Nicotiana sylvestris]
Length=934

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 118/160 (74%), Gaps = 1/160 (1%)
 Frame = +1

Query  145  VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELS  324
             A+ A++  W N+PP+W EGSDPCG  WEG+ CN SRV S+ LS M L G   GD+  L+
Sbjct  15   TALFAIKSSWNNLPPNW-EGSDPCGSSWEGIICNDSRVTSIKLSGMGLEGNQFGDLSSLT  73

Query  325  ELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnk  504
             LQILDLS N  L G+LP  IGNLK L  LILVGC FFG IP+SIGSL +L ++SL  N 
Sbjct  74   ALQILDLSNNVGLKGTLPSSIGNLKNLTTLILVGCSFFGQIPESIGSLQQLVFISLTSNS  133

Query  505  FIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
            F G IPPS+G LS+L WLDL+DN+L+G+IPVS G+TPGLD
Sbjct  134  FTGSIPPSIGNLSKLSWLDLSDNKLSGTIPVSKGSTPGLD  173



>ref|XP_009387132.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=965

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 118/166 (71%), Gaps = 0/166 (0%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            TD  D  A++++   WKN PP+W + SDPCG  WEGV C+ SRV SL LS+M + G LS 
Sbjct  25   TDPQDAAALRSMLSEWKNAPPTWGQSSDPCGSPWEGVFCDASRVTSLRLSTMGIKGTLSS  84

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            DI +L+ELQ LDLSYN DL G L   IGNLKKL  LIL GC F G IP+ +G+L  L +L
Sbjct  85   DISQLTELQSLDLSYNGDLGGLLTPNIGNLKKLTTLILAGCSFNGKIPEELGNLKLLSFL  144

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
            +LN NKF G IP SLG LS LYWLDLADNQL GS+P+S   TPGLD
Sbjct  145  ALNSNKFNGRIPASLGLLSNLYWLDLADNQLIGSLPISVNATPGLD  190



>ref|XP_011012970.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Populus euphratica]
Length=984

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 132/189 (70%), Gaps = 11/189 (6%)
 Frame = +1

Query  94   LFIQFLG-----IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            LF+ F       I + TD +D  A+++L+  W+N PPSW +  DPCG  WEGV C+ SR+
Sbjct  12   LFLTFFTSGIHLIFSDTDPSDAAALQSLKRQWQNTPPSWGQSPDPCGAPWEGVTCSNSRI  71

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
             +L LS+M+L G+LSGDI  L+EL+ LDLS+N +LTGSL   +G+L KL  LIL GCGF 
Sbjct  72   TALGLSTMNLKGKLSGDIGGLTELRSLDLSFNTNLTGSLTPRLGDLLKLNILILAGCGFS  131

Query  439  GLIPDSIGs------lsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            G IPD +G+       + L++ +LN N F G IPPSLG+LS+LYWLDLADNQLTG IP+S
Sbjct  132  GSIPDELGNLAELSFFTTLRHRALNSNNFSGGIPPSLGKLSKLYWLDLADNQLTGPIPIS  191

Query  601  DGNTPGLDM  627
               TPGLD+
Sbjct  192  KNTTPGLDL  200



>ref|XP_007154093.1| hypothetical protein PHAVU_003G0900000g [Phaseolus vulgaris]
 gb|ESW26087.1| hypothetical protein PHAVU_003G0900000g [Phaseolus vulgaris]
Length=874

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 120/166 (72%), Gaps = 2/166 (1%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            T + D+  + +L   WKN  P W  GSDPC D WEG+ C  +RV S+TLSS    G LSG
Sbjct  23   TADEDFTTLMSLMSTWKNTSPDWV-GSDPCED-WEGIKCKNTRVTSITLSSTGFGGPLSG  80

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            DI  LSEL+ILDLSYNKD TG LP  IG L+KL  LILVGC F G IPDSIG+L +L +L
Sbjct  81   DIGSLSELEILDLSYNKDFTGPLPESIGELRKLSTLILVGCNFNGPIPDSIGNLQELLFL  140

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
            SLN N+F GPIPPS+G LS+LYWLDLADNQL GSIPVS  +  GLD
Sbjct  141  SLNSNRFSGPIPPSIGSLSKLYWLDLADNQLEGSIPVSGDDIFGLD  186



>ref|XP_011012972.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Populus euphratica]
Length=979

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 132/189 (70%), Gaps = 11/189 (6%)
 Frame = +1

Query  94   LFIQFLG-----IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            LF+ F       I + TD +D  A+++L+  W+N PPSW +  DPCG  WEGV C+ SR+
Sbjct  12   LFLTFFTSGIHLIFSDTDPSDAAALQSLKRQWQNTPPSWGQSPDPCGAPWEGVTCSNSRI  71

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
             +L LS+M+L G+LSGDI  L+EL+ LDLS+N +LTGSL   +G+L KL  LIL GCGF 
Sbjct  72   TALGLSTMNLKGKLSGDIGGLTELRSLDLSFNTNLTGSLTPRLGDLLKLNILILAGCGFS  131

Query  439  GLIPDSIGs------lsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            G IPD +G+       + L++ +LN N F G IPPSLG+LS+LYWLDLADNQLTG IP+S
Sbjct  132  GSIPDELGNLAELSFFTTLRHRALNSNNFSGGIPPSLGKLSKLYWLDLADNQLTGPIPIS  191

Query  601  DGNTPGLDM  627
               TPGLD+
Sbjct  192  KNTTPGLDL  200



>gb|KHG12756.1| hypothetical protein F383_03913 [Gossypium arboreum]
 gb|KHG27402.1| hypothetical protein F383_16446 [Gossypium arboreum]
Length=959

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 129/183 (70%), Gaps = 2/183 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            L L+ + I    + A TD +D  +++A+   WKNVP +W  G DPC D W G+GC GSRV
Sbjct  7    LFLLVVSIHIYIVTAETDPDDNSSLRAVMSEWKNVPSNWGRG-DPCDDKWVGIGCTGSRV  65

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
             S+ L +M L G L GDI  LSEL+ LDLSYNK L G LP  + NLKKL NLILVGCGF 
Sbjct  66   TSINLPNMKLEGGLVGDIFFLSELKELDLSYNKGLRGILPPAVQNLKKLENLILVGCGFS  125

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN-TP  615
            G IPD+IGSL +L+ LSLN N F G IPPS+G LS L WLD+ADNQL G IPVS+G+ TP
Sbjct  126  GQIPDTIGSLPQLRILSLNSNAFSGNIPPSIGNLSTLNWLDMADNQLEGEIPVSNGSTTP  185

Query  616  GLD  624
            GLD
Sbjct  186  GLD  188



>gb|KHN40214.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=871

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 133/191 (70%), Gaps = 4/191 (2%)
 Frame = +1

Query  58   TMIPRIQLLLVPLFIQFLGI-VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  234
             M+P   L+L+  +I  + + VA T+N+D+ A+ +L   W+N P +W    DPC D W+G
Sbjct  21   AMLP---LMLILNYIMLVSVAVAQTNNDDFTALVSLTSTWQNKPLNWKGSPDPCNDGWDG  77

Query  235  VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  414
            + C  S V S+ L+ +D+ GELS DI  LSEL+ LDLS+NK LTGSLP  IGNL KL NL
Sbjct  78   IKCINSHVTSIRLTGLDIKGELSEDIGLLSELETLDLSHNKGLTGSLPHSIGNLTKLSNL  137

Query  415  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIP  594
             LV CGF G IPD IGSL +L +LSLN N F G IP S+G L +L WLD+ADNQL G+IP
Sbjct  138  FLVDCGFTGPIPDEIGSLKELVFLSLNSNSFSGGIPASIGNLPKLNWLDIADNQLEGTIP  197

Query  595  VSDGNTPGLDM  627
            +S G+TPGLDM
Sbjct  198  ISSGSTPGLDM  208



>ref|XP_009761326.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana sylvestris]
Length=961

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 123/169 (73%), Gaps = 0/169 (0%)
 Frame = +1

Query  121  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  300
            + TD  D   +++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M L G+L
Sbjct  22   SVTDPRDVAILRSLKDQWENTPPSWQKSDDPCGTSWEGVTCNNSRVTALGLSTMGLRGKL  81

Query  301  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  480
            SGDI  L+EL  LDLS+N+ LTGSL   IG+L+KL  LIL GC F G IP  +G L++L 
Sbjct  82   SGDIGGLTELISLDLSFNRGLTGSLSPRIGDLQKLNILILAGCSFSGSIPRELGKLAELS  141

Query  481  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +L+LN N F G IP +LG L++LYWLDLADNQLTG IPVS  ++PGLD+
Sbjct  142  FLALNSNNFTGEIPRTLGNLAKLYWLDLADNQLTGPIPVSTSSSPGLDL  190



>ref|XP_010044506.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
 ref|XP_010044514.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
 gb|KCW88495.1| hypothetical protein EUGRSUZ_A00882 [Eucalyptus grandis]
Length=968

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 136/187 (73%), Gaps = 2/187 (1%)
 Frame = +1

Query  73   IQLLLVPLFIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  249
            I L+ V LF + L +V +FT+ +D VA+++L+  W+N PPSW   SDPCG  WEGV CN 
Sbjct  9    IFLVAVLLFGKDLQLVFSFTNPDDSVALQSLKMSWQNTPPSWERSSDPCGLPWEGVTCNS  68

Query  250  -SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  426
             SRV SL LS+M + G+L  +I  L+EL+ LDLS+NK+LTG L R++GNL+KL  LIL G
Sbjct  69   NSRVTSLGLSTMGIKGQLISEIAGLAELRSLDLSFNKELTGPLARQLGNLQKLNILILAG  128

Query  427  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  606
            C F G IPD +G+L++L +L+LN N   G IP SLG LS+LYW DLADNQLTG IP+S  
Sbjct  129  CSFTGSIPDELGNLAELSFLALNSNNLTGNIPASLGNLSKLYWFDLADNQLTGPIPISTD  188

Query  607  NTPGLDM  627
             +PGLD+
Sbjct  189  TSPGLDL  195



>ref|XP_009600216.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana tomentosiformis]
Length=964

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 123/174 (71%), Gaps = 0/174 (0%)
 Frame = +1

Query  106  FLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMD  285
            F  I   TD  D   +++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M 
Sbjct  17   FHLIYTVTDPRDVAILRSLKDQWENTPPSWQKSDDPCGTTWEGVTCNNSRVTALGLSTMG  76

Query  286  LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGs  465
            L G+LSGDI  L+EL  LDLS+N+ LTGSL   IG+L+ L  LIL GC F G IP  +G 
Sbjct  77   LRGKLSGDIGGLTELISLDLSFNRGLTGSLSPRIGDLQNLNILILAGCSFSGSIPRELGK  136

Query  466  lsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            L++L +L+LN N F G IP +LG L++LYWLDLADNQLTG IPVS  ++PGLD+
Sbjct  137  LAELSFLALNSNNFTGEIPRTLGNLAKLYWLDLADNQLTGQIPVSTSSSPGLDL  190



>emb|CDM81501.1| unnamed protein product [Triticum aestivum]
Length=957

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 125/182 (69%), Gaps = 1/182 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            L+L  + +Q   I+A T+  D   +  +   W   P +W +G+DPCGD W G+ C   RV
Sbjct  7    LILFGVLVQASVILADTNAQDTAGLTGIAASWDTKPSNW-DGNDPCGDKWIGIICTQDRV  65

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
             S+ LSS  L+G LSGDI+ LSELQ LDLSYNKDL GSLP  IG+L  L NLILVGC F 
Sbjct  66   TSIRLSSQSLSGTLSGDIQSLSELQYLDLSYNKDLGGSLPSSIGSLSNLQNLILVGCSFA  125

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  618
            G IP  IG LSKL +LSLN N+F G IPPSLG LS+LYW DLADN+LTG +PV DG  PG
Sbjct  126  GEIPKEIGQLSKLIFLSLNSNRFTGRIPPSLGGLSKLYWFDLADNKLTGGLPVFDGTNPG  185

Query  619  LD  624
            LD
Sbjct  186  LD  187



>emb|CDM81495.1| unnamed protein product [Triticum aestivum]
Length=957

 Score =   180 bits (456),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 125/182 (69%), Gaps = 1/182 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            L+L  + +Q   I+A T+  D   +  +   W   P +W +G+DPCGD W G+ C   RV
Sbjct  7    LILFGVLVQASVILADTNAQDTAGLTGIAASWDTKPSNW-DGNDPCGDKWIGIICTQDRV  65

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
             S+ LSS  L+G LSGDI+ LSELQ LDLSYNKDL GSLP  IG+L  L NLILVGC F 
Sbjct  66   TSIRLSSQSLSGTLSGDIQSLSELQYLDLSYNKDLGGSLPSSIGSLSNLQNLILVGCSFA  125

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  618
            G IP  IG LSKL +LSLN N+F G IPPSLG LS+LYW DLADN+LTG +PV DG  PG
Sbjct  126  GEIPKEIGQLSKLIFLSLNSNRFTGRIPPSLGGLSKLYWFDLADNKLTGGLPVFDGTNPG  185

Query  619  LD  624
            LD
Sbjct  186  LD  187



>gb|KHN40213.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=944

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 120/166 (72%), Gaps = 2/166 (1%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            T + D     +L + W+N PP+W  GSDPC D W G+ C  S + S+TLSS  L G+LSG
Sbjct  7    TADGDLTTFLSLINTWENTPPNWV-GSDPCDD-WVGIKCKNSHITSITLSSTSLAGQLSG  64

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            DI  LSEL+ LDLSYNKDLTG LP  IG LKKL  LILVGC F G IPDSIG++ +L +L
Sbjct  65   DIGSLSELETLDLSYNKDLTGPLPESIGELKKLATLILVGCSFKGPIPDSIGNMQELLFL  124

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
            SLN N F GPIP S+G LS+LYWLDLADNQL G+IPVS G+  GLD
Sbjct  125  SLNSNSFSGPIPHSIGNLSKLYWLDLADNQLQGNIPVSSGDISGLD  170



