BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS038F09

Length=621
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009630744.1|  PREDICTED: serine carboxypeptidase II-2            303   1e-97   Nicotiana tomentosiformis
ref|XP_009789305.1|  PREDICTED: serine carboxypeptidase II-2            300   2e-96   Nicotiana sylvestris
ref|XP_004242620.1|  PREDICTED: serine carboxypeptidase II-2            295   2e-94   Solanum lycopersicum
ref|XP_006343604.1|  PREDICTED: serine carboxypeptidase II-2-like       293   1e-93   Solanum tuberosum [potatoes]
gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg                290   2e-92   Erythranthe guttata [common monkey flower]
ref|XP_002528403.1|  serine carboxypeptidase, putative                  290   4e-92   Ricinus communis
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2            288   9e-92   Sesamum indicum [beniseed]
ref|XP_006453576.1|  hypothetical protein CICLE_v10008112mg             283   3e-91   
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            286   7e-91   Vitis vinifera
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            285   1e-90   Prunus mume [ume]
ref|XP_007202013.1|  hypothetical protein PRUPE_ppa005192mg             285   2e-90   Prunus persica
ref|XP_010531651.1|  PREDICTED: serine carboxypeptidase-like 29         275   6e-90   Tarenaya hassleriana [spider flower]
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            283   1e-89   Pyrus x bretschneideri [bai li]
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg             283   2e-89   Citrus clementina [clementine]
gb|KDO62275.1|  hypothetical protein CISIN_1g0418332mg                  278   2e-89   Citrus sinensis [apfelsine]
gb|KDP38717.1|  hypothetical protein JCGZ_04070                         283   2e-89   Jatropha curcas
emb|CDP02851.1|  unnamed protein product                                282   2e-89   Coffea canephora [robusta coffee]
ref|XP_006453578.1|  hypothetical protein CICLE_v10008112mg             282   3e-89   Citrus clementina [clementine]
ref|XP_010273729.1|  PREDICTED: serine carboxypeptidase II-2            282   3e-89   Nelumbo nucifera [Indian lotus]
emb|CBI36578.3|  unnamed protein product                                281   4e-89   Vitis vinifera
ref|XP_002273324.2|  PREDICTED: serine carboxypeptidase II-2            282   6e-89   Vitis vinifera
ref|XP_010526302.1|  PREDICTED: serine carboxypeptidase-like 29         280   2e-88   Tarenaya hassleriana [spider flower]
ref|XP_002324520.1|  serine carboxypeptidase S10 family protein         280   2e-88   
ref|XP_009410194.1|  PREDICTED: serine carboxypeptidase II-2-like       280   2e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002324616.2|  hypothetical protein POPTR_0018s11210g             280   2e-88   
ref|XP_011018072.1|  PREDICTED: serine carboxypeptidase-like 29 i...    278   2e-88   Populus euphratica
ref|XP_008790133.1|  PREDICTED: serine carboxypeptidase II-2 isof...    278   3e-88   Phoenix dactylifera
ref|XP_006474032.1|  PREDICTED: serine carboxypeptidase-like 29-like    279   4e-88   Citrus sinensis [apfelsine]
ref|XP_008394291.1|  PREDICTED: serine carboxypeptidase II-2            279   5e-88   
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase II-2            278   9e-88   Fragaria vesca subsp. vesca
ref|XP_008790132.1|  PREDICTED: serine carboxypeptidase II-2 isof...    278   9e-88   Phoenix dactylifera
ref|XP_011018071.1|  PREDICTED: serine carboxypeptidase II-2-like...    277   2e-87   Populus euphratica
ref|XP_010048771.1|  PREDICTED: serine carboxypeptidase II-2            276   4e-87   Eucalyptus grandis [rose gum]
ref|XP_010040844.1|  PREDICTED: serine carboxypeptidase II-2-like       276   5e-87   Eucalyptus grandis [rose gum]
ref|XP_009395827.1|  PREDICTED: serine carboxypeptidase II-2-like       276   5e-87   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK29659.1|  hypothetical protein AALP_AA7G162000                    276   6e-87   Arabis alpina [alpine rockcress]
gb|KJB76660.1|  hypothetical protein B456_012G098600                    274   6e-87   Gossypium raimondii
ref|XP_006845388.1|  hypothetical protein AMTR_s00019p00053910          275   9e-87   Amborella trichopoda
ref|XP_006387151.1|  hypothetical protein POPTR_1689s00200g             270   1e-86   
ref|XP_004162685.1|  PREDICTED: serine carboxypeptidase-like 29-like    274   4e-86   
gb|KJB76659.1|  hypothetical protein B456_012G098600                    273   8e-86   Gossypium raimondii
ref|XP_004144720.1|  PREDICTED: serine carboxypeptidase-like 29-like    273   1e-85   Cucumis sativus [cucumbers]
ref|XP_008452541.1|  PREDICTED: serine carboxypeptidase II-2            272   2e-85   Cucumis melo [Oriental melon]
gb|KGN61064.1|  hypothetical protein Csa_2G036620                       274   2e-85   
ref|XP_007013884.1|  Serine carboxypeptidase-like 29                    271   3e-85   Theobroma cacao [chocolate]
ref|XP_006286217.1|  hypothetical protein CARUB_v10007783mg             271   4e-85   Capsella rubella
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            271   5e-85   Elaeis guineensis
gb|KHG11306.1|  Serine carboxypeptidase-like 29                         270   2e-84   Gossypium arboreum [tree cotton]
ref|XP_002869361.1|  hypothetical protein ARALYDRAFT_491673             269   3e-84   
ref|XP_010687643.1|  PREDICTED: serine carboxypeptidase II-2            269   4e-84   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS71160.1|  hypothetical protein M569_03591                         267   7e-84   Genlisea aurea
ref|XP_010432944.1|  PREDICTED: serine carboxypeptidase-like 29         268   8e-84   Camelina sativa [gold-of-pleasure]
ref|XP_009127491.1|  PREDICTED: serine carboxypeptidase-like 29         267   1e-83   Brassica rapa
ref|XP_010447670.1|  PREDICTED: serine carboxypeptidase-like 29         267   2e-83   Camelina sativa [gold-of-pleasure]
ref|XP_003564183.1|  PREDICTED: serine carboxypeptidase II-2            267   2e-83   Brachypodium distachyon [annual false brome]
emb|CDY28217.1|  BnaA01g06320D                                          266   3e-83   Brassica napus [oilseed rape]
emb|CDY23258.1|  BnaA08g12880D                                          266   3e-83   Brassica napus [oilseed rape]
ref|XP_009127511.1|  PREDICTED: serine carboxypeptidase-like 29         266   4e-83   Brassica rapa
ref|XP_010438130.1|  PREDICTED: serine carboxypeptidase-like 29         267   4e-83   Camelina sativa [gold-of-pleasure]
emb|CDX68696.1|  BnaC01g07570D                                          266   6e-83   
ref|XP_010111113.1|  Serine carboxypeptidase-like 29                    266   6e-83   
ref|NP_567854.1|  serine carboxypeptidase-like 29                       265   1e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108967.1|  PREDICTED: serine carboxypeptidase-like 29         265   1e-82   
emb|CDY28216.1|  BnaA01g06330D                                          264   3e-82   Brassica napus [oilseed rape]
emb|CDY55623.1|  BnaC03g77560D                                          264   4e-82   Brassica napus [oilseed rape]
ref|XP_006412667.1|  hypothetical protein EUTSA_v10025076mg             262   2e-81   Eutrema salsugineum [saltwater cress]
emb|CDY13387.1|  BnaA03g51050D                                          261   2e-81   Brassica napus [oilseed rape]
ref|XP_009137969.1|  PREDICTED: serine carboxypeptidase-like 29         261   2e-81   Brassica rapa
emb|CAN75200.1|  hypothetical protein VITISV_014887                     262   6e-81   Vitis vinifera
emb|CDX68695.1|  BnaC01g07580D                                          260   1e-80   
gb|KHN02055.1|  Serine carboxypeptidase II-2                            259   1e-80   Glycine soja [wild soybean]
emb|CAA18212.1|  SERINE CARBOXYPEPTIDASE II-like protein                258   2e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003522937.2|  PREDICTED: serine carboxypeptidase II-2-like       259   2e-80   Glycine max [soybeans]
ref|XP_004964646.1|  PREDICTED: serine carboxypeptidase II-2-like       258   4e-80   Setaria italica
ref|XP_006655861.1|  PREDICTED: serine carboxypeptidase II-2-like       258   6e-80   Oryza brachyantha
dbj|BAJ99024.1|  predicted protein                                      258   6e-80   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK02147.1|  predicted protein                                      258   7e-80   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX72270.1|  BnaC07g42920D                                          262   9e-80   
gb|AFW85537.1|  hypothetical protein ZEAMMB73_208131                    254   8e-79   
ref|NP_001146398.1|  Serine carboxypeptidase K10B2.2 precursor          254   2e-78   Zea mays [maize]
ref|XP_004488608.1|  PREDICTED: serine carboxypeptidase II-2-like       254   2e-78   Cicer arietinum [garbanzo]
ref|NP_001057009.1|  Os06g0186400                                       253   7e-78   
sp|P55748.1|CBP22_HORVU  RecName: Full=Serine carboxypeptidase II...    251   1e-77   Hordeum vulgare [barley]
ref|XP_007138291.1|  hypothetical protein PHAVU_009G196000g             251   3e-77   Phaseolus vulgaris [French bean]
emb|CDY32091.1|  BnaC04g44750D                                          248   3e-76   Brassica napus [oilseed rape]
ref|XP_009141519.1|  PREDICTED: serine carboxypeptidase-like 26         247   4e-76   Brassica rapa
gb|AFK34623.1|  unknown                                                 238   5e-76   Lotus japonicus
ref|XP_003595890.1|  Serine carboxypeptidase II-2                       248   6e-76   Medicago truncatula
emb|CDY40438.1|  BnaA04g20790D                                          246   8e-76   Brassica napus [oilseed rape]
ref|XP_003548016.1|  PREDICTED: serine carboxypeptidase-like 27-like    246   3e-75   Glycine max [soybeans]
ref|XP_006350225.1|  PREDICTED: serine carboxypeptidase-like 27-like    245   3e-75   Solanum tuberosum [potatoes]
emb|CDO99730.1|  unnamed protein product                                245   5e-75   Coffea canephora [robusta coffee]
emb|CDP11023.1|  unnamed protein product                                245   8e-75   Coffea canephora [robusta coffee]
ref|XP_003595892.1|  Serine carboxypeptidase II-2                       244   1e-74   Medicago truncatula
gb|KFK36474.1|  hypothetical protein AALP_AA4G129400                    243   1e-74   Arabis alpina [alpine rockcress]
ref|NP_181121.1|  serine carboxypeptidase-like 26                       243   2e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006589433.1|  PREDICTED: serine carboxypeptidase-like 27-like    243   2e-74   Glycine max [soybeans]
ref|XP_006410747.1|  hypothetical protein EUTSA_v10016650mg             243   2e-74   Eutrema salsugineum [saltwater cress]
ref|XP_007143689.1|  hypothetical protein PHAVU_007G093300g             243   3e-74   Phaseolus vulgaris [French bean]
gb|AES66787.2|  serine carboxypeptidase-like protein                    243   4e-74   Medicago truncatula
ref|XP_006294202.1|  hypothetical protein CARUB_v10023198mg             242   4e-74   Capsella rubella
ref|XP_011076996.1|  PREDICTED: serine carboxypeptidase-like 27         243   4e-74   Sesamum indicum [beniseed]
ref|XP_010253608.1|  PREDICTED: serine carboxypeptidase-like 27         242   5e-74   Nelumbo nucifera [Indian lotus]
ref|XP_010505098.1|  PREDICTED: serine carboxypeptidase-like 26         242   5e-74   Camelina sativa [gold-of-pleasure]
gb|ACA61621.1|  hypothetical protein AP7_B10.1                          242   6e-74   Arabidopsis lyrata subsp. petraea
gb|KDP25725.1|  hypothetical protein JCGZ_23946                         242   6e-74   Jatropha curcas
ref|XP_004236634.1|  PREDICTED: serine carboxypeptidase-like 27         242   6e-74   Solanum lycopersicum
ref|XP_002881414.1|  hypothetical protein ARALYDRAFT_482550             241   6e-74   
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         242   6e-74   Nicotiana sylvestris
ref|XP_002312024.1|  serine carboxypeptidase S10 family protein         242   7e-74   Populus trichocarpa [western balsam poplar]
ref|XP_010509560.1|  PREDICTED: serine carboxypeptidase-like 26         241   1e-73   Camelina sativa [gold-of-pleasure]
gb|KJB78940.1|  hypothetical protein B456_013G026200                    239   1e-73   Gossypium raimondii
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         241   1e-73   Nicotiana tomentosiformis
ref|XP_011031767.1|  PREDICTED: serine carboxypeptidase-like 27         241   1e-73   Populus euphratica
ref|XP_003596536.1|  Serine carboxypeptidase                            243   2e-73   
ref|XP_010516783.1|  PREDICTED: serine carboxypeptidase-like 26         240   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_009378094.1|  PREDICTED: serine carboxypeptidase-like 27         240   2e-73   Pyrus x bretschneideri [bai li]
gb|KHN13367.1|  Serine carboxypeptidase-like 27                         241   3e-73   Glycine soja [wild soybean]
ref|XP_004307401.1|  PREDICTED: serine carboxypeptidase-like 27         240   3e-73   Fragaria vesca subsp. vesca
ref|XP_003595891.1|  Serine carboxypeptidase-like protein               241   3e-73   Medicago truncatula
gb|EYU39591.1|  hypothetical protein MIMGU_mgv1a009171mg                237   3e-73   Erythranthe guttata [common monkey flower]
gb|KJB78942.1|  hypothetical protein B456_013G026200                    239   4e-73   Gossypium raimondii
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         240   4e-73   Gossypium arboreum [tree cotton]
gb|KJB76564.1|  hypothetical protein B456_012G094900                    236   4e-73   Gossypium raimondii
gb|KHN17121.1|  Serine carboxypeptidase-like 27                         239   4e-73   Glycine soja [wild soybean]
gb|KJB78939.1|  hypothetical protein B456_013G026200                    239   5e-73   Gossypium raimondii
ref|XP_002315292.2|  serine carboxypeptidase S10 family protein         239   6e-73   Populus trichocarpa [western balsam poplar]
gb|KJB76565.1|  hypothetical protein B456_012G094900                    236   7e-73   Gossypium raimondii
ref|XP_003556225.1|  PREDICTED: serine carboxypeptidase-like 27-l...    239   1e-72   Glycine max [soybeans]
gb|KJB78938.1|  hypothetical protein B456_013G026200                    239   1e-72   Gossypium raimondii
ref|XP_010264739.1|  PREDICTED: serine carboxypeptidase-like 27         238   1e-72   Nelumbo nucifera [Indian lotus]
ref|XP_002534550.1|  serine carboxypeptidase, putative                  236   1e-72   
ref|XP_010669644.1|  PREDICTED: serine carboxypeptidase-like 27         238   2e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010067291.1|  PREDICTED: serine carboxypeptidase-like 28         238   2e-72   Eucalyptus grandis [rose gum]
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27-like    238   2e-72   Cucumis sativus [cucumbers]
gb|AFK37459.1|  unknown                                                 238   2e-72   Lotus japonicus
ref|XP_007009788.1|  Serine carboxypeptidase-like 27 isoform 2          237   3e-72   
ref|XP_008368824.1|  PREDICTED: serine carboxypeptidase-like 27         237   4e-72   Malus domestica [apple tree]
ref|XP_011469672.1|  PREDICTED: serine carboxypeptidase-like 27 i...    237   4e-72   Fragaria vesca subsp. vesca
ref|XP_008381976.1|  PREDICTED: serine carboxypeptidase-like 27         237   5e-72   
ref|XP_004307399.1|  PREDICTED: serine carboxypeptidase-like 27 i...    237   5e-72   Fragaria vesca subsp. vesca
ref|XP_009333715.1|  PREDICTED: serine carboxypeptidase-like 27         237   6e-72   Pyrus x bretschneideri [bai li]
ref|XP_002312023.1|  hypothetical protein POPTR_0008s04130g             237   8e-72   Populus trichocarpa [western balsam poplar]
ref|XP_011040962.1|  PREDICTED: serine carboxypeptidase-like 27         237   8e-72   Populus euphratica
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         236   9e-72   Cucumis melo [Oriental melon]
ref|XP_009141517.1|  PREDICTED: serine carboxypeptidase-like 28         236   9e-72   Brassica rapa
ref|XP_008233341.1|  PREDICTED: serine carboxypeptidase-like 27         236   1e-71   Prunus mume [ume]
ref|XP_010547376.1|  PREDICTED: serine carboxypeptidase-like 27         236   1e-71   Tarenaya hassleriana [spider flower]
gb|KJB76563.1|  hypothetical protein B456_012G094900                    236   2e-71   Gossypium raimondii
emb|CDY40439.1|  BnaA04g20780D                                          235   2e-71   Brassica napus [oilseed rape]