>ref|XP_006584124.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Glycine max]
Length=960

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 120/166 (72%), Gaps = 2/166 (1%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            T + D     +L + W+N PP+W  GSDPC D W G+ C  S + S+TLSS  L G+LSG
Sbjct  23   TADGDLTTFLSLINTWENTPPNWV-GSDPCDD-WVGIKCKNSHITSITLSSTGLAGQLSG  80

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            DI  LSEL+ LDLSYNKDLTG LP  IG LKKL  LILVGC F G IPDSIG++ +L +L
Sbjct  81   DIGSLSELETLDLSYNKDLTGPLPESIGELKKLATLILVGCSFKGPIPDSIGNMQELLFL  140

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
            SLN N F GPIP S+G LS+LYWLDLADNQL G+IPVS G+  GLD
Sbjct  141  SLNSNSFSGPIPHSIGNLSKLYWLDLADNQLQGNIPVSSGDISGLD  186



>ref|XP_010482273.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Camelina sativa]
Length=950

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 128/178 (72%), Gaps = 3/178 (2%)
 Frame = +1

Query  100  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS-RVVSLTLS  276
            +Q   + A  D +D  A++ L+  W  +  SW +GSDPCG+HW G+ CN + RVVS+ LS
Sbjct  16   VQVCSVSAIPDGSDSSALQVLKSEWTALSKSW-KGSDPCGNHWVGITCNNNNRVVSIMLS  74

Query  277  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  456
            +++L G L  DI  LSEL+ILDLSYN  L+G+LP  IGNLK L +LIL+GCGF G IP+S
Sbjct  75   NLNLKGNLPADISTLSELEILDLSYNTGLSGALPSSIGNLKNLKSLILMGCGFSGQIPES  134

Query  457  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTPGLDM  627
            IGSL KL  LSLN N F G IP S+G+LSELYW D+ DNQ+ G IPVSDG + PGLDM
Sbjct  135  IGSLEKLTTLSLNSNHFSGTIPASIGRLSELYWFDITDNQIEGKIPVSDGISLPGLDM  192



>ref|XP_010482272.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Camelina sativa]
Length=953

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 128/178 (72%), Gaps = 3/178 (2%)
 Frame = +1

Query  100  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS-RVVSLTLS  276
            +Q   + A  D +D  A++ L+  W  +  SW +GSDPCG+HW G+ CN + RVVS+ LS
Sbjct  16   VQVCSVSAIPDGSDSSALQVLKSEWTALSKSW-KGSDPCGNHWVGITCNNNNRVVSIMLS  74

Query  277  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  456
            +++L G L  DI  LSEL+ILDLSYN  L+G+LP  IGNLK L +LIL+GCGF G IP+S
Sbjct  75   NLNLKGNLPADISTLSELEILDLSYNTGLSGALPSSIGNLKNLKSLILMGCGFSGQIPES  134

Query  457  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTPGLDM  627
            IGSL KL  LSLN N F G IP S+G+LSELYW D+ DNQ+ G IPVSDG + PGLDM
Sbjct  135  IGSLEKLTTLSLNSNHFSGTIPASIGRLSELYWFDITDNQIEGKIPVSDGISLPGLDM  192



>ref|XP_002864014.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40273.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=953

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 132/184 (72%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +LL+  F Q   + A T+  D  A+ AL+  W + P  W EGSDPCG +W G+ C   RV
Sbjct  9    MLLIMFFFQICSVSALTNGLDSSALNALKAEWTSPPDGW-EGSDPCGTNWVGITCQNDRV  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            VS++L +++L G+L  DI  LSEL+ILDLSYN  L+G LP  IGNL KL NLILVGC F 
Sbjct  68   VSISLGNLNLEGKLQPDISFLSELRILDLSYNPKLSGPLPPNIGNLGKLRNLILVGCSFS  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  615
            G IP+SIG L +L YLSLNLN+F G IP S+GQLS+LYW D+ADNQ+ G +PVS+G ++P
Sbjct  128  GQIPESIGMLKELIYLSLNLNQFSGTIPASIGQLSKLYWFDIADNQIEGELPVSNGTSSP  187

Query  616  GLDM  627
            GLDM
Sbjct  188  GLDM  191



>ref|XP_006402241.1| hypothetical protein EUTSA_v10012584mg [Eutrema salsugineum]
 gb|ESQ43694.1| hypothetical protein EUTSA_v10012584mg [Eutrema salsugineum]
Length=964

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 135/184 (73%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +LL  LF Q   + A T+ +D  A++AL+  W   P SW +GSDPCG +W G+ C+  R+
Sbjct  9    MLLTLLFFQNCFVSALTNGSDASALQALKSDWSRFPESW-KGSDPCGTNWVGITCSNDRI  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            VS++L +++L G+LS DI  L+ELQILDL+ N  L+G LP  IGNLKKL  L L+GCGF 
Sbjct  68   VSISLGNINLEGKLSADISALAELQILDLTSNPKLSGPLPPNIGNLKKLNTLNLMGCGFS  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  615
            G IP+SIGSL +L  LSLN NKF G IP S+G+LS+L+W D+ADNQ+ G++PVS+G ++P
Sbjct  128  GQIPESIGSLEQLTTLSLNSNKFSGTIPASIGRLSKLFWFDIADNQIEGTVPVSNGTSSP  187

Query  616  GLDM  627
            GLDM
Sbjct  188  GLDM  191



>ref|XP_010482271.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Camelina sativa]
Length=954

 Score =   179 bits (454),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 128/178 (72%), Gaps = 3/178 (2%)
 Frame = +1

Query  100  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS-RVVSLTLS  276
            +Q   + A  D +D  A++ L+  W  +  SW +GSDPCG+HW G+ CN + RVVS+ LS
Sbjct  16   VQVCSVSAIPDGSDSSALQVLKSEWTALSKSW-KGSDPCGNHWVGITCNNNNRVVSIMLS  74

Query  277  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  456
            +++L G L  DI  LSEL+ILDLSYN  L+G+LP  IGNLK L +LIL+GCGF G IP+S
Sbjct  75   NLNLKGNLPADISTLSELEILDLSYNTGLSGALPSSIGNLKNLKSLILMGCGFSGQIPES  134

Query  457  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTPGLDM  627
            IGSL KL  LSLN N F G IP S+G+LSELYW D+ DNQ+ G IPVSDG + PGLDM
Sbjct  135  IGSLEKLTTLSLNSNHFSGTIPASIGRLSELYWFDITDNQIEGKIPVSDGISLPGLDM  192



>dbj|BAJ94480.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=957

 Score =   179 bits (454),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 125/182 (69%), Gaps = 1/182 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            L+L  + +Q   ++A T+  D   +  +   W   P +W +G+DPCGD W G+ C   RV
Sbjct  7    LVLFGILVQASVVLADTNAQDTAGLTGIAASWDTRPSNW-DGNDPCGDKWIGIICTQDRV  65

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
             S+ LSS  L+G LSGDI+ LSELQ LDLSYNKDL GSLP  IG+L  L NLILVGC F 
Sbjct  66   TSIRLSSQSLSGTLSGDIQSLSELQYLDLSYNKDLGGSLPSSIGSLSNLQNLILVGCSFA  125

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  618
            G IP  IG LSKL +LSLN N+F G IPPSLG LS+LYW DLADN+LTG +P+ DG  PG
Sbjct  126  GEIPKEIGQLSKLIFLSLNSNRFTGRIPPSLGGLSKLYWFDLADNKLTGGLPIFDGTNPG  185

Query  619  LD  624
            LD
Sbjct  186  LD  187



>dbj|BAJ89467.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=957

 Score =   179 bits (454),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 125/182 (69%), Gaps = 1/182 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            L+L  + +Q   ++A T+  D   +  +   W   P +W +G+DPCGD W G+ C   RV
Sbjct  7    LVLFGILVQASVVLADTNAQDTAGLTGIAASWDTRPSNW-DGNDPCGDKWIGIICTQDRV  65

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
             S+ LSS  L+G LSGDI+ LSELQ LDLSYNKDL GSLP  IG+L  L NLILVGC F 
Sbjct  66   TSIRLSSQSLSGTLSGDIQSLSELQYLDLSYNKDLGGSLPSSIGSLSNLQNLILVGCSFA  125

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  618
            G IP  IG LSKL +LSLN N+F G IPPSLG LS+LYW DLADN+LTG +P+ DG  PG
Sbjct  126  GEIPKEIGQLSKLIFLSLNSNRFTGRIPPSLGGLSKLYWFDLADNKLTGGLPIFDGTNPG  185

Query  619  LD  624
            LD
Sbjct  186  LD  187



>ref|XP_009337850.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
 ref|XP_009337851.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=963

 Score =   179 bits (454),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 125/177 (71%), Gaps = 0/177 (0%)
 Frame = +1

Query  97   FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  276
            F +   I + T+ +D  A+++L+  W NVPPSW + SDPCG  WEGV CN SRV +L LS
Sbjct  15   FSRLHVISSVTNPDDASALQSLKQTWSNVPPSWDKSSDPCGAQWEGVTCNDSRVTALGLS  74

Query  277  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  456
            ++++ G++ GDI  LSEL+ LDLS+NK LTGSL   +G+L KL  LIL GC F G IP  
Sbjct  75   AINVKGKIEGDIGGLSELRSLDLSFNKGLTGSLSPRLGDLSKLNILILAGCSFSGSIPSE  134

Query  457  IGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +G+L +L +L+LN N F G IP SLG+LS LYWLDLADNQLTG IPVS    PGLD 
Sbjct  135  LGNLKELTFLALNTNNFTGRIPASLGKLSNLYWLDLADNQLTGPIPVSTAVAPGLDQ  191



>ref|XP_006584125.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X2 [Glycine max]
Length=945

 Score =   179 bits (453),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 120/166 (72%), Gaps = 2/166 (1%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            T + D     +L + W+N PP+W  GSDPC D W G+ C  S + S+TLSS  L G+LSG
Sbjct  23   TADGDLTTFLSLINTWENTPPNWV-GSDPCDD-WVGIKCKNSHITSITLSSTGLAGQLSG  80

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            DI  LSEL+ LDLSYNKDLTG LP  IG LKKL  LILVGC F G IPDSIG++ +L +L
Sbjct  81   DIGSLSELETLDLSYNKDLTGPLPESIGELKKLATLILVGCSFKGPIPDSIGNMQELLFL  140

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
            SLN N F GPIP S+G LS+LYWLDLADNQL G+IPVS G+  GLD
Sbjct  141  SLNSNSFSGPIPHSIGNLSKLYWLDLADNQLQGNIPVSSGDISGLD  186



>ref|XP_004960772.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Setaria italica]
Length=962

 Score =   179 bits (453),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 125/182 (69%), Gaps = 1/182 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            L L  + +Q   I+A TD  D   + A+   WKN P +W  G DPC D W G+ C G+RV
Sbjct  8    LFLFSVLVQTSAILADTDPGDSAGLTAIAANWKNKPSNW-NGDDPCRDKWIGIICTGNRV  66

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
             S+ LSS  L+G LSGDI+ L+EL  LDLSYNKDL+G LP  IG+L  L NLILVGC F 
Sbjct  67   TSIRLSSFGLSGTLSGDIQTLTELVYLDLSYNKDLSGPLPSTIGSLSNLQNLILVGCSFS  126

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  618
            G IP  +G LSKL +LSLN NKF G IP SLG LS+LYW DLADN+LTG++P+ DG  PG
Sbjct  127  GEIPKELGQLSKLIFLSLNSNKFSGSIPASLGNLSKLYWFDLADNKLTGTLPIFDGTNPG  186

Query  619  LD  624
            LD
Sbjct  187  LD  188



>ref|XP_006338928.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=964

 Score =   178 bits (452),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 122/171 (71%), Gaps = 0/171 (0%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            I   TD  D   +++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M L G
Sbjct  20   IYTVTDPRDVTILRSLKDQWENTPPSWQKSDDPCGTSWEGVTCNNSRVTALGLSTMGLRG  79

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            +LSGDI  L+EL  LDLS+N+ LTGSL   IG+L+KL  LIL GC F G IP  +G L++
Sbjct  80   KLSGDIGGLTELISLDLSFNRGLTGSLSPRIGDLQKLNILILAGCSFSGSIPMELGRLAE  139

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            L +L+LN N F G IP +LG LS+LYWLDLADNQLTG IPVS  ++ GLD+
Sbjct  140  LSFLALNSNNFTGEIPQTLGNLSKLYWLDLADNQLTGPIPVSTSSSSGLDL  190



>ref|XP_011461103.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
 ref|XP_011461104.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
 ref|XP_011461105.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
Length=939

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 129/180 (72%), Gaps = 2/180 (1%)
 Frame = +1

Query  88   VPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSL  267
            V + +Q L I A  +  +Y  ++ L D W   PPSW   +DPC D WEG+ C  SR+ +L
Sbjct  12   VLVLLQVLFIAAEANTQEYGYMQILMDEWNIKPPSWV-SADPC-DGWEGIKCTNSRITAL  69

Query  268  TLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLI  447
             L++M L G+LS DIE LSEL+IL+LS+NK L+G L   IG LKKL +L LVGC FFG I
Sbjct  70   VLANMGLKGQLSTDIELLSELRILNLSFNKGLSGQLRASIGKLKKLVHLNLVGCSFFGPI  129

Query  448  PDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            PD+IGSL+KL YLSL  N F GPIPPS+G LS L ++DL+DN+L GSIPVS+G TPGLDM
Sbjct  130  PDAIGSLTKLSYLSLKNNSFSGPIPPSIGNLSNLTFIDLSDNKLQGSIPVSNGTTPGLDM  189



>ref|XP_009417853.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X4 [Musa acuminata subsp. malaccensis]
Length=841

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 118/167 (71%), Gaps = 0/167 (0%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            T+  D  A+++L   W+N PP+W +  DPCG  WEG+GC+ SRV  L LS+M + G LSG
Sbjct  22   TNPQDAAALRSLMSQWQNTPPNWGKSDDPCGTPWEGIGCSNSRVTVLRLSTMGIKGTLSG  81

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            DI +L EL+ LDLSYN +L G LP  I NL+K+  LIL GC F G IPD +GSL  L YL
Sbjct  82   DIGQLGELKTLDLSYNSELGGPLPPNIANLRKITTLILAGCSFSGNIPDELGSLVNLSYL  141

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +LN N+F G IP SLG+LS LYW D+ADNQL+GS+P+S   +PGLD 
Sbjct  142  ALNSNQFTGSIPASLGKLSNLYWFDVADNQLSGSLPISTKTSPGLDQ  188



>ref|XP_009365988.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Pyrus x bretschneideri]
Length=959

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 120/171 (70%), Gaps = 0/171 (0%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            I + T  +D  A+++LR  W NVPPSW + +DPCG+ WEG+ C+GSRV +L LS M++ G
Sbjct  18   ISSSTHPDDANALQSLRQTWTNVPPSWDKSNDPCGERWEGITCSGSRVTALGLSGMNVKG  77

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
             + GDI  LS+L  LDLS+NK LTGSL   +G+L  L  LIL GC F G+IP  +G L +
Sbjct  78   TIEGDIAGLSKLISLDLSFNKGLTGSLSPRLGDLSNLNTLILAGCNFSGIIPSELGKLGE  137

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            L +L+LN N F G IP SLG LS LYWLDLADNQLTG +PVS   TPGLD 
Sbjct  138  LTFLALNTNNFTGSIPASLGNLSNLYWLDLADNQLTGPLPVSSSTTPGLDQ  188



>ref|XP_009365989.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Pyrus x bretschneideri]
Length=962

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 124/171 (73%), Gaps = 0/171 (0%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            IV+ TD ND   +++L+  W+N PPSW + +DPCG  WEGV CNGSRV +L LSS  L G
Sbjct  21   IVSLTDLNDAAVLQSLKGAWQNTPPSWDKSNDPCGLRWEGVTCNGSRVSALALSSTGLKG  80

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            EL+GDI  L+EL+ +DLS+N  LTGSL   +G+LKKL  ++L GC F G IPD +G+L++
Sbjct  81   ELTGDIGGLTELRSMDLSFNPGLTGSLSPRLGDLKKLNVMVLAGCSFSGNIPDELGNLAE  140

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            L +L+LN N   G IP  LG+LS LYWLDLA NQL+G IP+S   +PGLD+
Sbjct  141  LTFLALNSNNLTGVIPHPLGKLSNLYWLDLAKNQLSGPIPISTSTSPGLDL  191



>ref|XP_008804684.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
Length=562

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            TD  D  A+++L + W+  PPSW +  DPCG  W GV C+ SRV  L LS+M + G LSG
Sbjct  24   TDPQDAAALRSLMNQWQAAPPSWGQSDDPCGMPWNGVICSKSRVTILRLSTMGIKGTLSG  83

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            DI +L++LQ LDLSYN DL G L   IGNLK+L  LILVGC F G IP  +G+L++L +L
Sbjct  84   DIGQLTKLQSLDLSYNSDLGGPLTPNIGNLKELTTLILVGCNFSGTIPSELGNLAELSFL  143

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
             LN N+F G IP SLG LS LYWLDLA+N+LTG +P+S G TPGLD+
Sbjct  144  DLNSNQFTGNIPASLGNLSNLYWLDLANNKLTGMLPISKGTTPGLDL  190



>ref|XP_009417851.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Musa acuminata subsp. malaccensis]
Length=933

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 118/167 (71%), Gaps = 0/167 (0%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            T+  D  A+++L   W+N PP+W +  DPCG  WEG+GC+ SRV  L LS+M + G LSG
Sbjct  22   TNPQDAAALRSLMSQWQNTPPNWGKSDDPCGTPWEGIGCSNSRVTVLRLSTMGIKGTLSG  81

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            DI +L EL+ LDLSYN +L G LP  I NL+K+  LIL GC F G IPD +GSL  L YL
Sbjct  82   DIGQLGELKTLDLSYNSELGGPLPPNIANLRKITTLILAGCSFSGNIPDELGSLVNLSYL  141

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +LN N+F G IP SLG+LS LYW D+ADNQL+GS+P+S   +PGLD 
Sbjct  142  ALNSNQFTGSIPASLGKLSNLYWFDVADNQLSGSLPISTKTSPGLDQ  188



>ref|XP_009417852.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Musa acuminata subsp. malaccensis]
Length=928

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 118/167 (71%), Gaps = 0/167 (0%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            T+  D  A+++L   W+N PP+W +  DPCG  WEG+GC+ SRV  L LS+M + G LSG
Sbjct  22   TNPQDAAALRSLMSQWQNTPPNWGKSDDPCGTPWEGIGCSNSRVTVLRLSTMGIKGTLSG  81

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            DI +L EL+ LDLSYN +L G LP  I NL+K+  LIL GC F G IPD +GSL  L YL
Sbjct  82   DIGQLGELKTLDLSYNSELGGPLPPNIANLRKITTLILAGCSFSGNIPDELGSLVNLSYL  141

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +LN N+F G IP SLG+LS LYW D+ADNQL+GS+P+S   +PGLD 
Sbjct  142  ALNSNQFTGSIPASLGKLSNLYWFDVADNQLSGSLPISTKTSPGLDQ  188



>ref|XP_010922852.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=962

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            TD  D  A+++L + W+  PPSW + +DPCG  W+GV C+ SRV  L LS+M + G LSG
Sbjct  24   TDQQDAAALRSLMNQWQAAPPSWGQSNDPCGVPWDGVVCSNSRVTVLRLSTMGIKGTLSG  83

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            DI +L++LQ LDLSYN +L G     IGNLK+L  LILVGC F G IP  +G+L++L +L
Sbjct  84   DIAQLTKLQSLDLSYNGELGGPFTPNIGNLKELTTLILVGCSFSGTIPSELGNLAELSFL  143

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
             LN N+F G IP SLG LS LYWLDLA+N+LTG++P+S+G TPGLD+
Sbjct  144  DLNSNQFTGNIPASLGNLSNLYWLDLANNKLTGTLPISEGTTPGLDL  190



>ref|XP_009365992.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=997

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 119/171 (70%), Gaps = 0/171 (0%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            I + T  +D  A+++LR  W N+PPSW + +DPCG+HWEG+ CNGSRV +L LS M++ G
Sbjct  59   ISSSTHPDDANALQSLRQTWSNIPPSWDKSNDPCGEHWEGITCNGSRVTALELSGMNVKG  118

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            +  GDI  LSEL+ L LS+NK L GSL   +G+L  L  L+L GC F G IP  +G L +
Sbjct  119  KFEGDIGGLSELRSLVLSFNKGLAGSLSPRLGDLSNLNILVLAGCSFSGTIPSELGKLGE  178

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            L +L+LN N F G IP SLG LS LYWLDLA NQLTG +PVS G TPGLD 
Sbjct  179  LTFLALNTNSFTGSIPASLGNLSNLYWLDLAYNQLTGPLPVSSGTTPGLDQ  229



>ref|XP_008465342.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Cucumis melo]
Length=941

 Score =   176 bits (447),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 131/183 (72%), Gaps = 1/183 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAF-TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR  255
            L++  LF+ F  + A  TD+ D   +++L+DGW+N PPSW   +DPCG  W+GV C  SR
Sbjct  5    LVVSLLFLAFFYLAASSTDSRDSSVLQSLKDGWQNTPPSWGTSNDPCGTPWDGVICKNSR  64

Query  256  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  435
            VV+L LSSM L G+L GDI  L+EL+ LDL+ N+DL GS+   +GNL KL  LIL  CGF
Sbjct  65   VVALKLSSMGLKGKLGGDIGGLTELRSLDLAANRDLVGSISPALGNLLKLETLILSTCGF  124

Query  436  FGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP  615
             G IP+ +G+LS+L +LSL  N F G IP +LG+LS+LYWLDLADNQLTG++PVS   + 
Sbjct  125  SGNIPEELGNLSELTFLSLYSNNFTGTIPATLGKLSKLYWLDLADNQLTGALPVSTSGSW  184

Query  616  GLD  624
            GLD
Sbjct  185  GLD  187



>ref|XP_009417849.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Musa acuminata subsp. malaccensis]
Length=958

 Score =   176 bits (447),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 118/167 (71%), Gaps = 0/167 (0%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            T+  D  A+++L   W+N PP+W +  DPCG  WEG+GC+ SRV  L LS+M + G LSG
Sbjct  22   TNPQDAAALRSLMSQWQNTPPNWGKSDDPCGTPWEGIGCSNSRVTVLRLSTMGIKGTLSG  81

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            DI +L EL+ LDLSYN +L G LP  I NL+K+  LIL GC F G IPD +GSL  L YL
Sbjct  82   DIGQLGELKTLDLSYNSELGGPLPPNIANLRKITTLILAGCSFSGNIPDELGSLVNLSYL  141

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +LN N+F G IP SLG+LS LYW D+ADNQL+GS+P+S   +PGLD 
Sbjct  142  ALNSNQFTGSIPASLGKLSNLYWFDVADNQLSGSLPISTKTSPGLDQ  188



>ref|XP_009387702.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=961

 Score =   176 bits (447),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            TD ND   ++++ + W+N PP+W +  DPCG  WEGV C+ +RV +L LS+M + G L+G
Sbjct  23   TDPNDAAVLRSMLNQWENAPPTWGQSDDPCGTPWEGVSCDSTRVTALRLSTMGIKGTLNG  82

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            D+ +L++LQ LDLSYN  L+G L   IGNLK+L   IL GC F G IP  +G+L  L +L
Sbjct  83   DVGQLTQLQSLDLSYNGGLSGPLSASIGNLKQLTTFILAGCSFSGSIPQELGNLKLLSFL  142

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +LN NKF G IP SLG LS LYWLDLADNQLTGS+P+S  +TPGLD+
Sbjct  143  ALNSNKFSGRIPASLGLLSNLYWLDLADNQLTGSLPISTNSTPGLDL  189



>ref|XP_010484994.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770, partial [Camelina sativa]
Length=846

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 132/184 (72%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +LL+ LF     + A T+  D  A+  L+  W + P  W EGSDPCG +W G+ C   RV
Sbjct  9    MLLILLFFHICSVSALTNTLDSSALSGLKSEWTSSPDGW-EGSDPCGTNWVGIKCRNDRV  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            +S++L +++L G+L  DI  LSEL+ILDLSYN  L+G LP  IGNLK L +LILVGC F 
Sbjct  68   ISISLGNLNLEGKLPADISFLSELEILDLSYNTGLSGPLPPNIGNLKNLKSLILVGCSFS  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  615
            G IP+SIGSL +L YLSLNLNKF G IP S+G+LS+LYW D+ADNQ+ G +PVS+G ++P
Sbjct  128  GEIPESIGSLKELIYLSLNLNKFSGTIPASIGRLSKLYWFDIADNQIEGELPVSNGTSSP  187

Query  616  GLDM  627
            GLDM
Sbjct  188  GLDM  191



>gb|EYU33251.1| hypothetical protein MIMGU_mgv1a021972mg, partial [Erythranthe 
guttata]
Length=945

 Score =   176 bits (445),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 126/188 (67%), Gaps = 1/188 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            M  R  + ++ + ++ L + A TD+ D  A+ A+R  W N+PP+W  G DPCG++W+G+ 
Sbjct  12   MSSRFVVCVLLVSVRILDVSALTDSGDLAALNAIRSSWTNLPPNWI-GPDPCGNNWDGIS  70

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            C  +RV SL L+ MD+ G    DI  L+ L  LDLS N  L G LP  IGNLK L  LIL
Sbjct  71   CTATRVTSLMLAGMDVQGSQFSDISSLTGLTFLDLSNNIGLKGILPPSIGNLKNLSTLIL  130

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            VGC FFG IPDSIGSL +L Y+SLN N F GPIPPS+G LS+L WLDL+ N+L GSIPVS
Sbjct  131  VGCSFFGPIPDSIGSLQQLIYISLNSNGFSGPIPPSIGNLSKLSWLDLSVNRLNGSIPVS  190

Query  601  DGNTPGLD  624
                PGLD
Sbjct  191  SDTAPGLD  198



>ref|XP_008804670.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
 ref|XP_008804671.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
Length=951

 Score =   176 bits (445),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 121/167 (72%), Gaps = 0/167 (0%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            TD  D  A+++L + W+  PPSW +  DPCG  W+GV C+ SRV  L LS+M + G LSG
Sbjct  13   TDPQDAAALRSLMNQWQAAPPSWGQSDDPCGMPWDGVVCSKSRVTVLRLSTMGIKGTLSG  72

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            DI +L++LQ LDLSYN DL G L   IGNLK+L  LILVGC F G +P  +G+L++L +L
Sbjct  73   DIGQLTKLQSLDLSYNNDLRGPLAPNIGNLKELTTLILVGCSFSGTLPSELGNLAELSFL  132

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
             LN N+F G IP SLG LS LYWLDLA+N+LTG++P+S G TPGLD+
Sbjct  133  DLNSNQFTGKIPGSLGSLSNLYWLDLANNKLTGTLPISKGTTPGLDL  179



>ref|XP_011018905.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Populus euphratica]
Length=967

 Score =   176 bits (445),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            TD  D  A+++L+  W+N PPSW +  DPCG  WEGV C+ SR+ +L LS+M+L G+LSG
Sbjct  28   TDPRDAAALRSLKSQWQNTPPSWGQSDDPCGAPWEGVTCSNSRITALGLSTMNLVGKLSG  87

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            DI  L+EL+ LDLS+N +LTG L   +G+L  L  LIL GCGF G IPD +G+L+KL +L
Sbjct  88   DIGGLAELRSLDLSFNSNLTGPLSPRLGDLLNLNILILAGCGFSGSIPDELGNLAKLSFL  147