gb|KJB76567.1|  hypothetical protein B456_012G094900                    235   3e-71   Gossypium raimondii
gb|KJB76566.1|  hypothetical protein B456_012G094900                    235   4e-71   Gossypium raimondii
ref|XP_002274723.1|  PREDICTED: serine carboxypeptidase-like 27         234   4e-71   Vitis vinifera
ref|XP_004288721.2|  PREDICTED: serine carboxypeptidase 24              234   5e-71   Fragaria vesca subsp. vesca
gb|KFK38250.1|  hypothetical protein AALP_AA3G088900                    234   6e-71   Arabis alpina [alpine rockcress]
ref|XP_006407773.1|  hypothetical protein EUTSA_v10020705mg             234   6e-71   Eutrema salsugineum [saltwater cress]
ref|XP_007009787.1|  Serine carboxypeptidase-like 27 isoform 1          236   7e-71   
ref|XP_003591950.1|  Serine carboxypeptidase-like protein               233   1e-70   Medicago truncatula
ref|XP_003591949.1|  Serine carboxypeptidase-like protein               233   2e-70   
gb|EPS66906.1|  hypothetical protein M569_07869                         231   2e-70   Genlisea aurea
gb|KJB76571.1|  hypothetical protein B456_012G095000                    233   2e-70   Gossypium raimondii
ref|XP_009147010.1|  PREDICTED: serine carboxypeptidase-like 27 i...    233   2e-70   
gb|AES62200.2|  serine carboxypeptidase-like protein                    234   2e-70   Medicago truncatula
ref|XP_007009790.1|  Serine carboxypeptidase-like 28                    233   2e-70   
ref|XP_010460785.1|  PREDICTED: serine carboxypeptidase-like 27         233   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_011031766.1|  PREDICTED: serine carboxypeptidase-like 27         233   2e-70   Populus euphratica
ref|XP_009147009.1|  PREDICTED: serine carboxypeptidase-like 27 i...    233   3e-70   Brassica rapa
emb|CDY35977.1|  BnaA05g29730D                                          232   3e-70   Brassica napus [oilseed rape]
ref|XP_002274699.1|  PREDICTED: serine carboxypeptidase-like 28         233   3e-70   Vitis vinifera
emb|CBI31484.3|  unnamed protein product                                233   3e-70   Vitis vinifera
gb|KDO48447.1|  hypothetical protein CISIN_1g012819mg                   232   3e-70   Citrus sinensis [apfelsine]
ref|NP_187456.1|  serine carboxypeptidase-like 27                       232   3e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CDY28004.1|  BnaC05g44060D                                          232   4e-70   Brassica napus [oilseed rape]
emb|CAN74854.1|  hypothetical protein VITISV_028701                     232   4e-70   Vitis vinifera
ref|XP_006436271.1|  hypothetical protein CICLE_v10031497mg             232   4e-70   Citrus clementina [clementine]
ref|XP_004496293.1|  PREDICTED: serine carboxypeptidase-like 27-l...    231   5e-70   
ref|XP_010260054.1|  PREDICTED: serine carboxypeptidase-like 25 i...    231   5e-70   Nelumbo nucifera [Indian lotus]
gb|KHG08205.1|  Serine carboxypeptidase-like 27                         231   6e-70   Gossypium arboreum [tree cotton]
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         231   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW65386.1|  hypothetical protein EUGRSUZ_G02816                     231   1e-69   Eucalyptus grandis [rose gum]
gb|KJB76569.1|  hypothetical protein B456_012G094900                    231   1e-69   Gossypium raimondii
ref|XP_011040963.1|  PREDICTED: serine carboxypeptidase-like 27         231   1e-69   Populus euphratica
ref|XP_002315293.2|  hypothetical protein POPTR_0010s22700g             231   1e-69   
ref|XP_010464446.1|  PREDICTED: serine carboxypeptidase-like 27         231   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_009386999.1|  PREDICTED: serine carboxypeptidase-like 27         231   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010486379.1|  PREDICTED: serine carboxypeptidase-like 27         231   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    231   1e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010067290.1|  PREDICTED: serine carboxypeptidase-like 27         232   1e-69   Eucalyptus grandis [rose gum]
ref|XP_004496292.1|  PREDICTED: serine carboxypeptidase-like 27-l...    231   2e-69   Cicer arietinum [garbanzo]
ref|XP_010505097.1|  PREDICTED: serine carboxypeptidase-like 28         231   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_003591947.1|  Serine carboxypeptidase-like protein               230   2e-69   Medicago truncatula
gb|KDO48446.1|  hypothetical protein CISIN_1g016137mg                   228   4e-69   Citrus sinensis [apfelsine]
ref|XP_006297634.1|  hypothetical protein CARUB_v10013654mg             229   4e-69   
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         229   5e-69   Nicotiana sylvestris
ref|NP_181120.2|  serine carboxypeptidase-like 28                       229   5e-69   Arabidopsis thaliana [mouse-ear cress]
emb|CBI21207.3|  unnamed protein product                                229   5e-69   Vitis vinifera
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         229   5e-69   Vitis vinifera
ref|XP_006436272.1|  hypothetical protein CICLE_v10031437mg             229   9e-69   Citrus clementina [clementine]
gb|AFK43035.1|  unknown                                                 228   9e-69   Medicago truncatula
ref|XP_006297635.1|  hypothetical protein CARUB_v10013654mg             228   1e-68   
ref|XP_006294164.1|  hypothetical protein CARUB_v10023157mg             228   1e-68   Capsella rubella
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    228   2e-68   Nelumbo nucifera [Indian lotus]
ref|XP_006850617.1|  hypothetical protein AMTR_s00034p00161680          228   2e-68   Amborella trichopoda
ref|XP_006410746.1|  hypothetical protein EUTSA_v10016610mg             228   3e-68   Eutrema salsugineum [saltwater cress]
gb|KJB75609.1|  hypothetical protein B456_012G048700                    223   3e-68   Gossypium raimondii
ref|XP_009414289.1|  PREDICTED: serine carboxypeptidase-like 27         228   3e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB77373.1|  hypothetical protein B456_012G134700                    228   4e-68   Gossypium raimondii
ref|XP_002882565.1|  hypothetical protein ARALYDRAFT_478140             227   4e-68   Arabidopsis lyrata subsp. lyrata
ref|XP_010920885.1|  PREDICTED: serine carboxypeptidase-like 27         228   4e-68   Elaeis guineensis
gb|KJB77375.1|  hypothetical protein B456_012G134700                    228   5e-68   Gossypium raimondii
ref|XP_002529402.1|  serine carboxypeptidase, putative                  227   5e-68   Ricinus communis
ref|XP_007139483.1|  hypothetical protein PHAVU_008G033300g             226   6e-68   Phaseolus vulgaris [French bean]
emb|CDO99728.1|  unnamed protein product                                226   6e-68   Coffea canephora [robusta coffee]
emb|CDP10248.1|  unnamed protein product                                226   6e-68   Coffea canephora [robusta coffee]
dbj|BAK05698.1|  predicted protein                                      224   8e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAO04184.1|  hypothetical protein                                   226   9e-68   Delphinium grandiflorum
gb|AAM15112.1|  putative serine carboxypeptidase II                     225   1e-67   Arabidopsis thaliana [mouse-ear cress]
gb|KJB07560.1|  hypothetical protein B456_001G032600                    224   1e-67   Gossypium raimondii
gb|ABR16028.1|  unknown                                                 226   1e-67   Picea sitchensis
gb|KDP25724.1|  hypothetical protein JCGZ_23945                         226   1e-67   Jatropha curcas
ref|XP_003549539.1|  PREDICTED: serine carboxypeptidase 24-like         225   1e-67   Glycine max [soybeans]
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         225   1e-67   Nelumbo nucifera [Indian lotus]
ref|XP_010509563.1|  PREDICTED: serine carboxypeptidase-like 28         225   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_009618061.1|  PREDICTED: serine carboxypeptidase-like 34         218   2e-67   Nicotiana tomentosiformis
ref|XP_006373363.1|  hypothetical protein POPTR_0017s12960g             224   2e-67   
ref|XP_002881413.1|  hypothetical protein ARALYDRAFT_321290             225   2e-67   