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +LN NKF G IPPSLG+LS+LYWLDLADNQLTG+IP+S G  PGLD+
Sbjct  148  ALNSNKFSGGIPPSLGKLSKLYWLDLADNQLTGTIPISKGTIPGLDL  194



>ref|NP_199786.2| Leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
 gb|AED95853.1| Leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
Length=493

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 135/193 (70%), Gaps = 4/193 (2%)
 Frame = +1

Query  58   TMIPRIQ--LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWE  231
            TM  RI+  +LL+  F Q   + A T+  D  A++ +++ W   P  W EGSDPCG +W 
Sbjct  57   TMSSRIRTCMLLILFFFQKCYVSALTNVFDASALRGMKNEWTRSPKGW-EGSDPCGTNWV  115

Query  232  GVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN  411
            G+ C   RVVS++L + +L G LS  I  LSEL+ILDLS+N  LTG LP  IG+LKKL N
Sbjct  116  GITCTNDRVVSISLVNHNLEGTLSEYILALSELEILDLSFNIGLTGPLPSNIGDLKKLKN  175

Query  412  LILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSI  591
            LILVGCG  G IPDSIGSL ++  LSLNLNKF G IP S+G+LS+L W D+A+NQ+ G +
Sbjct  176  LILVGCGLSGQIPDSIGSLEQIINLSLNLNKFSGTIPASIGRLSKLDWFDIAENQIEGEL  235

Query  592  PVSDG-NTPGLDM  627
            P+S+G ++PGLDM
Sbjct  236  PISNGTSSPGLDM  248



>ref|XP_007208371.1| hypothetical protein PRUPE_ppa000921mg [Prunus persica]
 gb|EMJ09570.1| hypothetical protein PRUPE_ppa000921mg [Prunus persica]
Length=961

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 127/182 (70%), Gaps = 6/182 (3%)
 Frame = +1

Query  94   LFIQFLG-----IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            LF+ F       I + TD  D     +L+  W N+PPSW + +DPCG  WEGV CN SRV
Sbjct  8    LFLAFCSAGIHMIFSETDPGDAAVFISLKGAWTNLPPSW-KSNDPCGMSWEGVTCNNSRV  66

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
             +L LS+MDL G + GDI  LSEL+ LDLS+NK LTGSL   +G+L KL  LIL GCGF 
Sbjct  67   TALGLSAMDLKGHIEGDIGGLSELRSLDLSFNKGLTGSLSPRLGDLSKLNILILAGCGFS  126

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  618
            G IPD +G+L +L +L+LN N F G IPPSLG+LS+L+WLDLADNQLTG++P+S   T G
Sbjct  127  GNIPDELGNLGELTFLALNTNNFTGKIPPSLGKLSKLFWLDLADNQLTGTLPISTPVTSG  186

Query  619  LD  624
            LD
Sbjct  187  LD  188



>emb|CDP16125.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 129/186 (69%), Gaps = 0/186 (0%)
 Frame = +1

Query  70   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  249
            ++QL  + + +    + +FTD  D   +++++  WKN+PPSW   +DPCG  WEGV C+ 
Sbjct  5    KLQLCYLIVSMACHLVFSFTDPQDATVLQSIKQQWKNLPPSWNNSNDPCGTPWEGVTCSN  64

Query  250  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  429
            SRV +L LSSM L+G+L  DI  L+EL  LDLS N DLTGS+   +G+L+KL  LIL GC
Sbjct  65   SRVKALALSSMRLSGKLGDDIGGLTELTSLDLSSNPDLTGSVSSRLGDLRKLNVLILAGC  124

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  609
            G  G IP  +G+L++L +L+LN N F G IP SLG L+ LYWLDL++N+L+GSIPVS   
Sbjct  125  GLSGTIPSELGNLAQLSFLALNSNNFTGEIPASLGNLTNLYWLDLSNNRLSGSIPVSTST  184

Query  610  TPGLDM  627
             PGLD+
Sbjct  185  GPGLDL  190



>ref|XP_002308292.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE91815.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=974

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            TD  D  A+K+L+  W+N PPSW +  DPCG  WEGV C+ SR+ +L LS+M L G+LSG
Sbjct  28   TDPRDAAALKSLKSQWQNTPPSWDQSDDPCGAPWEGVTCSNSRITALGLSTMSLVGKLSG  87

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            DI  L+EL+ LDLS+N +LTG L   +G+L  L  LIL GCGF G IPD +G+L+KL +L
Sbjct  88   DIGGLAELRSLDLSFNSNLTGPLSPRLGDLLNLNILILAGCGFSGSIPDELGNLAKLSFL  147

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +LN NKF G IPPSLG+LS+LYWLDLADNQLTG+IP+S G  PGLD+
Sbjct  148  ALNSNKFSGGIPPSLGKLSKLYWLDLADNQLTGTIPISKGTIPGLDL  194



>ref|XP_009391654.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=926

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 117/167 (70%), Gaps = 1/167 (1%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            TD+ D  A+KAL + WKN PPSW   +DPC D W+GV C GSRV  L L SM++ G LSG
Sbjct  22   TDSQDVSALKALSNQWKNTPPSWRRSNDPC-DQWDGVNCTGSRVKELKLFSMNIEGRLSG  80

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            DI+ L+EL +LDLS NK+L G LPR IGNLK+L  L L+GC F G IP  +G+L  LK L
Sbjct  81   DIQNLTELTLLDLSSNKNLGGPLPRSIGNLKQLQTLRLIGCSFSGSIPVEVGNLLNLKIL  140

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            SLN N+F G IP SLG+LS L WLDLA+NQLTG IP S     GLD 
Sbjct  141  SLNSNQFNGTIPGSLGRLSNLEWLDLAENQLTGIIPTSSNGASGLDQ  187



>ref|XP_007208107.1| hypothetical protein PRUPE_ppa000924mg [Prunus persica]
 gb|EMJ09306.1| hypothetical protein PRUPE_ppa000924mg [Prunus persica]
Length=960

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 131/183 (72%), Gaps = 6/183 (3%)
 Frame = +1

Query  94   LFIQFLG-----IVAFTDNNDYVAIKALRDGWKNVPPSWAEGS-DPCGDHWEGVGCNGSR  255
            LF+ F       I + T++ D     +L++ W ++PPSW + S DPCG +WEGV CN SR
Sbjct  8    LFLAFCSAGIHVIFSETNSRDAAVFISLKEAWTDLPPSWNDKSNDPCGMNWEGVKCNNSR  67

Query  256  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  435
            V +L LS+MDL G++ GDI  LSEL+ LDLS+NK LTGSL   +G+L KL  LIL GCGF
Sbjct  68   VTALGLSAMDLKGQIEGDIGGLSELRSLDLSFNKGLTGSLSPRLGDLSKLNILILAGCGF  127

Query  436  FGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP  615
             G IP+ +G+L +L +L+LN NKF G IPPSLG+LS+LYWLDL DNQLTG++P+S   T 
Sbjct  128  SGNIPEELGNLGELTFLALNTNKFTGQIPPSLGKLSKLYWLDLVDNQLTGTLPISTPLTS  187

Query  616  GLD  624
            GLD
Sbjct  188  GLD  190



>emb|CDY21452.1| BnaC03g27450D [Brassica napus]
Length=953

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 127/172 (74%), Gaps = 2/172 (1%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            + A T+  D  A++AL+  W   P SW EG DPCG  W G+ C   RVVS++L ++++ G
Sbjct  21   VSALTNGFDGAALQALKAEWTKPPSSW-EGDDPCGTSWVGITCISDRVVSISLGNLNVEG  79

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            +LSGDI  LSELQILDLSYN  LTG LP  IG  KKL NLILVGC F G IP+SIG L +
Sbjct  80   KLSGDIAALSELQILDLSYNTGLTGPLPPNIGEAKKLKNLILVGCSFTGQIPESIGKLEQ  139

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTPGLDM  627
            L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++PVS+G ++PGLDM
Sbjct  140  LIYLSLNLNQFSGTIPVSIGRLSKLYWFDIADNQIEGTLPVSNGTSSPGLDM  191



>emb|CDO97683.1| unnamed protein product [Coffea canephora]
Length=946

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 127/181 (70%), Gaps = 1/181 (1%)
 Frame = +1

Query  85   LVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVS  264
            L+ L IQ L  +A TD+ND  A+ A++  W N+PP+W +G+DPCG  W+G+ CN S    
Sbjct  9    LLILSIQILHTLAQTDSNDSAALNAIKSSWNNLPPNW-KGADPCGSGWDGITCNVSDFQC  67

Query  265  LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL  444
              L  M LTG   GDI  L+ELQ LDLS N  L G++P  IGNLKKL  LILVGC F G 
Sbjct  68   RMLGGMLLTGSGLGDITMLTELQTLDLSNNIGLKGTIPSSIGNLKKLSTLILVGCSFSGP  127

Query  445  IPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
            IPDSIGSLS+L Y+SLN N F GPIPPS+G LS L WLDL++N L G++PVS  ++PGLD
Sbjct  128  IPDSIGSLSRLVYISLNSNSFSGPIPPSIGNLSNLSWLDLSENNLNGTLPVSFQDSPGLD  187

Query  625  M  627
            M
Sbjct  188  M  188



>gb|EMT14100.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=902

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 124/182 (68%), Gaps = 1/182 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            L+L  + +Q   I+A T+  D   +  +   W   P +W +G+DPCGD W G+ C   RV
Sbjct  7    LILFGVLVQASVILADTNVQDTAGLTGIAASWDTKPSNW-DGNDPCGDKWIGIICIQDRV  65

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
             S+ LSS  L+G LSGDI+ LSELQ LDLSYNKDL GSLP  IG+L  L NLILVGC F 
Sbjct  66   TSIRLSSQSLSGTLSGDIQSLSELQYLDLSYNKDLGGSLPSSIGSLSNLQNLILVGCSFA  125

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  618
            G IP  IG LSKL +LSLN N+F G IPPSL  LS+LYW DLA+N+LTG +PV DG  PG
Sbjct  126  GEIPKEIGQLSKLIFLSLNSNRFTGHIPPSLSGLSKLYWFDLAENKLTGGLPVFDGTNPG  185

Query  619  LD  624
            LD
Sbjct  186  LD  187



>emb|CDY12940.1| BnaA09g13340D [Brassica napus]
Length=931

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 137/193 (71%), Gaps = 5/193 (3%)
 Frame = +1

Query  61   MIPRIQ--LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  234
            M  RIQ  +LL+  F Q   + A T+  D  A++AL+  W   P +W +GSDPCG +W G
Sbjct  5    MRSRIQVCMLLILTFCQICSVSALTNGLDASALQALKSEWTRFPENW-KGSDPCGTNWVG  63

Query  235  VGCNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN  411
            + CN +  V+S++L +++L G+LS DI  L+ELQILDL+ N  L+GSLP  IGNL+KL  
Sbjct  64   ITCNNNNHVISISLGNLNLEGKLSADISSLAELQILDLTSNSKLSGSLPSNIGNLRKLTT  123

Query  412  LILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSI  591
            L L+ CGF G IP+SIGSL +L  LSLN NKF G IP S+G+LS+L W D+ADNQ+ G+I
Sbjct  124  LNLMECGFSGEIPESIGSLEQLITLSLNSNKFSGTIPASIGRLSKLNWFDIADNQIEGTI  183

Query  592  PVSDG-NTPGLDM  627
            PVS+G ++PGLDM
Sbjct  184  PVSNGTSSPGLDM  196



>ref|XP_010682227.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770, partial [Beta vulgaris subsp. vulgaris]
Length=866

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 129/186 (69%), Gaps = 5/186 (3%)
 Frame = +1

Query  82   LLVPLFIQFLGI-VAFTDNNDYVAIKALRDG---WKNVPPSWAEGSDPCGDHWEGVGCNG  249
            L + L + F+ I +A  D    +     +DG   W+N+PP+W+ G DPC + W G+ C+ 
Sbjct  11   LRIGLLVAFICISIAIGDVTSQIQTNR-QDGLGDWRNLPPNWSIGGDPCVNEWLGIKCSD  69

Query  250  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  429
            SR+  + L +M+LTG+L+GD+  L ELQILDLSYN+ LTG LP+ IG L KL +LIL+ C
Sbjct  70   SRITEIKLLNMNLTGQLTGDLAVLRELQILDLSYNRGLTGPLPQSIGQLLKLTSLILMDC  129

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  609
            GF G IPD IGSL +L  L LN N F GP+P ++G L  LYWLDL  NQL+GSIPVS+G+
Sbjct  130  GFSGRIPDYIGSLKQLDSLYLNGNNFTGPVPATIGNLLNLYWLDLGTNQLSGSIPVSNGD  189

Query  610  TPGLDM  627
            TPGLDM
Sbjct  190  TPGLDM  195



>ref|XP_009364675.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=937

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 124/184 (67%), Gaps = 6/184 (3%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGD-HWEGVGCNGSR  255
            L+++P F+    I    +N +YV +K L D W   P SW  GSDPCGD  WEG+ C  S 
Sbjct  14   LVMIPFFV----IAVEANNQEYVPMKILMDEWNIRPTSWV-GSDPCGDGSWEGITCTNSH  68

Query  256  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  435
            V S+ L+ M LTG L  DIE LSEL++L+LS+N+ L G LP  IG L KL  L LVGC F
Sbjct  69   VTSIALADMALTGSLPSDIERLSELEVLNLSFNRGLKGLLPASIGKLTKLVYLNLVGCSF  128

Query  436  FGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP  615
            FG IPD++GSL +L YLSL  N F G IPPS+G ++ L +LDL+DNQL GSIPVS+   P
Sbjct  129  FGRIPDTMGSLKQLSYLSLKNNSFSGRIPPSIGNMTNLSFLDLSDNQLQGSIPVSNRTAP  188

Query  616  GLDM  627
            GLDM
Sbjct  189  GLDM  192



>ref|XP_010441071.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=953

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 132/184 (72%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +LL+ LF     + A T+  D  A+  L+  W + P  W EGSDPCG +W G+ C   RV
Sbjct  9    MLLILLFFYICSVSALTNTLDSSALSGLKSEWTSSPDGW-EGSDPCGTNWVGIKCRNDRV  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            +S++L +++L G+L  DI  LSEL+ILDLSYN  L+G LP  IGNLK L +LILVGC F 
Sbjct  68   ISISLGNLNLEGKLPADISFLSELEILDLSYNTGLSGPLPPNIGNLKNLKSLILVGCSFS  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  615
            G IP+SIGSL +L YLSLNLNKF G IP S+G+LS+LYW D+ADNQ+ G +PVS+G ++P
Sbjct  128  GEIPESIGSLKELIYLSLNLNKFSGTIPASIGRLSKLYWFDIADNQIEGELPVSNGTSSP  187

Query  616  GLDM  627
            GLDM
Sbjct  188  GLDM  191



>ref|XP_002519985.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF42309.1| receptor protein kinase, putative [Ricinus communis]
Length=988

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            I + TD  D   +++L+D W N PPSW  G DPCG  WEGV C  SRV +L LS+M L G
Sbjct  30   IFSVTDPRDAATLQSLKDSWLNTPPSWGSG-DPCGTPWEGVTCKDSRVTALGLSTMSLAG  88

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            +L+GDI  L+EL  LDLSYN +LTGSL   +G+L+ L  LIL GCGF G IP+ +G+L++
Sbjct  89   KLTGDIGGLTELISLDLSYNPELTGSLTPRLGDLRNLNILILAGCGFTGSIPNELGNLAE  148

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            L +L+LN N   G IPPSLG+LS +YWLDLADN+LTG IP+S   TPGLD 
Sbjct  149  LSFLALNSNNLTGIIPPSLGKLSNVYWLDLADNELTGPIPISTPATPGLDQ  199



>ref|XP_006279556.1| hypothetical protein CARUB_v10025735mg [Capsella rubella]
 gb|EOA12454.1| hypothetical protein CARUB_v10025735mg [Capsella rubella]
Length=1844

 Score =   175 bits (444),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 128/172 (74%), Gaps = 2/172 (1%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            + AFTD +D+  ++ L+  WK +   W +GSDPCG  W G+ CN +RVV+++L +++L G
Sbjct  21   VSAFTDGSDFTVLETLKGEWKTLSEKW-KGSDPCGAEWVGISCNNNRVVNISLGNLNLQG  79

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            +L  DI  L ELQILDL+ N +LTG LP  IGNLKKL  L L+GC F G IPDSIGSL +
Sbjct  80   KLHEDISNLFELQILDLTSNPNLTGQLPLNIGNLKKLTILNLMGCNFTGQIPDSIGSLEQ  139

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTPGLDM  627
            LK LSLNLN F G IPPS+G+LS+LYW D+ADN++ G +PVSDG ++PGLDM
Sbjct  140  LKTLSLNLNNFTGDIPPSIGRLSKLYWFDIADNKIEGGLPVSDGKSSPGLDM  191


 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = +1

Query  121   AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  300
             A  D     A++AL+  W   P +W EGSDPCG +W G+ C   R++S++L ++DL G+L
Sbjct  916   ATFDEASAAALQALKSEWTKFPKNW-EGSDPCGTNWVGITCTNDRIISISLGNLDLEGKL  974

Query  301   SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  480
             S DI  LSELQILDL+ N  LTG LP  IGNLKKL  L L+GCGF G IP+SIGSL +L 
Sbjct  975   SADIAALSELQILDLTSNPKLTGPLPSNIGNLKKLNALNLMGCGFSGQIPESIGSLEQLT  1034

Query  481   ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTPGLDM  627
              LSLN NKFIG IP S+G+LS+L+W D+ADNQ+ G +PVS+G ++PGLDM
Sbjct  1035  TLSLNSNKFIGTIPASIGRLSKLFWFDIADNQIEGKLPVSNGTSSPGLDM  1084



>ref|XP_002467924.1| hypothetical protein SORBIDRAFT_01g036470 [Sorghum bicolor]
 gb|EER94922.1| hypothetical protein SORBIDRAFT_01g036470 [Sorghum bicolor]
Length=966

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 119/170 (70%), Gaps = 1/170 (1%)
 Frame = +1

Query  118  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WEGVGCNGSRVVSLTLSSMDLTG  294
            +A TD+ D   ++AL D W+N PPSW +  DPCGD  WEGV C   +V+S+ LS+M + G
Sbjct  20   LAMTDSQDTSVLRALMDQWQNAPPSWGQSDDPCGDSPWEGVTCGSDKVISIKLSTMGIKG  79

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
             L+ DI +LS LQ LDLS+NKDL+G L   IGNLK+L  LIL GC F G IPD +GSL K
Sbjct  80   TLAADIGQLSNLQSLDLSFNKDLSGVLSPTIGNLKQLTTLILAGCSFHGTIPDELGSLPK  139

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
            L Y++LN N+F G IP SLG LS LYW D+ADNQL+G +PVS     GLD
Sbjct  140  LSYMALNSNQFSGKIPASLGNLSSLYWFDIADNQLSGPLPVSTSGGMGLD  189



>ref|XP_006664421.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Oryza brachyantha]
Length=912

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 122/182 (67%), Gaps = 1/182 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +    + ++     A T+  D   +  +   W + P +W  G DPCGD W G+ C G+RV
Sbjct  8    IFFFSVLVEAFVASADTNAQDTSGLNGIAGSWDSRPSNW-NGLDPCGDKWIGIICTGNRV  66

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
             S+ LSS  L+G LSGDI+ L+ELQ LDLSYNK+L G+LP  IG L KL NLILVGC F 
Sbjct  67   TSIRLSSFGLSGTLSGDIQSLTELQYLDLSYNKNLRGTLPSTIGTLSKLQNLILVGCSFT  126

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  618
            G IP  IG LS L +LSLN NKF G IPPSLG LS+LYW DLADNQLTG +P+S+  +PG
Sbjct  127  GEIPKEIGQLSNLIFLSLNSNKFTGSIPPSLGGLSKLYWFDLADNQLTGGLPISNLTSPG  186

Query  619  LD  624
            LD
Sbjct  187  LD  188



>ref|XP_010442444.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=953

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 131/184 (71%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +LL+ LF     + A T+  D  A+  L+  W + P  W EGSDPCG +W G+ C   RV
Sbjct  9    MLLILLFFHICSVSALTNTLDSSALSGLKSEWTSSPDGW-EGSDPCGTNWVGIKCRNDRV  67

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            +S++L +++L  +L  DI  LSEL+ILDLSYN  L+G LP  IGNLK L +LILVGC F 
Sbjct  68   ISISLGNLNLEAKLPADISFLSELEILDLSYNTGLSGPLPPNIGNLKNLKSLILVGCSFS  127

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  615
            G IP+SIGSL +L YLSLNLNKF G IP S+G+LS+LYW D+ADNQ+ G +PVS+G ++P
Sbjct  128  GEIPESIGSLKELIYLSLNLNKFSGTIPASIGRLSKLYWFDIADNQIEGELPVSNGTSSP  187

Query  616  GLDM  627
            GLDM
Sbjct  188  GLDM  191



>ref|XP_010653092.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Vitis vinifera]
 ref|XP_010653093.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Vitis vinifera]
 ref|XP_010653094.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Vitis vinifera]
Length=961

 Score =   173 bits (439),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 127/172 (74%), Gaps = 1/172 (1%)
 Frame = +1

Query  112  GIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLT  291
            GI+ FT+++D   +++L+  W+N PPSW E SDPCG  WEG+ CN SRV++L LS+M L 
Sbjct  18   GILCFTNSDDAGVLQSLKGQWENTPPSW-EKSDPCGVPWEGITCNNSRVIALGLSTMGLK  76

Query  292  GELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGsls  471
            G+L GDI  L+EL+ LDLS+N  LTGSL  ++GNL+ L  LIL GCGF G IPD +G+L+
Sbjct  77   GKLEGDIGGLTELRSLDLSFNLGLTGSLTPKLGNLENLNILILAGCGFTGQIPDELGNLA  136

Query  472  klkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +L +L+LN N   G IPPSLG+LS LYWLDLA+N+L+G  P S   +PGLD 
Sbjct  137  QLTFLALNSNNLTGQIPPSLGRLSNLYWLDLAENKLSGPFPTSTLTSPGLDQ  188



>ref|XP_009416032.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=965

 Score =   173 bits (439),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 130/186 (70%), Gaps = 6/186 (3%)
 Frame = +1

Query  70   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  249
            R  + L+    Q L + + TD+ D  A+ AL   WKN+P +W   SDPCGD+W G+ CN 
Sbjct  20   RCLVFLLGFLTQMLVVTSDTDSQDAAALNALATLWKNIPSNW-RSSDPCGDNWVGISCNN  78

Query  250  -SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  426
             SRV S++LSS+ L G L+GDI+ L+ELQ LDLSYNK LTG LP  IG+L KL NLILVG
Sbjct  79   ESRVTSISLSSLGLKGTLTGDIQYLTELQALDLSYNKGLTGGLPSSIGSLSKLVNLILVG  138

Query  427  CGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG  606
            C F G IP  IGSLS L +LSLN N F G IP S+G LS LYWLDLADN+L+G+IPVS  
Sbjct  139  CSFSGEIPPEIGSLSLLTFLSLNSNSFTGGIPSSIGNLSNLYWLDLADNKLSGTIPVS--  196

Query  607  NTPGLD  624
              PGLD
Sbjct  197  --PGLD  200



>emb|CAQ58615.1| ATP binding / kinase/ protein serine / threonine kinase [Vitis 
vinifera]
Length=946

 Score =   173 bits (439),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 127/172 (74%), Gaps = 1/172 (1%)
 Frame = +1

Query  112  GIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLT  291
            GI+ FT+++D   +++L+  W+N PPSW E SDPCG  WEG+ CN SRV++L LS+M L 
Sbjct  3    GILCFTNSDDAGVLQSLKGQWENTPPSW-EKSDPCGVPWEGITCNNSRVIALGLSTMGLK  61

Query  292  GELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGsls  471
            G+L GDI  L+EL+ LDLS+N  LTGSL  ++GNL+ L  LIL GCGF G IPD +G+L+
Sbjct  62   GKLEGDIGGLTELRSLDLSFNLGLTGSLTPKLGNLENLNILILAGCGFTGQIPDELGNLA  121

Query  472  klkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            +L +L+LN N   G IPPSLG+LS LYWLDLA+N+L+G  P S   +PGLD 
Sbjct  122  QLTFLALNSNNLTGQIPPSLGRLSNLYWLDLAENKLSGPFPTSTLTSPGLDQ  173



>ref|XP_003593681.1| Somatic embryogenesis receptor-like kinase [Medicago truncatula]
 gb|AES63932.1| LRR receptor-like kinase [Medicago truncatula]
Length=934

 Score =   173 bits (438),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 120/177 (68%), Gaps = 2/177 (1%)
 Frame = +1

Query  100  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSS  279
             Q L + + TD  D+ A+ +L   W N P +W  GSDPCG +W G+GC+ SR+  L L  
Sbjct  16   FQVLHVASQTDRGDFTALSSLTQSWNNRPSNWV-GSDPCGSNWAGIGCDNSRITELKLLG  74

Query  280  MDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSI  459
            + L G+LS  I+ LSEL+ LDLS N  +TG++PREIGNLK L +L LVGCGF G IPDSI
Sbjct  75   LSLEGQLSSAIQSLSELETLDLSSNTGMTGTIPREIGNLKNLNSLALVGCGFSGPIPDSI  134

Query  460  GslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS-DGNTPGLDM  627
            GSL KL +L+LN N F G IP SLG LS L WLDL  NQL G IPVS D   PGLDM
Sbjct  135  GSLKKLTFLALNSNNFTGNIPHSLGNLSNLDWLDLDQNQLEGPIPVSNDQGQPGLDM  191



>ref|XP_004485853.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Cicer arietinum]
Length=934

 Score =   173 bits (438),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 119/171 (70%), Gaps = 2/171 (1%)
 Frame = +1

Query  118  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE  297
             A TD+ D+ A+ +L   WKN P  W  GSDPCG  W+G+ C  SR+  L L  ++L G+
Sbjct  22   AAQTDSGDFTALSSLIQSWKNKPSDWV-GSDPCGSDWDGIRCTNSRITELKLPGLNLVGQ  80

Query  298  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  477
            LS  I+ LSEL  LDLSYN  +TG++PREIGNLK L +L LVGCGF G IPDSIGSL KL
Sbjct  81   LSSAIQSLSELDTLDLSYNTGITGTIPREIGNLKNLNSLALVGCGFIGPIPDSIGSLKKL  140

Query  478  kylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS-DGNTPGLDM  627
             +L+LN NK  G IP SLG LS L WLDLADNQL G IPVS D   PGLDM
Sbjct  141  TFLALNSNKLNGNIPRSLGNLSNLDWLDLADNQLEGPIPVSNDQGQPGLDM  191



>ref|XP_011077100.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Sesamum indicum]
Length=963

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 122/176 (69%), Gaps = 1/176 (1%)
 Frame = +1

Query  100  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSS  279
            I F  I A T+  D   +++L+D W N PPSW   +DPC   WEGV CN SRV SL LS+
Sbjct  17   ICFHVIYAETNAQDAAVLRSLKDEWGNTPPSWDRSNDPCA-AWEGVTCNNSRVTSLGLST  75

Query  280  MDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSI  459
            M LTG++SGDI  LSEL  LDLSYN  LTGSL   +G+L+KL  LIL GC F   IP  +
Sbjct  76   MGLTGKMSGDIGGLSELVSLDLSYNPGLTGSLSPRLGDLQKLTILILAGCSFTNSIPSEL  135