ref|XP_010089631.1|  Serine carboxypeptidase-like 25                    226   2e-67   Morus notabilis
ref|XP_010516781.1|  PREDICTED: serine carboxypeptidase-like 28         225   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         226   2e-67   Eucalyptus grandis [rose gum]
ref|XP_007032751.1|  Serine carboxypeptidase-like 25 isoform 4          222   3e-67   
ref|XP_003519151.1|  PREDICTED: serine carboxypeptidase 24-like i...    225   3e-67   Glycine max [soybeans]
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         224   4e-67   Nicotiana tomentosiformis
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              224   4e-67   Sesamum indicum [beniseed]
gb|KJB07562.1|  hypothetical protein B456_001G032600                    224   5e-67   Gossypium raimondii
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         224   5e-67   Nelumbo nucifera [Indian lotus]
gb|EYU39590.1|  hypothetical protein MIMGU_mgv1a0101821mg               215   5e-67   Erythranthe guttata [common monkey flower]
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    224   6e-67   Glycine max [soybeans]
ref|XP_003530438.1|  PREDICTED: serine carboxypeptidase-like 25-l...    224   6e-67   
ref|XP_011018041.1|  PREDICTED: serine carboxypeptidase 24-like i...    222   7e-67   Populus euphratica
ref|XP_006453595.1|  hypothetical protein CICLE_v10008182mg             221   7e-67   
ref|XP_008789080.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    224   7e-67   
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         224   7e-67   Populus trichocarpa [western balsam poplar]
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         224   8e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN42831.1|  Serine carboxypeptidase 24                              223   9e-67   Glycine soja [wild soybean]
gb|KFK36473.1|  hypothetical protein AALP_AA4G129300                    223   1e-66   Arabis alpina [alpine rockcress]
emb|CDY43258.1|  BnaC05g48510D                                          223   1e-66   Brassica napus [oilseed rape]
gb|ACA61622.1|  hypothetical protein AP7_B10.2                          215   1e-66   Arabidopsis lyrata subsp. petraea
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         223   1e-66   Solanum lycopersicum
gb|KJB07564.1|  hypothetical protein B456_001G032600                    224   1e-66   Gossypium raimondii
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         223   1e-66   Glycine soja [wild soybean]
gb|EYU44197.1|  hypothetical protein MIMGU_mgv1a005600mg                223   2e-66   Erythranthe guttata [common monkey flower]
ref|XP_006845845.1|  hypothetical protein AMTR_s00154p00033550          223   2e-66   Amborella trichopoda
ref|XP_003570294.1|  PREDICTED: serine carboxypeptidase 24              223   2e-66   Brachypodium distachyon [annual false brome]
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         223   2e-66   Nicotiana sylvestris
ref|XP_010938508.1|  PREDICTED: serine carboxypeptidase II-3-like...    221   2e-66   
ref|XP_007146042.1|  hypothetical protein PHAVU_006G007800g             223   2e-66   Phaseolus vulgaris [French bean]
gb|KJB07559.1|  hypothetical protein B456_001G032600                    223   2e-66   Gossypium raimondii
ref|XP_009147382.1|  PREDICTED: serine carboxypeptidase-like 25         223   2e-66   Brassica rapa
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         223   2e-66   Populus euphratica
emb|CDP02317.1|  unnamed protein product                                223   2e-66   Coffea canephora [robusta coffee]
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          223   2e-66   Sorghum bicolor [broomcorn]
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    223   2e-66   Populus euphratica
ref|XP_011033395.1|  PREDICTED: serine carboxypeptidase 24-like         222   2e-66   Populus euphratica
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    223   2e-66   Solanum tuberosum [potatoes]
ref|XP_006343642.1|  PREDICTED: serine carboxypeptidase 24-like         222   3e-66   Solanum tuberosum [potatoes]
ref|XP_008221066.1|  PREDICTED: serine carboxypeptidase-like 34         223   3e-66   Prunus mume [ume]
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   222   3e-66   Populus trichocarpa [western balsam poplar]
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25         222   4e-66   Fragaria vesca subsp. vesca
gb|KJB75608.1|  hypothetical protein B456_012G048700                    222   4e-66   Gossypium raimondii
ref|XP_008394313.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    222   4e-66   
ref|XP_009358427.1|  PREDICTED: serine carboxypeptidase 24              222   4e-66   Pyrus x bretschneideri [bai li]
ref|XP_006845380.1|  hypothetical protein AMTR_s00019p00043630          221   5e-66   
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             221   5e-66   
ref|XP_009365880.1|  PREDICTED: serine carboxypeptidase-like 25         222   5e-66   Pyrus x bretschneideri [bai li]
gb|KEH21654.1|  serine carboxypeptidase-like protein                    221   6e-66   Medicago truncatula
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                221   6e-66   Gossypium arboreum [tree cotton]
ref|XP_010112534.1|  Serine carboxypeptidase-like 34                    222   7e-66   Morus notabilis
ref|XP_008357779.1|  PREDICTED: serine carboxypeptidase-like 25 i...    221   7e-66   
ref|XP_004146676.1|  PREDICTED: serine carboxypeptidase 24-like         221   7e-66   Cucumis sativus [cucumbers]
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         221   7e-66   
ref|XP_010315500.1|  PREDICTED: serine carboxypeptidase II-3-like       221   8e-66   
ref|XP_008673013.1|  PREDICTED: LOC100285510 isoform X1                 221   8e-66   
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         221   8e-66   
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          221   9e-66   
ref|XP_002275684.1|  PREDICTED: serine carboxypeptidase 24 isofor...    221   9e-66   
gb|KFK37671.1|  hypothetical protein AALP_AA3G013500                    221   9e-66   
ref|XP_008677402.1|  PREDICTED: lysosomal protective protein isof...    221   1e-65   
ref|NP_001152245.1|  lysosomal protective protein precursor             221   1e-65   
dbj|BAJ92218.1|  predicted protein                                      222   1e-65   
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         221   1e-65   
dbj|BAJ85578.1|  predicted protein                                      221   1e-65   
ref|XP_011018040.1|  PREDICTED: serine carboxypeptidase 24-like i...    221   1e-65   
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         221   1e-65   
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              220   1e-65   
ref|NP_001140896.1|  hypothetical protein precursor                     214   1e-65   
ref|XP_004161865.1|  PREDICTED: serine carboxypeptidase 24-like         221   1e-65   
ref|XP_007223035.1|  hypothetical protein PRUPE_ppa005368mg             220   1e-65   
ref|XP_010938507.1|  PREDICTED: serine carboxypeptidase II-3-like...    221   1e-65   
ref|XP_010938742.1|  PREDICTED: serine carboxypeptidase II-3-like       221   2e-65   
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         220   2e-65   
gb|KHN35601.1|  Serine carboxypeptidase II-3                            221   2e-65   
ref|XP_006578498.1|  PREDICTED: serine carboxypeptidase II-3-like       222   2e-65   
emb|CBI29056.3|  unnamed protein product                                220   2e-65   
ref|XP_008365144.1|  PREDICTED: serine carboxypeptidase II-3-like       218   2e-65   
ref|XP_010655923.1|  PREDICTED: serine carboxypeptidase-like 34         221   3e-65   
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          221   3e-65   
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          219   3e-65   
ref|XP_010916829.1|  PREDICTED: serine carboxypeptidase II-3-like       219   3e-65   
ref|XP_006408447.1|  hypothetical protein EUTSA_v10020652mg             219   4e-65   
ref|XP_009413121.1|  PREDICTED: serine carboxypeptidase-like 34         219   4e-65   