Query  460  GslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            G+LS+L +L+LN N   G IPPSLG+LS+LYWLDLADNQL G IP+S   +PGLD 
Sbjct  136  GNLSELTFLALNSNNLSGDIPPSLGKLSKLYWLDLADNQLKGQIPISSVFSPGLDQ  191



>ref|XP_008345657.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like protein kinase At5g49770 [Malus domestica]
Length=1223

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 130/204 (64%), Gaps = 9/204 (4%)
 Frame = +1

Query  16   VVCFDCWSGMVI**TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSW  195
            V+C    SG       I  ++ L  P F + +  V F+      A+++LR  W NVPPSW
Sbjct  258  VICEPMISGQ----KAISVVKSLGFPCF-EIMDAVGFSA----XALQSLRQTWSNVPPSW  308

Query  196  AEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSL  375
             + +DPC + WEG+ CN SRV +L LS M++ GE+  DI  LSEL+ LDLS+NK LTGSL
Sbjct  309  DKSNDPCXERWEGITCNXSRVTALXLSGMNVKGEIEXDIAGLSELRSLDLSFNKGLTGSL  368

Query  376  PREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYW  555
               +G+L  L  LIL GC F G+IP  +G L  L +L+LN N F G IP SLG LS LYW
Sbjct  369  SPRLGDLSNLNXLILAGCXFSGIIPSELGKLGXLXFLALNTNNFTGSIPASLGNLSNLYW  428

Query  556  LDLADNQLTGSIPVSDGNTPGLDM  627
            LDLADNQLTG +PVS G TPGLD 
Sbjct  429  LDLADNQLTGPLPVSSGTTPGLDQ  452



>ref|XP_010537840.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Tarenaya hassleriana]
Length=964

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 132/186 (71%), Gaps = 0/186 (0%)
 Frame = +1

Query  70   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  249
            R+   LV  F  F  I + TD  D  A+++L D W+N PPSW E  DPCG  WEGV CN 
Sbjct  7    RLLFFLVCCFAVFSVISSVTDPRDAAAMRSLMDQWENTPPSWRESDDPCGTPWEGVTCNN  66

Query  250  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  429
            SR+ +L LS+M L G+LSGDI  L+EL+ LDLS+N  L GSL  ++G+L+ L  LIL GC
Sbjct  67   SRITALGLSTMGLKGKLSGDIGGLTELRSLDLSFNPGLKGSLTPQLGDLQNLNILILAGC  126

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  609
            GF G IP+ +G+LS+L +L+LN N F G IP SLG LS++YWLDLADNQLTG IPVS  +
Sbjct  127  GFTGNIPEELGNLSELSFLALNSNNFSGRIPASLGNLSKVYWLDLADNQLTGPIPVSSPS  186

Query  610  TPGLDM  627
            +PGLD+
Sbjct  187  SPGLDL  192



>ref|XP_006651341.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like, partial [Oryza brachyantha]
Length=964

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 119/167 (71%), Gaps = 1/167 (1%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WEGVGCNGSRVVSLTLSSMDLTGELS  303
            TD+ D   ++AL D W+N PP+W +  DPCGD  W+GV C+ SRV+S+ +S+M + G L+
Sbjct  18   TDSQDTSVLRALMDQWQNAPPTWGQSDDPCGDAPWDGVVCSNSRVISIKISTMGIKGVLA  77

Query  304  GDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklky  483
             DI +L+ELQ LDLS+NKDL G L   IGNLK+L  LIL GC F G IPD +G+L KL Y
Sbjct  78   ADIGQLTELQSLDLSFNKDLGGVLTPNIGNLKQLTTLILAGCSFHGTIPDELGTLPKLSY  137

Query  484  lslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
            ++LN N+F G IP SLG LS LYW D+ADNQLTG +P+S     GLD
Sbjct  138  MALNSNQFSGKIPASLGNLSNLYWFDIADNQLTGPLPISTNGGMGLD  184



>ref|XP_006385115.1| hypothetical protein POPTR_0004s24060g [Populus trichocarpa]
 gb|ERP62912.1| hypothetical protein POPTR_0004s24060g [Populus trichocarpa]
Length=313

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 129/186 (69%), Gaps = 6/186 (3%)
 Frame = +1

Query  85   LVPLFIQFLGIVAF-----TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  249
            + P  + FL + +F     T  +D+  +  L+D W+N P +W  G+DPCG  WEG+ C+ 
Sbjct  1    MCPKVLTFLLVASFQIYTETYGDDFTVMSILKDAWENTPRNWV-GADPCGGKWEGISCHN  59

Query  250  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  429
            SRV S+TL+++ LTGELSGDI  LSEL+ LDLSYN  L+G+LP  I NLKKL  L LVGC
Sbjct  60   SRVTSITLAAVGLTGELSGDISSLSELESLDLSYNTGLSGTLPASIVNLKKLKILKLVGC  119

Query  430  GFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN  609
             F G IP+ IGSL  L+ L LN N+F GPIP S+G LS+L+ LDL++N L G+IPVS G 
Sbjct  120  RFSGPIPELIGSLQLLESLDLNSNRFTGPIPHSIGNLSKLFLLDLSNNMLDGAIPVSSGT  179

Query  610  TPGLDM  627
            T GLDM
Sbjct  180  TSGLDM  185



>gb|KJB57522.1| hypothetical protein B456_009G167900 [Gossypium raimondii]
Length=925

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = +1

Query  172  WKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSY  351
            WKNVP +W  G DPC D W G+GC GSRV SL L +M L G L GDI  LSEL+ LDLSY
Sbjct  4    WKNVPSNWGRG-DPCDDKWVGIGCTGSRVTSLNLPNMKLEGRLVGDIFFLSELKELDLSY  62

Query  352  NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSL  531
            NK L G LP  + NLKKL NLILVGCGF G IPD+IGSL +L+ LSLN N F G IPPS+
Sbjct  63   NKGLRGILPPAVQNLKKLENLILVGCGFSGQIPDTIGSLPQLRILSLNSNAFSGNIPPSI  122

Query  532  GQLSELYWLDLADNQLTGSIPVSDGN-TPGLD  624
            G LS L WLD+ADNQL G IPVS+G+ TPGLD
Sbjct  123  GNLSTLNWLDMADNQLEGEIPVSNGSTTPGLD  154



>ref|XP_008359275.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Malus domestica]
Length=272

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 119/183 (65%), Gaps = 6/183 (3%)
 Frame = +1

Query  82   LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGD-HWEGVGCNGSRV  258
            +L+P F+    I       +YV +K L D W   P SW  GSDPCG+  WEGV C  S V
Sbjct  15   VLIPFFV----IAVEASIQEYVPMKILMDEWNIRPTSWV-GSDPCGNGSWEGVTCTNSHV  69

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
             S+ L+ M LTG +  DIE LSEL++L+LS+N+ L G LP  IG L KL  L LVGC FF
Sbjct  70   TSIALADMALTGSVPSDIELLSELEVLNLSFNRGLKGLLPASIGKLTKLVYLNLVGCSFF  129

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG  618
            G IPD++GSL  L YLSL  N F G IPPS+G ++ L +LDL+DNQL G IPVS+   PG
Sbjct  130  GPIPDTMGSLKHLSYLSLKNNSFSGRIPPSIGNMTNLSFLDLSDNQLXGPIPVSNRTAPG  189

Query  619  LDM  627
            LDM
Sbjct  190  LDM  192



>ref|XP_002311479.2| hypothetical protein POPTR_0008s12450g, partial [Populus trichocarpa]
 gb|EEE88846.2| hypothetical protein POPTR_0008s12450g, partial [Populus trichocarpa]
Length=433

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 118/166 (71%), Gaps = 0/166 (0%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            TD  D   +++L+  W+N PPSW +  DPCG  W GV CN SR+ SL L  M L G LS 
Sbjct  27   TDPGDAAELQSLKSHWQNTPPSWDQTDDPCGAPWVGVTCNNSRITSLKLPCMSLAGNLSD  86

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
             I  L+EL+ LDLS+N ++TGSL   +G+LK L  LIL GCGF G IPD +G+L++L +L
Sbjct  87   RIGGLTELRSLDLSFNPNVTGSLTPRLGDLKNLKILILAGCGFSGSIPDELGNLAELSFL  146

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
            +LN N   G IP SLG+LS+LYWLDLA+NQLTG+IP+S  ++PGLD
Sbjct  147  ALNSNILSGRIPASLGKLSKLYWLDLAENQLTGTIPISKNSSPGLD  192



>ref|NP_001242669.1| probable leucine-rich repeat receptor-like protein kinase At5g49770-like 
precursor [Glycine max]
 gb|ACM89577.1| leucine-rich repeat family protein / protein kinase family protein 
[Glycine max]
Length=723

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 121/168 (72%), Gaps = 2/168 (1%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            TD+ DY  + +L + W N P +W  G DPCG  W+G+ C+ S++  L L  ++L G+LS 
Sbjct  24   TDSQDYSGLNSLTESWSNKPQNWV-GPDPCGSGWDGIRCSNSKITQLRLPGLNLAGQLSS  82

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
             I+ LSEL  LDLSYN  LTG++P+EIGNLKKL +L LVGCGF G IPDSIGSL +L +L
Sbjct  83   AIQSLSELDTLDLSYNTGLTGTIPQEIGNLKKLKSLSLVGCGFSGPIPDSIGSLKQLTFL  142

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN-TPGLDM  627
            +LN N+F G IP SLG LS + WLDLA+NQL G+IPVSD    PGLD+
Sbjct  143  ALNSNRFSGTIPRSLGNLSNIDWLDLAENQLEGTIPVSDDQGRPGLDL  190



>emb|CDY19539.1| BnaC09g13640D [Brassica napus]
Length=938

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 136/193 (70%), Gaps = 5/193 (3%)
 Frame = +1

Query  61   MIPRIQ--LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  234
            M  R Q  +LL+  F Q   + A T+  D  A++AL+  W   P +W +GSDPCG +W G
Sbjct  5    MSSRYQVCMLLILTFCQICSVSALTNGLDASALQALKSEWTRFPENW-KGSDPCGTNWVG  63

Query  235  VGCNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN  411
            + CN +  V+S++L +++L G+LS DI  L+ELQILDL+ N  L+GSLP  IGNL+KL  
Sbjct  64   ITCNNNNHVISISLGNLNLEGKLSADISSLAELQILDLTSNSKLSGSLPSNIGNLRKLTT  123

Query  412  LILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSI  591
            L L+ CGF G IP+SIGSL +L  LSLN NKF G IP S+G+LS+L W D+ADN++ G+I
Sbjct  124  LNLMECGFSGEIPESIGSLEQLITLSLNSNKFSGTIPASIGRLSKLNWFDIADNKIEGTI  183

Query  592  PVSDG-NTPGLDM  627
            PVS+G ++PGLDM
Sbjct  184  PVSNGTSSPGLDM  196



>ref|NP_199788.1| putative leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 sp|Q9LT96.1|Y5977_ARATH RecName: Full=Probable leucine-rich repeat receptor-like protein 
kinase At5g49770; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA98165.1| receptor protein kinase-like [Arabidopsis thaliana]
 gb|ACN59389.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED95855.1| putative leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=946

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 129/177 (73%), Gaps = 3/177 (2%)
 Frame = +1

Query  103  QFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG-SRVVSLTLSS  279
            Q   + AFTD +D+ A++AL++ W  +  SW + SDPCG  W G+ CN  +RVVS++L++
Sbjct  19   QIYSVYAFTDGSDFTALQALKNEWDTLSKSW-KSSDPCGTEWVGITCNNDNRVVSISLTN  77

Query  280  MDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSI  459
             +L G+L  +I  LSELQ LDL+ N +L+G LP  IGNL+KL  L L+GC F G IPDSI
Sbjct  78   RNLKGKLPTEISTLSELQTLDLTGNPELSGPLPANIGNLRKLTFLSLMGCAFNGPIPDSI  137

Query  460  GslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT-PGLDM  627
            G+L +L  LSLNLNKF G IP S+G+LS+LYW D+ADNQL G +PVSDG + PGLDM
Sbjct  138  GNLEQLTRLSLNLNKFSGTIPASMGRLSKLYWFDIADNQLEGKLPVSDGASLPGLDM  194



>ref|XP_009113087.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=934

 Score =   170 bits (430),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS-R  255
            +LL+  F Q   + A T+  D  A++AL+  W   P +W +GSDPCG +W G+ CN +  
Sbjct  9    MLLILAFCQICYVSALTNGLDASALQALKSEWTRFPENW-KGSDPCGTNWVGITCNNNNH  67

Query  256  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  435
            V+S++L +++L G+LS DI  L+ELQILDL+ N  L+GSLP  IGNL+KL  L L+ CGF
Sbjct  68   VISISLGNLNLEGKLSADISSLAELQILDLTSNSKLSGSLPSNIGNLRKLTTLNLMECGF  127

Query  436  FGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NT  612
             G IP+SIGSL +L  LSLN NKF G IP S+G+LS+L W D+ADNQ+ G+IPVS+G ++
Sbjct  128  SGEIPESIGSLDQLITLSLNSNKFSGTIPASIGRLSKLNWFDIADNQIEGTIPVSNGTSS  187

Query  613  PGLDM  627
            PGLDM
Sbjct  188  PGLDM  192



>ref|XP_004972229.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Setaria italica]
Length=961

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 121/185 (65%), Gaps = 0/185 (0%)
 Frame = +1

Query  73   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  252
            I LLLV            TD  D  A+++L  GW+N P SW   +DPCG  W+G+ CN  
Sbjct  6    IPLLLVMFSASLRAGFCDTDPQDVAALQSLMRGWQNFPSSWKASNDPCGAQWDGITCNNG  65

Query  253  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  432
            RV S+ LSS++L G LS  I +LSEL  LDLS N  L+G LP  IGNLK+L  LILVGC 
Sbjct  66   RVTSMRLSSINLQGTLSNSIGQLSELVYLDLSSNSGLSGPLPTSIGNLKQLTTLILVGCS  125

Query  433  FFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT  612
            F G IP  +G+L +L +L+LN N F G IP S+G L+ L+WLDLA+NQL+G IP+S   +
Sbjct  126  FTGGIPQELGNLVQLSFLALNSNNFTGRIPASIGLLTNLFWLDLAENQLSGPIPISSTTS  185

Query  613  PGLDM  627
            PGLD+
Sbjct  186  PGLDL  190



>emb|CDY12939.1| BnaA09g13350D [Brassica napus]
Length=938

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS-R  255
            +LL+  F Q   + A T+  D  A++AL+  W   P +W +GSDPCG +W G+ CN +  
Sbjct  13   MLLILAFCQICYVSALTNGLDASALQALKSEWTRFPENW-KGSDPCGTNWVGITCNNNNH  71

Query  256  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  435
            ++S++L +++L G+LS DI  L+ELQILDL+ N  L+GSLP  IGNL+KL  L L+ CGF
Sbjct  72   IISISLGNLNLEGKLSADISSLAELQILDLTSNSKLSGSLPSNIGNLRKLTTLNLMECGF  131

Query  436  FGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NT  612
             G IP+SIGSL +L  LSLN NKF G IP S+G+LS+L W D+ADNQ+ G+IPVS+G ++
Sbjct  132  SGEIPESIGSLDQLITLSLNSNKFSGTIPASIGRLSKLNWFDIADNQIEGTIPVSNGTSS  191

Query  613  PGLDM  627
            PGLDM
Sbjct  192  PGLDM  196



>ref|XP_002864015.1| hypothetical protein ARALYDRAFT_495037 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40274.1| hypothetical protein ARALYDRAFT_495037 [Arabidopsis lyrata subsp. 
lyrata]
Length=944

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 127/172 (74%), Gaps = 2/172 (1%)
 Frame = +1

Query  115  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  294
            + A TD++D  A++AL+  WK +  SW + SDPCG  W G+ CN +RVVS++L++ +L G
Sbjct  21   VYAITDDSDSTALQALKSEWKTLSKSW-KSSDPCGSGWVGITCNNNRVVSISLTNRNLNG  79

Query  295  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  474
            +L  +I  L+ELQ LDL+ N +L+G LP  IGNLKKL  L L+GC F G IPDSIG+L +
Sbjct  80   KLPTEISTLAELQTLDLTGNPELSGPLPANIGNLKKLIVLSLMGCDFNGEIPDSIGNLEQ  139

Query  475  lkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT-PGLDM  627
            L  LSLNLNKF G IPPS+G+LS+LYW D+ADNQ+ G +PVSDG +  GLDM
Sbjct  140  LTRLSLNLNKFTGTIPPSMGRLSKLYWFDIADNQIEGKLPVSDGASLSGLDM  191



>gb|KHN48167.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=931

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            TD+ DY  + +L + W N P +W  G DPCG  W+G+ C+ SR+  L L  ++L G+LS 
Sbjct  24   TDSQDYSGLNSLTESWSNKPQNWV-GPDPCGSGWDGIRCSNSRITQLRLPGLNLGGQLSS  82

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
             I+ LSEL  LDLSYN  LTG++P+EIGNLKKL +L LVGCGF G IPDSIGSL +L +L
Sbjct  83   AIQSLSELDTLDLSYNTGLTGTVPQEIGNLKKLKSLSLVGCGFSGRIPDSIGSLKQLTFL  142

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN-TPGLDM  627
            +LN N F G IP SLG LS + WLDLA+NQL G+IPVSD    PGLD+
Sbjct  143  ALNSNNFSGTIPRSLGNLSNVDWLDLAENQLEGTIPVSDDQGRPGLDL  190



>ref|XP_006279961.1| hypothetical protein CARUB_v10025827mg [Capsella rubella]
 gb|EOA12859.1| hypothetical protein CARUB_v10025827mg [Capsella rubella]
Length=953

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 134/184 (73%), Gaps = 4/184 (2%)
 Frame = +1

Query  79   LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  258
            +LL+ L  Q     A T+  D  A+KA++D W   P  W EGSDPCG +W GV C    V
Sbjct  9    MLLILLCFQICS--ALTNVFDTTALKAMKDEWTTPPDGW-EGSDPCGTNWVGVKCRNDSV  65

Query  259  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  438
            +S++LS+++L G+L+ DI  LSEL+ILDLSYN  LTG LP +IG+LKKL +LI+V C F 
Sbjct  66   ISISLSNLNLEGKLAPDITILSELEILDLSYNTGLTGPLPVKIGDLKKLKSLIVVRCSFS  125

Query  439  GLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP  615
            G IP+SIGSL +L YLSLNLNKF G IP S+G+LS+LYW D+ADNQ+ G +PVS+  ++P
Sbjct  126  GEIPESIGSLKELVYLSLNLNKFTGMIPASIGRLSKLYWFDIADNQIEGELPVSNSTSSP  185

Query  616  GLDM  627
            GLDM
Sbjct  186  GLDM  189



>ref|XP_011088110.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Sesamum indicum]
Length=954

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 123/189 (65%), Gaps = 1/189 (1%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  240
            M  R+ + L+ +  + L I A T + D  A+ AL+  WKN+PP+W  G DPCG  W+G+ 
Sbjct  12   MSSRVLVFLLLVSTRILAIFAVTYSGDLAALIALKATWKNLPPNWV-GGDPCGSKWDGIN  70

Query  241  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  420
            C  +RV SL L+   L G    DI  L+ LQ LDLS N  L G LP  IGNLK L  LIL
Sbjct  71   CTDTRVTSLMLAGTGLEGSEFSDISSLTGLQFLDLSNNIGLKGVLPSSIGNLKNLTVLIL  130

Query  421  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS  600
            +GC FFG IPDSIGSL +L Y+SLN N F G IPPS+G LS+L WLDL+ N+L G+IPVS
Sbjct  131  IGCSFFGPIPDSIGSLQQLVYISLNSNSFSGSIPPSIGNLSQLSWLDLSMNKLNGTIPVS  190

Query  601  DGNTPGLDM  627
                PGLD+
Sbjct  191  TETAPGLDL  199



>ref|XP_009391655.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=960

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 116/166 (70%), Gaps = 0/166 (0%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            TD  D  A+ +L   W+N PPSW +  DPCG  WEGV C+ SRV SLTLS+M + G L  
Sbjct  22   TDAQDAAALLSLMTQWQNTPPSWGKTDDPCGTPWEGVRCSNSRVTSLTLSTMGIKGTLGD  81

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
            DI +LSEL+ILDLSYN  L G+L   IGNL +L  LILVGC F G IPD +GSL  L YL
Sbjct  82   DIGQLSELKILDLSYNTMLGGTLTPNIGNLMELTILILVGCSFNGNIPDELGSLGNLSYL  141

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
            +LN N+F G IP SLG+LS L W D+ADNQLTG +P+S   +PGLD
Sbjct  142  ALNSNQFTGSIPASLGKLSNLNWFDIADNQLTGPLPISTETSPGLD  187



>ref|XP_002441283.1| hypothetical protein SORBIDRAFT_09g023790 [Sorghum bicolor]
 gb|EES19713.1| hypothetical protein SORBIDRAFT_09g023790 [Sorghum bicolor]
Length=678

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 114/166 (69%), Gaps = 0/166 (0%)
 Frame = +1

Query  130  DNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGD  309
            ++ D  A+ AL+  W N P SW+  SDPC   W+GV CN  RV SL LSS+++ G LS  
Sbjct  33   NSQDGSALNALKSQWTNAPSSWSSASDPCDGGWDGVMCNNGRVTSLRLSSVNIQGTLSDS  92

Query  310  IEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyls  489
            I +L++L  LD+S+N  L G +P  IGNL +L  LIL GC F G IP  +G+L KL +L+
Sbjct  93   IGQLTQLVYLDVSFNIGLNGRMPATIGNLAELTTLILAGCSFTGSIPPELGNLQKLTFLA  152

Query  490  lnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            LN NKF G IPP LG LS L+WLDLADNQLTGSIPV+  NTPGLD 
Sbjct  153  LNSNKFTGTIPPQLGLLSSLFWLDLADNQLTGSIPVTTANTPGLDQ  198



>ref|NP_001176022.1| Os10g0145700 [Oryza sativa Japonica Group]
 dbj|BAH94750.1| Os10g0145700 [Oryza sativa Japonica Group]
Length=309

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +1

Query  184  PPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDL  363
            P +W  G+DPCGD W G+ C G+RV S+ LSS  L+G LSGDI+ LSELQ LDLSYNK+L
Sbjct  29   PSNWGNGNDPCGDKWIGIICTGNRVTSIRLSSFGLSGTLSGDIQSLSELQYLDLSYNKNL  88

Query  364  TGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLS  543
             G LP  IG L KL NLILVGC F G IP  IG LS L +LSLN NKF G IPPSL  LS
Sbjct  89   RGPLPSTIGTLSKLQNLILVGCSFTGEIPKEIGQLSNLIFLSLNSNKFNGSIPPSLCCLS  148

Query  544  ELYWLDLADNQLTGSIPVSDGNTPGLD  624
            +LYW DL+DNQLTG +P+S+  + GLD
Sbjct  149  KLYWFDLSDNQLTGGLPISNWTSLGLD  175



>ref|XP_006588460.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Glycine max]
 gb|KHN32231.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=932

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 121/168 (72%), Gaps = 2/168 (1%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            TD+ DY  + +L + W N P +W  G DPCG  W+G+ C+ S++  L L  ++L G+LS 
Sbjct  24   TDSQDYSGLNSLTESWSNKPQNWV-GPDPCGSGWDGIRCSNSKITQLRLPGLNLAGQLSS  82

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
             I+ LSEL  LDLSYN  LTG++P+EIGNLKKL +L LVGCGF G IPDSIGSL +L +L
Sbjct  83   AIQSLSELDTLDLSYNTGLTGTIPQEIGNLKKLKSLSLVGCGFSGPIPDSIGSLKQLTFL  142

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN-TPGLDM  627
            +LN N+F G IP SLG LS + WLDLA+NQL G+IPVSD    PGLD+
Sbjct  143  ALNSNRFSGTIPRSLGNLSNIDWLDLAENQLEGTIPVSDDQGRPGLDL  190



>ref|XP_008227086.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Prunus mume]
Length=934

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 119/177 (67%), Gaps = 1/177 (1%)
 Frame = +1

Query  94   LFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTL  273
            + I F  I A     +Y  +K L D W   PPSW  GSDPC   WEG+ C  SR+ S+ L
Sbjct  19   VLISFFVIAAEGAIEEYAPMKILMDEWDIRPPSWV-GSDPCVGGWEGIECTNSRITSIAL  77

Query  274  SSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPD  453
            + M LTG+L  DIE LSEL+IL+LS+NK L G LP  IG L KL  L LVGC F G IPD
Sbjct  78   ADMSLTGQLPSDIELLSELEILNLSFNKGLKGPLPASIGKLTKLVYLNLVGCSFVGPIPD  137

Query  454  SIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
            +IGSL +L YLSL  N F G IPPS+G L++L++LDL+DN+L GS PVS+G  PGLD
Sbjct  138  TIGSLKQLSYLSLKNNSFNGLIPPSIGNLTKLFFLDLSDNKLVGSFPVSNGAAPGLD  194



>gb|EYU39493.1| hypothetical protein MIMGU_mgv1a025586mg [Erythranthe guttata]
Length=950

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 129/192 (67%), Gaps = 9/192 (5%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFL---GIVAFTDNNDYVAIKALRDGWKNVPPSW-AEGSDPCGDHW  228
            M  + QLL   + +  L    + A TD+ D   +++L+D W NVPPSW   G DPC   W
Sbjct  1    MAEKRQLLFCYMLVFSLWSCIVYAVTDSQDAAVLRSLKDQWGNVPPSWDTSGGDPCAS-W  59

Query  229  EGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY  408
            EGV CN SRV +L LS+M LTG +SGDI  LSEL  LDLS+N+ LTGSL   +G+L+KL 
Sbjct  60   EGVVCNNSRVTTLGLSTMGLTGTMSGDIGGLSELISLDLSFNRGLTGSLSPRLGDLRKLT  119

Query  409  NLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGS  588
             LIL GC F   IP  +G+LS+L +L+LN N+  G IP SLGQLS LYWLDLADNQLTG 
Sbjct  120  VLILAGCSFTNSIPTELGNLSELTFLALNSNQLSGEIPASLGQLSNLYWLDLADNQLTGQ  179

Query  589  IPVSDGNTPGLD  624
            IPV+    PGLD
Sbjct  180  IPVN----PGLD  187



>ref|XP_006371696.1| hypothetical protein POPTR_0018s002601g, partial [Populus trichocarpa]
 gb|ERP49493.1| hypothetical protein POPTR_0018s002601g, partial [Populus trichocarpa]
Length=204

 Score =   157 bits (396),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 117/161 (73%), Gaps = 1/161 (1%)
 Frame = +1

Query  145  VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELS  324
              +  L+D W+N P +W  G+DPCG  WEG+ C  SRV S+TL+++ LTGELSGDI  LS
Sbjct  15   TVMSILKDAWQNTPRNWV-GADPCGGKWEGISCYNSRVTSITLAAVGLTGELSGDISSLS  73

Query  325  ELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnk  504
            EL++LDLSYN  L+G+LP  I NLKKL  L LVGC F G IP+ IGSL  L+ L LN N+
Sbjct  74   ELEVLDLSYNTGLSGTLPASIVNLKKLKILKLVGCSFSGPIPELIGSLQLLESLDLNSNR  133

Query  505  FIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM  627
            F GPIP S+G LS+L+ LDL++N L G+IPVS G T GLDM
Sbjct  134  FTGPIPHSIGNLSKLFLLDLSNNMLDGAIPVSSGTTSGLDM  174



>ref|XP_003593677.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES63928.1| LRR receptor-like kinase family protein, putative [Medicago truncatula]
Length=503