gb|KHG16869.1|  Serine carboxypeptidase-like 25                         219   4e-65   
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             219   4e-65   
ref|NP_001151874.1|  LOC100285510 precursor                             219   5e-65   
ref|XP_008443849.1|  PREDICTED: serine carboxypeptidase 24-like i...    219   5e-65   
ref|XP_008800209.1|  PREDICTED: serine carboxypeptidase II-3-like       220   5e-65   
gb|KDO72764.1|  hypothetical protein CISIN_1g011426mg                   216   5e-65   
ref|XP_009794620.1|  PREDICTED: putative serine carboxypeptidase-...    220   5e-65   
gb|EPS67442.1|  hypothetical protein M569_07330                         217   5e-65   
ref|XP_010548637.1|  PREDICTED: serine carboxypeptidase 24              219   5e-65   
ref|XP_004489523.1|  PREDICTED: serine carboxypeptidase-like 25-like    219   6e-65   
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             219   6e-65   
ref|XP_008813040.1|  PREDICTED: serine carboxypeptidase II-3-like       219   6e-65   
ref|XP_010108549.1|  Serine carboxypeptidase 24                         219   7e-65   
ref|XP_011022036.1|  PREDICTED: serine carboxypeptidase-like 34         219   8e-65   
ref|XP_009351733.1|  PREDICTED: serine carboxypeptidase-like 34         219   9e-65   
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         218   9e-65   
ref|XP_009399958.1|  PREDICTED: serine carboxypeptidase II-3-like       219   1e-64   
ref|XP_010546241.1|  PREDICTED: serine carboxypeptidase-like 34 i...    218   1e-64   
gb|AAK44013.1|AF370198_1  putative serine carboxypeptidase II           218   1e-64   
ref|XP_010546240.1|  PREDICTED: serine carboxypeptidase-like 34 i...    218   1e-64   
gb|KJB79850.1|  hypothetical protein B456_013G069700                    218   1e-64   
ref|NP_001141117.1|  uncharacterized protein LOC100273202 precursor     214   1e-64   
ref|XP_010551812.1|  PREDICTED: serine carboxypeptidase-like 25 i...    218   2e-64   
gb|ACL53740.1|  unknown                                                 214   2e-64   
ref|XP_008783277.1|  PREDICTED: serine carboxypeptidase II-3-like       218   2e-64   
ref|XP_003592239.1|  Serine carboxypeptidase-like protein               218   2e-64   
ref|XP_010551814.1|  PREDICTED: serine carboxypeptidase-like 25 i...    218   2e-64   
ref|XP_011083949.1|  PREDICTED: serine carboxypeptidase 24-like i...    217   2e-64   
gb|AAQ63884.1|  putative serine carboxypeptidase                        218   2e-64   
ref|XP_006830191.1|  hypothetical protein AMTR_s00173p00045470          218   2e-64   
ref|XP_008643436.1|  PREDICTED: hypothetical protein isoform X2         218   2e-64   
ref|XP_010906017.1|  PREDICTED: serine carboxypeptidase II-3-like       218   2e-64   
ref|XP_003572740.1|  PREDICTED: serine carboxypeptidase-like 34         218   2e-64   
ref|XP_008361910.1|  PREDICTED: serine carboxypeptidase-like 34         218   2e-64   
gb|KJB76570.1|  hypothetical protein B456_012G095000                    217   2e-64   
ref|XP_008643435.1|  PREDICTED: hypothetical protein isoform X1         218   2e-64   
gb|KHN05312.1|  Serine carboxypeptidase II-3                            218   3e-64   
ref|XP_010942075.1|  PREDICTED: serine carboxypeptidase 24 isofor...    217   3e-64   
ref|NP_194790.1|  serine carboxypeptidase 24                            217   3e-64   
gb|KEH32355.1|  serine carboxypeptidase-like protein                    217   3e-64   
ref|XP_006593897.1|  PREDICTED: serine carboxypeptidase II-3-like       218   3e-64   
ref|XP_002282331.1|  PREDICTED: serine carboxypeptidase II-3-like       217   4e-64   
ref|XP_003592243.1|  Serine carboxypeptidase II-3                       217   4e-64   
ref|XP_006595329.1|  PREDICTED: serine carboxypeptidase II-3-like       217   4e-64   
ref|XP_010323187.1|  PREDICTED: serine carboxypeptidase 24 isofor...    215   4e-64   
gb|KHN05141.1|  Serine carboxypeptidase II-3                            217   4e-64   
gb|KJB07563.1|  hypothetical protein B456_001G032600                    217   5e-64   
gb|KFK27639.1|  hypothetical protein AALP_AA8G409500                    217   5e-64   
ref|XP_010937832.1|  PREDICTED: serine carboxypeptidase-like 27         216   5e-64   
ref|XP_008654562.1|  PREDICTED: uncharacterized protein LOC100273...    213   5e-64   
gb|ABR16596.1|  unknown                                                 218   5e-64   
ref|XP_002520355.1|  serine carboxypeptidase, putative                  219   6e-64   
ref|XP_008783276.1|  PREDICTED: serine carboxypeptidase II-3-like       217   6e-64   
gb|AES71591.2|  serine carboxypeptidase-like protein                    217   6e-64   
ref|XP_006345489.1|  PREDICTED: serine carboxypeptidase-like 40-like    216   6e-64   
ref|XP_010463602.1|  PREDICTED: serine carboxypeptidase-like 25         216   6e-64   
ref|XP_002463311.1|  hypothetical protein SORBIDRAFT_02g041610          218   6e-64   
gb|ABR16997.1|  unknown                                                 218   7e-64   
gb|KCW51319.1|  hypothetical protein EUGRSUZ_J00874                     214   7e-64   
ref|XP_010549997.1|  PREDICTED: serine carboxypeptidase-like 25         216   7e-64   
ref|XP_006297594.1|  hypothetical protein CARUB_v10013616mg             216   7e-64   
gb|EAY76388.1|  hypothetical protein OsI_04319                          216   8e-64   
ref|NP_001044713.1|  Os01g0833500                                       216   8e-64   
ref|XP_002458719.1|  hypothetical protein SORBIDRAFT_03g038940          216   8e-64   
ref|XP_004970465.1|  PREDICTED: serine carboxypeptidase-like 27-like    216   9e-64   
ref|XP_006431295.1|  hypothetical protein CICLE_v10011605mg             216   9e-64   
ref|XP_004502015.1|  PREDICTED: serine carboxypeptidase-like 40-like    216   9e-64   
ref|XP_010445019.1|  PREDICTED: serine carboxypeptidase-like 25         216   9e-64   
ref|XP_006412683.1|  hypothetical protein EUTSA_v10025119mg             213   9e-64   
ref|NP_001150705.1|  LOC100284338 precursor                             216   1e-63   
ref|XP_002306020.2|  serine carboxypeptidase S10 family protein         216   1e-63   
ref|XP_007043281.1|  Serine carboxypeptidase-like 34 isoform 1          216   1e-63   
ref|XP_004297735.1|  PREDICTED: serine carboxypeptidase-like 34         216   1e-63   
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             215   1e-63   
gb|KDP38391.1|  hypothetical protein JCGZ_04316                         216   1e-63   
ref|XP_010447693.1|  PREDICTED: serine carboxypeptidase 24-like         215   1e-63   
ref|NP_191213.1|  alpha/beta-Hydrolases superfamily protein             209   1e-63   
dbj|BAJ94105.1|  predicted protein                                      216   1e-63   
ref|XP_009601275.1|  PREDICTED: serine carboxypeptidase-like 40         216   1e-63   
ref|NP_186860.1|  serine carboxypeptidase-like 25                       215   1e-63   
ref|XP_006434836.1|  hypothetical protein CICLE_v10000968mg             216   2e-63   
ref|XP_006482747.1|  PREDICTED: serine carboxypeptidase-like 25-l...    216   2e-63   
sp|P52711.1|CBP23_HORVU  RecName: Full=Serine carboxypeptidase II...    216   2e-63   
ref|XP_003592237.1|  Serine carboxypeptidase II-3                       216   2e-63   
ref|XP_002452495.1|  hypothetical protein SORBIDRAFT_04g026900          215   2e-63   
gb|KDO75846.1|  hypothetical protein CISIN_1g0117382mg                  211   2e-63   
ref|XP_006473369.1|  PREDICTED: serine carboxypeptidase II-3-like       215   2e-63   
ref|XP_009391583.1|  PREDICTED: serine carboxypeptidase II-3            215   2e-63   
ref|XP_010432963.1|  PREDICTED: serine carboxypeptidase 24 isofor...    215   2e-63   
gb|EEC69980.1|  hypothetical protein OsI_00486                          215   2e-63   
gb|KCW51318.1|  hypothetical protein EUGRSUZ_J00874                     214   2e-63   
gb|KCW66184.1|  hypothetical protein EUGRSUZ_F00022                     215   2e-63   
ref|XP_010041326.1|  PREDICTED: serine carboxypeptidase II-3-like       215   2e-63   
gb|EEC73659.1|  hypothetical protein OsI_08191                          215   2e-63   
ref|XP_003592238.1|  Serine carboxypeptidase II-3                       215   2e-63   
ref|NP_001078615.1|  serine carboxypeptidase-like 34                    214   3e-63   
ref|NP_001047514.1|  Os02g0634700                                       215   3e-63   
ref|XP_008805039.1|  PREDICTED: serine carboxypeptidase-like 27         214   3e-63   
gb|EPS67928.1|  hypothetical protein M569_06845                         214   3e-63   
gb|AAM65698.1|  putative serine carboxypeptidase II                     214   3e-63   
ref|XP_006354981.1|  PREDICTED: serine carboxypeptidase-like 34-like    214   3e-63   
ref|XP_004242603.2|  PREDICTED: serine carboxypeptidase 24 isofor...    215   3e-63   
ref|XP_003564543.1|  PREDICTED: serine carboxypeptidase-like 27         214   3e-63   
ref|XP_009370170.1|  PREDICTED: serine carboxypeptidase II-3-like...    214   3e-63   
ref|XP_009777002.1|  PREDICTED: serine carboxypeptidase-like 40         214   4e-63   
ref|XP_011090479.1|  PREDICTED: serine carboxypeptidase II-3-like       214   4e-63   
gb|ACJ85847.1|  unknown                                                 209   5e-63   
gb|KDP38716.1|  hypothetical protein JCGZ_04069                         207   6e-63   
ref|XP_002316057.2|  serine carboxypeptidase S10 family protein         214   6e-63   
ref|XP_009370169.1|  PREDICTED: serine carboxypeptidase II-3-like...    214   6e-63   
ref|XP_006287580.1|  hypothetical protein CARUB_v10000790mg             214   6e-63   
ref|XP_010031922.1|  PREDICTED: serine carboxypeptidase-like 34         214   7e-63   
ref|NP_001042076.1|  Os01g0158200                                       213   8e-63   
gb|AFW73854.1|  hypothetical protein ZEAMMB73_784908                    214   8e-63   
ref|NP_851062.2|  serine carboxypeptidase-like 34                       214   8e-63   
ref|XP_008461360.1|  PREDICTED: serine carboxypeptidase-like 34         214   8e-63   
ref|XP_009400122.1|  PREDICTED: serine carboxypeptidase II-3-like       214   8e-63   
ref|XP_004231499.1|  PREDICTED: serine carboxypeptidase-like 34         213   8e-63   
ref|XP_008654561.1|  PREDICTED: uncharacterized protein LOC100273...    213   8e-63   
ref|XP_002884303.1|  hypothetical protein ARALYDRAFT_477440             213   9e-63   
ref|XP_002872043.1|  SCPL34                                             214   9e-63   
ref|XP_010485446.1|  PREDICTED: serine carboxypeptidase-like 25         213   9e-63   
ref|XP_009619884.1|  PREDICTED: serine carboxypeptidase 24-like         214   9e-63   
ref|XP_004505704.1|  PREDICTED: serine carboxypeptidase-like 34-like    213   1e-62   
ref|XP_006662015.1|  PREDICTED: serine carboxypeptidase-like 34-like    213   1e-62   
dbj|BAB08188.1|  unnamed protein product                                213   1e-62   
dbj|BAK02399.1|  predicted protein                                      213   1e-62   
gb|ABF70080.1|  serine carboxypeptidase (carboxypeptidase D), put...    213   1e-62   
ref|XP_006412682.1|  hypothetical protein EUTSA_v10025119mg             213   1e-62   
ref|XP_006484531.1|  PREDICTED: serine carboxypeptidase-like 34-like    213   1e-62   
ref|XP_006437593.1|  hypothetical protein CICLE_v10031313mg             213   1e-62   
ref|XP_004508115.1|  PREDICTED: serine carboxypeptidase-like 33-like    213   2e-62   
ref|XP_002876371.1|  predicted protein                                  213   2e-62   
gb|KDP27243.1|  hypothetical protein JCGZ_19942                         212   2e-62   
gb|ACN29008.1|  unknown                                                 214   2e-62   
ref|XP_007035881.1|  Serine carboxypeptidase-like 33                    213   2e-62   
ref|XP_009130122.1|  PREDICTED: serine carboxypeptidase-like 34         213   2e-62   
ref|XP_003592240.1|  Serine carboxypeptidase-like protein               213   2e-62   
gb|KEH32356.1|  serine carboxypeptidase-like protein                    213   2e-62   
ref|XP_007224802.1|  hypothetical protein PRUPE_ppa023729mg             213   2e-62   
gb|ACG38162.1|  serine carboxypeptidase K10B2.2 precursor               212   2e-62   
ref|XP_008654560.1|  PREDICTED: uncharacterized protein LOC100273...    212   2e-62   
ref|XP_010421120.1|  PREDICTED: serine carboxypeptidase-like 34         213   2e-62   
gb|ACF79757.1|  unknown                                                 212   2e-62   
emb|CDY46950.1|  BnaA02g32960D                                          213   2e-62   
ref|XP_002876119.1|  predicted protein                                  213   2e-62   
ref|XP_004137284.1|  PREDICTED: serine carboxypeptidase-like 25-like    212   2e-62   
ref|XP_010907374.1|  PREDICTED: serine carboxypeptidase-like 34         210   2e-62   
ref|XP_006346531.1|  PREDICTED: serine carboxypeptidase II-3-like       212   2e-62   
ref|XP_006285794.1|  hypothetical protein CARUB_v10007268mg             212   3e-62   
ref|XP_010493441.1|  PREDICTED: serine carboxypeptidase-like 34         213   3e-62   
ref|XP_010231680.1|  PREDICTED: serine carboxypeptidase-like 33         212   3e-62   
ref|XP_009801012.1|  PREDICTED: serine carboxypeptidase II-3-like       212   3e-62   
gb|EMT05424.1|  Serine carboxypeptidase II-3                            213   3e-62   
ref|XP_003542323.2|  PREDICTED: serine carboxypeptidase-like 40-l...    212   3e-62   
ref|XP_002983919.1|  serine carboxypeptidase-like enzyme                211   3e-62   
ref|XP_008652806.1|  PREDICTED: serine carboxypeptidase II-3-like       212   4e-62   
ref|XP_003592242.1|  Serine carboxypeptidase-like protein               212   4e-62   
ref|NP_001147904.1|  serine carboxypeptidase 1 precursor                213   4e-62   
ref|XP_006392051.1|  hypothetical protein EUTSA_v10023439mg             211   4e-62   
ref|XP_004135953.1|  PREDICTED: serine carboxypeptidase-like 34-like    212   4e-62   
ref|XP_006392050.1|  hypothetical protein EUTSA_v10023439mg             211   4e-62   
ref|XP_006657371.1|  PREDICTED: serine carboxypeptidase-like 34-like    212   4e-62   
ref|XP_008461353.1|  PREDICTED: serine carboxypeptidase-like 40         213   4e-62   
emb|CDY68103.1|  BnaCnng57600D                                          203   4e-62   
ref|XP_002457307.1|  hypothetical protein SORBIDRAFT_03g005360          211   4e-62   
ref|XP_002960751.1|  serine carboxypeptidase-like enzyme                211   4e-62   
ref|XP_007220730.1|  hypothetical protein PRUPE_ppa023387mg             205   4e-62   
ref|XP_006373364.1|  hypothetical protein POPTR_0017s12960g             212   4e-62   
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...    211   5e-62   
gb|AES71590.2|  serine carboxypeptidase-like protein                    212   5e-62   
dbj|BAJ99174.1|  predicted protein                                      211   5e-62   
ref|XP_010908844.1|  PREDICTED: serine carboxypeptidase-like 27         211   5e-62   
ref|XP_003607259.1|  Serine carboxypeptidase-like protein               211   6e-62   
ref|XP_006853073.1|  hypothetical protein AMTR_s00038p00085900          211   6e-62   
ref|XP_009397583.1|  PREDICTED: serine carboxypeptidase-like 34 i...    211   7e-62   
ref|XP_004953203.1|  PREDICTED: serine carboxypeptidase-like 34-like    211   7e-62   
ref|XP_009397584.1|  PREDICTED: serine carboxypeptidase-like 34 i...    211   7e-62   
gb|KEH30582.1|  serine carboxypeptidase-like protein                    211   7e-62   
dbj|BAD19261.1|  putative serine carboxypeptidase II precursor          209   8e-62   
ref|XP_004135951.1|  PREDICTED: serine carboxypeptidase-like 40-like    211   1e-61   
ref|XP_010454603.1|  PREDICTED: serine carboxypeptidase-like 34         211   1e-61   
ref|XP_008801742.1|  PREDICTED: serine carboxypeptidase-like 33 i...    209   1e-61   
ref|XP_002462503.1|  hypothetical protein SORBIDRAFT_02g026870          211   1e-61   
ref|XP_011075284.1|  PREDICTED: serine carboxypeptidase-like 34         211   1e-61   
ref|XP_010315498.1|  PREDICTED: serine carboxypeptidase II-3-like       211   1e-61   
gb|KHN30516.1|  Serine carboxypeptidase-like 40                         211   1e-61   
ref|XP_003601337.1|  Serine carboxypeptidase-like protein               211   1e-61   
ref|XP_010670278.1|  PREDICTED: serine carboxypeptidase-like 25         210   1e-61   
emb|CBI19568.3|  unnamed protein product                                217   1e-61   