 Score =   163 bits (413),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 116/168 (69%), Gaps = 2/168 (1%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            TD+ D+ A+ +L   WKN P +W  GSDPCG  W+G+ C+ SR+  L L S+ L G+LS 
Sbjct  25   TDSGDFTALSSLIQSWKNKPLNWV-GSDPCGSDWDGIRCSNSRITELKLPSLKLEGQLSS  83

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
             I+ LSEL+ LD+SYN  +TG +PREIGNLK L +L L GCGF G IPDSIGSL  L +L
Sbjct  84   AIQSLSELETLDISYNAGMTGIIPREIGNLKNLNSLALSGCGFSGPIPDSIGSLKNLTFL  143

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS-DGNTPGLDM  627
            +LN NK  G IP SLG L+ L WLDL  NQL G IPVS D   PGLDM
Sbjct  144  ALNSNKLTGNIPRSLGNLANLDWLDLDKNQLAGPIPVSNDKGQPGLDM  191



>ref|XP_007208219.1| hypothetical protein PRUPE_ppa018586mg, partial [Prunus persica]
 gb|EMJ09418.1| hypothetical protein PRUPE_ppa018586mg, partial [Prunus persica]
Length=934

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 119/157 (76%), Gaps = 1/157 (1%)
 Frame = +1

Query  157  ALRDGWKNVPPSWAEGS-DPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQ  333
            +L+  W N+PPSW + S DPCG +WEGV CN SRV +L LS+MDL G++ GDI  LSEL+
Sbjct  5    SLKGAWTNLPPSWNDKSNDPCGMNWEGVTCNNSRVTALGLSAMDLKGQIEGDIGGLSELR  64

Query  334  ILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIG  513
             LDLS+NK LTGSL   +G+L KL  LIL GCGF G IP+ +G+L +L +L+LN NKF G
Sbjct  65   SLDLSFNKGLTGSLSPRLGDLSKLNILILAGCGFSGNIPEELGNLGELTFLALNTNKFTG  124

Query  514  PIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
             IPPSLG+LS+L WLDL DNQLTG++P+S   T GLD
Sbjct  125  QIPPSLGKLSKLNWLDLVDNQLTGTLPISTPLTSGLD  161



>ref|XP_003541454.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Glycine max]
Length=931

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  306
            TD+ DY  + +L + W   P +W  G DPCG  W+G+ C+ SR+  L L  ++L G+LS 
Sbjct  24   TDSQDYSGLNSLTESWSYKPQNWV-GPDPCGSGWDGIRCSNSRITQLRLPGLNLGGQLSS  82

Query  307  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  486
             I+ LSEL  LDLSYN  LTG++P+EIGNLKKL +L LVGCGF G IPDSIGSL +L +L
Sbjct  83   AIQSLSELDTLDLSYNTGLTGTVPQEIGNLKKLKSLSLVGCGFSGRIPDSIGSLKQLTFL  142

Query  487  slnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN-TPGLDM  627
            +LN N F G IP SLG LS + WLDLA+NQL G+IPVSD    PGLD+
Sbjct  143  ALNSNNFSGTIPRSLGNLSNVDWLDLAENQLEGTIPVSDDQGRPGLDL  190



>ref|XP_008643850.1| PREDICTED: uncharacterized protein LOC100382229 isoform X2 [Zea 
mays]
 ref|XP_008643856.1| PREDICTED: uncharacterized protein LOC100382229 isoform X2 [Zea 
mays]
 tpg|DAA45171.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=984

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 117/167 (70%), Gaps = 1/167 (1%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WEGVGCNGSRVVSLTLSSMDLTGELS  303
            TD+ D   ++AL D W+N PPSW +  DPCG+  WEGV C G +V+S+ LS+M + G L+
Sbjct  41   TDSQDTSVLRALMDQWQNAPPSWGQSDDPCGESPWEGVTCGGDKVISIKLSTMGIQGSLA  100

Query  304  GDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklky  483
             DI +LS+LQ +DLS+N +L G L   IGNLK+L  LIL GC F G IPD +GSL KL Y
Sbjct  101  ADIGQLSDLQSMDLSFNNELGGVLTPTIGNLKQLTTLILSGCSFHGTIPDELGSLPKLSY  160

Query  484  lslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
            ++LN N+F G IP SLG LS LYW D+ADNQL+G +PVS     GLD
Sbjct  161  MALNSNQFSGKIPASLGNLSSLYWFDIADNQLSGPLPVSTDGGMGLD  207



>ref|XP_008643846.1| PREDICTED: uncharacterized protein LOC100382229 isoform X1 [Zea 
mays]
 tpg|DAA45172.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1029

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 117/167 (70%), Gaps = 1/167 (1%)
 Frame = +1

Query  127  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WEGVGCNGSRVVSLTLSSMDLTGELS  303
            TD+ D   ++AL D W+N PPSW +  DPCG+  WEGV C G +V+S+ LS+M + G L+
Sbjct  86   TDSQDTSVLRALMDQWQNAPPSWGQSDDPCGESPWEGVTCGGDKVISIKLSTMGIQGSLA  145

Query  304  GDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklky  483
             DI +LS+LQ +DLS+N +L G L   IGNLK+L  LIL GC F G IPD +GSL KL Y
Sbjct  146  ADIGQLSDLQSMDLSFNNELGGVLTPTIGNLKQLTTLILSGCSFHGTIPDELGSLPKLSY  205

Query  484  lslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
            ++LN N+F G IP SLG LS LYW D+ADNQL+G +PVS     GLD
Sbjct  206  MALNSNQFSGKIPASLGNLSSLYWFDIADNQLSGPLPVSTDGGMGLD  252



>gb|ABF95747.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 gb|EEE58993.1| hypothetical protein OsJ_10704 [Oryza sativa Japonica Group]
Length=975

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 119/169 (70%), Gaps = 1/169 (1%)
 Frame = +1

Query  121  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WEGVGCNGSRVVSLTLSSMDLTGE  297
            A TD+ D   ++AL D W+N PP+W +  DPC D  W+GV C+ +RV+S+ +S+M + G 
Sbjct  32   AVTDSQDTSVLRALMDQWQNAPPTWGQSDDPCSDSPWDGVVCSNNRVISIKISTMGIKGV  91

Query  298  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  477
            L+ DI +L+ELQ LD+S+NKDL G L   IGNLK+L  LIL GC F G IPD +GSL KL
Sbjct  92   LAADIGQLTELQSLDMSFNKDLGGVLTPNIGNLKQLTTLILAGCSFHGNIPDELGSLPKL  151

Query  478  kylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
             Y++LN N+F G IP S+G LS LYW D+ADNQL+G +P+S     GLD
Sbjct  152  SYMALNSNQFSGKIPASMGNLSNLYWFDIADNQLSGPLPISTNGGMGLD  200



>gb|EEC75182.1| hypothetical protein OsI_11410 [Oryza sativa Indica Group]
Length=975

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 119/169 (70%), Gaps = 1/169 (1%)
 Frame = +1

Query  121  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WEGVGCNGSRVVSLTLSSMDLTGE  297
            A TD+ D   ++AL D W+N PP+W +  DPC D  W+GV C+ +RV+S+ +S+M + G 
Sbjct  32   AVTDSQDTSVLRALMDQWQNAPPTWGQSDDPCSDSPWDGVVCSNNRVISIKISTMGIKGV  91

Query  298  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  477
            L+ DI +L+ELQ LD+S+NKDL G L   IGNLK+L  LIL GC F G IPD +GSL KL
Sbjct  92   LAADIGQLTELQSLDMSFNKDLGGVLTPNIGNLKQLTTLILAGCSFHGNIPDELGSLPKL  151

Query  478  kylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
             Y++LN N+F G IP S+G LS LYW D+ADNQL+G +P+S     GLD
Sbjct  152  SYMALNSNQFSGKIPASMGNLSNLYWFDIADNQLSGPLPISTNGGMGLD  200



>ref|XP_003561670.2| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brachypodium distachyon]
Length=978

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 125/191 (65%), Gaps = 3/191 (2%)
 Frame = +1

Query  61   MIPRIQLLLVPLFIQFLGIV--AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WE  231
            M PR   LL  L +     V  A T++ D   ++AL D W++ PP+W +  DPCGD  WE
Sbjct  11   MRPRAVFLLAALVLSVCLRVSHAVTNSQDTSVLRALMDQWQDAPPTWGQSDDPCGDSPWE  70

Query  232  GVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN  411
            GV C+  RV+ + +S+M + G L+ DI +LSELQ LDLS+N DL G L   IGNLK+L  
Sbjct  71   GVTCSNDRVIFIKVSTMGIKGVLAADIGQLSELQSLDLSFNHDLGGVLTPTIGNLKQLTT  130

Query  412  LILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSI  591
            LIL GC F G IPD +GS+ KL Y++LN N+F G IP SLG LS+LYW D+ADN LTG +
Sbjct  131  LILAGCSFHGNIPDELGSVPKLSYMALNSNRFSGNIPASLGNLSDLYWFDIADNLLTGPL  190

Query  592  PVSDGNTPGLD  624
            P+S     GLD
Sbjct  191  PISSNGGMGLD  201



>ref|XP_011461107.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Fragaria vesca subsp. vesca]
Length=881

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 124/190 (65%), Gaps = 4/190 (2%)
 Frame = +1

Query  58   TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  237
            T+  R+ +LLV    +F GI A  ++ DY ++K L   W   PPSW + SDPC   WEG+
Sbjct  21   TLATRVFMLLV--LFKF-GIAAEANSMDYNSLKNLMQEWDIRPPSW-KSSDPCAHGWEGI  76

Query  238  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  417
             C  SRV S+ L+ M L G+L  DI+ LSE++ LDLS NK+LTG +P  IGNL KL NL 
Sbjct  77   DCTNSRVTSIKLAGMGLKGQLPADIQSLSEIETLDLSLNKELTGPIPTSIGNLTKLVNLN  136

Query  418  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  597
            L GC F+G IP +IGSL  L YL LN N   G IPPS+G LSEL +LDL  N+L G+IP+
Sbjct  137  LAGCSFYGPIPQTIGSLKHLYYLDLNNNNLSGQIPPSIGNLSELNYLDLTSNKLGGNIPI  196

Query  598  SDGNTPGLDM  627
            S   T GLDM
Sbjct  197  SSETTLGLDM  206



>ref|XP_011461106.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Fragaria vesca subsp. vesca]
Length=925

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 124/190 (65%), Gaps = 4/190 (2%)
 Frame = +1

Query  58   TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  237
            T+  R+ +LLV    +F GI A  ++ DY ++K L   W   PPSW + SDPC   WEG+
Sbjct  21   TLATRVFMLLV--LFKF-GIAAEANSMDYNSLKNLMQEWDIRPPSW-KSSDPCAHGWEGI  76

Query  238  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  417
             C  SRV S+ L+ M L G+L  DI+ LSE++ LDLS NK+LTG +P  IGNL KL NL 
Sbjct  77   DCTNSRVTSIKLAGMGLKGQLPADIQSLSEIETLDLSLNKELTGPIPTSIGNLTKLVNLN  136

Query  418  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  597
            L GC F+G IP +IGSL  L YL LN N   G IPPS+G LSEL +LDL  N+L G+IP+
Sbjct  137  LAGCSFYGPIPQTIGSLKHLYYLDLNNNNLSGQIPPSIGNLSELNYLDLTSNKLGGNIPI  196

Query  598  SDGNTPGLDM  627
            S   T GLDM
Sbjct  197  SSETTLGLDM  206



>gb|EMT31021.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=943

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 117/168 (70%), Gaps = 1/168 (1%)
 Frame = +1

Query  124  FTDNNDYVAIKALRDGWKNVPPSWAEGSDPCG-DHWEGVGCNGSRVVSLTLSSMDLTGEL  300
             TD+ D   ++AL D W+N PP+W +  DPCG   W+GV C+  RV+S+ +S+M + G L
Sbjct  24   LTDSQDTSVLRALMDQWQNSPPTWGQSDDPCGVSPWDGVTCSNDRVISIKVSTMGIKGLL  83

Query  301  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  480
            + DI +L+ELQ LDLS+NKDL G L   IGNLK+L  LIL GC F G IPD +GSL KL 
Sbjct  84   AADIGQLTELQSLDLSFNKDLGGVLTPTIGNLKQLATLILAGCSFHGNIPDELGSLPKLS  143

Query  481  ylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD  624
            Y++LN N+F G IP SLG LS LYW D+ADNQLTG +P+S     GLD
Sbjct  144  YMALNSNQFSGKIPASLGNLSSLYWFDVADNQLTGPLPISSNGGMGLD  191



>ref|XP_004295860.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Fragaria vesca subsp. vesca]
Length=926

 Score =   165 bits (417),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 124/190 (65%), Gaps = 4/190 (2%)
 Frame = +1

Query  58   TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  237
            T+  R+ +LLV    +F GI A  ++ DY ++K L   W   PPSW + SDPC   WEG+
Sbjct  21   TLATRVFMLLV--LFKF-GIAAEANSMDYNSLKNLMQEWDIRPPSW-KSSDPCAHGWEGI  76

Query  238  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  417
             C  SRV S+ L+ M L G+L  DI+ LSE++ LDLS NK+LTG +P  IGNL KL NL 
Sbjct  77   DCTNSRVTSIKLAGMGLKGQLPADIQSLSEIETLDLSLNKELTGPIPTSIGNLTKLVNLN  136

Query  418  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPPSLGQLSELYWLDLADNQLTGSIPV  597
            L GC F+G IP +IGSL  L YL LN N   G IPPS+G LSEL +LDL  N+L G+IP+
Sbjct  137  LAGCSFYGPIPQTIGSLKHLYYLDLNNNNLSGQIPPSIGNLSELNYLDLTSNKLGGNIPI  196

Query  598  SDGNTPGLDM  627
            S   T GLDM
Sbjct  197  SSETTLGLDM  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250