>ref|XP_009630744.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana tomentosiformis]
Length=470

 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 164/192 (85%), Gaps = 2/192 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKG--SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            MS L WG L+F L   T +  G    +S+V Q++LD V  LPG GFNV+F +Y+GYVTVN
Sbjct  1    MSNLKWGFLVFALFFITEVHLGSCFVNSNVVQKQLDKVTKLPGQGFNVNFENYAGYVTVN  60

Query  224  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  403
            +ES RALFYWFFEAV+DPSSKPLVLWLNGGPGCSSIA+GLAEE+GPFH+EKDGKTLYWNP
Sbjct  61   EESERALFYWFFEAVDDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHIEKDGKTLYWNP  120

Query  404  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  583
            YSWNLAANLLF+DSP GVGYSYSNTSSD L +GD RTA DSL FLLKW ERFP+YKGR+F
Sbjct  121  YSWNLAANLLFLDSPVGVGYSYSNTSSDHLNNGDARTAADSLAFLLKWLERFPEYKGRDF  180

Query  584  YITGESYAGHYV  619
            YITGESYAGHYV
Sbjct  181  YITGESYAGHYV  192



>ref|XP_009789305.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana sylvestris]
Length=470

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 163/192 (85%), Gaps = 2/192 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKG--SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            MS L WG L+F L   T +  G     S+V Q++LD V  LPG GFNV+F +Y+GYVTVN
Sbjct  1    MSNLKWGFLVFALFFITEVHLGSCFVDSNVVQKQLDKVSKLPGQGFNVNFENYAGYVTVN  60

Query  224  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  403
            +ES RALFYWFFEAV++PSSKPLVLWLNGGPGCSSIA+GLAEE+GPFH+EKDGKTLYWNP
Sbjct  61   EESERALFYWFFEAVDEPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHIEKDGKTLYWNP  120

Query  404  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  583
            YSWNLAANLLF+DSP GVGYSYSNTSSD L +GD RTA DSL FLLKW ERFP+YKGR+F
Sbjct  121  YSWNLAANLLFLDSPVGVGYSYSNTSSDHLNNGDARTAADSLAFLLKWLERFPEYKGRDF  180

Query  584  YITGESYAGHYV  619
            YITGESYAGHYV
Sbjct  181  YITGESYAGHYV  192



>ref|XP_004242620.1| PREDICTED: serine carboxypeptidase II-2 [Solanum lycopersicum]
Length=465

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            +FV+L   SI G    +   Q++LD V  LPG GFNV+FAHYSGYVTVN++S RALFYWF
Sbjct  7    VFVVLGLFSISGSFSVNPNAQKQLDRVSKLPGQGFNVNFAHYSGYVTVNEDSERALFYWF  66

Query  257  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  436
            FEAV+DPSSKPLVLWLNGGPGCSSIAFGLAEE+GPFH+EKDGKTLYWNPYSWNLAAN+LF
Sbjct  67   FEAVDDPSSKPLVLWLNGGPGCSSIAFGLAEEIGPFHIEKDGKTLYWNPYSWNLAANVLF  126

Query  437  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHY  616
            +DSP GVGYSYSNTSSD L +GD RTA DSL FLLKW ERFP+YKGR+FYI+GESYAGHY
Sbjct  127  LDSPVGVGYSYSNTSSDHLNNGDARTAADSLVFLLKWLERFPEYKGRDFYISGESYAGHY  186

Query  617  V  619
            V
Sbjct  187  V  187



>ref|XP_006343604.1| PREDICTED: serine carboxypeptidase II-2-like [Solanum tuberosum]
Length=465

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            +FV+L    I G    +   Q+ LD V  LPG GFNV+FAHYSGYVTVN+ES RALFYWF
Sbjct  7    VFVVLGLFFISGSFSVTPNAQKLLDRVSKLPGQGFNVNFAHYSGYVTVNEESERALFYWF  66

Query  257  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  436
            FEAV+DPSSKPLVLWLNGGPGCSSIAFGLAEE+GPFH+EKDGKTLYWNPYSWNLAAN+LF
Sbjct  67   FEAVDDPSSKPLVLWLNGGPGCSSIAFGLAEELGPFHIEKDGKTLYWNPYSWNLAANVLF  126

Query  437  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHY  616
            +DSP GVGYSYSNTSSD L +GD RTA DSL FLLKW ERFP+YKGREFYI+GESYAGHY
Sbjct  127  LDSPVGVGYSYSNTSSDHLNNGDTRTAADSLVFLLKWLERFPEYKGREFYISGESYAGHY  186

Query  617  V  619
            V
Sbjct  187  V  187



>gb|EYU34325.1| hypothetical protein MIMGU_mgv1a005646mg [Erythranthe guttata]
Length=476

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 165/198 (83%), Gaps = 8/198 (4%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATS---IDGGKG-----SSSVDQQKLDAVLDLPGLGFNVSFAHYS  205
            MS  +W   L +++L +    I  G G     +SS +QQ+LD V  LPG  FNVSFAHYS
Sbjct  1    MSTFNWVFNLVLVILISELHLISCGAGLSSSKNSSYEQQQLDRVSKLPGQSFNVSFAHYS  60

Query  206  GYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGK  385
            GY TVN+ESGRALFYWFFEA  DPSSKP+VLWLNGGPGCSS+AFGLAEE+GPFH+EKDGK
Sbjct  61   GYATVNKESGRALFYWFFEAEVDPSSKPIVLWLNGGPGCSSVAFGLAEEIGPFHIEKDGK  120

Query  386  TLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQ  565
            ++Y NPYSWN AAN+LF+DSPAGVG+SYSNTSSD+ T+GDKRTA ++LEFLL+WF+RFPQ
Sbjct  121  SIYLNPYSWNKAANILFLDSPAGVGFSYSNTSSDLFTNGDKRTAAENLEFLLQWFKRFPQ  180

Query  566  YKGREFYITGESYAGHYV  619
            YKG +FYITGESYAGHYV
Sbjct  181  YKGNDFYITGESYAGHYV  198



>ref|XP_002528403.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF33996.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score =   290 bits (741),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 158/196 (81%), Gaps = 5/196 (3%)
 Frame = +2

Query  47   EMSALSWGCLLFVLL-----LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGY  211
            EM  L     +F+L      +  S+     +  V QQ LD VL+LPG  FN+SFAHYSGY
Sbjct  7    EMGLLQLFITIFLLFSVNLYVGASVFESTLTDPVAQQGLDRVLELPGQTFNISFAHYSGY  66

Query  212  VTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  391
            VTVNQESGR LFYWF EAVEDP SKPL+LWLNGGPGCSSIA+G AEE+GPFH+++DGKTL
Sbjct  67   VTVNQESGRNLFYWFMEAVEDPDSKPLILWLNGGPGCSSIAYGEAEEIGPFHIQRDGKTL  126

Query  392  YWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYK  571
            Y NPYSWN  ANLLFVDSP GVG+SYSNTSSD+L +GDKRTA DSL FLLKWFERFPQ+K
Sbjct  127  YLNPYSWNQVANLLFVDSPVGVGFSYSNTSSDLLNNGDKRTAADSLAFLLKWFERFPQFK  186

Query  572  GREFYITGESYAGHYV  619
            GR+FYITGESYAGHYV
Sbjct  187  GRDFYITGESYAGHYV  202



>ref|XP_011079368.1| PREDICTED: serine carboxypeptidase II-2 [Sesamum indicum]
Length=474

 Score =   288 bits (738),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 161/195 (83%), Gaps = 5/195 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSID--GGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYV  214
            M+ L+W   L +++    +     + S S D   QQ LD VL LPG  FNVSFAHY+GYV
Sbjct  1    MTTLNWVFNLSLIICVAKLHFISCRASFSPDPPNQQLLDRVLKLPGQNFNVSFAHYAGYV  60

Query  215  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  394
            TVN+ESGRALFYWFFEA EDPSSKPLVLWLNGGPGCSSIA+GLAEE+GPFHVEKDGKTLY
Sbjct  61   TVNKESGRALFYWFFEADEDPSSKPLVLWLNGGPGCSSIAYGLAEEIGPFHVEKDGKTLY  120

Query  395  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKG  574
             NPYSWN  AN+LF+DSP GVG+SYSNTSSD L +GDKRTA D+LEFLL+WFERFPQY+G
Sbjct  121  LNPYSWNKVANILFLDSPVGVGFSYSNTSSDSLNNGDKRTATDNLEFLLQWFERFPQYRG  180

Query  575  REFYITGESYAGHYV  619
             +FYITGESYAGHYV
Sbjct  181  SDFYITGESYAGHYV  195



>ref|XP_006453576.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66816.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=352

 Score =   283 bits (725),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 153/183 (84%), Gaps = 6/183 (3%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFY
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  72   WFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANI  131

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  610
            LF+DSP GVG+SYSNTSSDI T+GDKRTAEDSL+FLLKW ERF Q+KGR+FYI+GESY G
Sbjct  132  LFLDSPVGVGFSYSNTSSDITTNGDKRTAEDSLKFLLKWLERFSQFKGRDFYISGESYGG  191

Query  611  HYV  619
            HYV
Sbjct  192  HYV  194



>ref|XP_002275081.1| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
 emb|CBI36573.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   286 bits (731),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 158/191 (83%), Gaps = 1/191 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            M +L W  +L +L     ++    SS  + QQ+LD V  LPG  FN+SFAHYSGYVTVN+
Sbjct  1    MLSLKWVFVLQILFTLIYLNTPASSSDPLVQQRLDKVQHLPGQAFNISFAHYSGYVTVNE  60

Query  227  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
             SGRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPY
Sbjct  61   NSGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPY  120

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  586
            SWN  AN+LF+DSP GVG+SYSNTSSD+ T+GD RTA+DSL FLLKWFERFPQYKGR+FY
Sbjct  121  SWNQVANILFLDSPVGVGFSYSNTSSDVSTNGDIRTAKDSLAFLLKWFERFPQYKGRDFY  180

Query  587  ITGESYAGHYV  619
            ITGESYAGHYV
Sbjct  181  ITGESYAGHYV  191



>ref|XP_008243035.1| PREDICTED: serine carboxypeptidase II-2 [Prunus mume]
Length=473

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 160/195 (82%), Gaps = 5/195 (3%)
 Frame = +2

Query  50   MSALSWGCLL--FVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  214
            M   SW  +L  F++LL     S+     + ++ QQKLD VL+LPG  FN+SFAHY+GY 
Sbjct  1    MVKPSWAFVLTYFIILLNLHLGSVFATIPTDALAQQKLDKVLELPGQTFNLSFAHYAGYA  60

Query  215  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  394
            TVN++SGRALFYW  EA EDP SKP+VLWLNGGPGCSSIA+G AEEVGPFH++ DGKTLY
Sbjct  61   TVNEDSGRALFYWLVEAAEDPGSKPIVLWLNGGPGCSSIAYGEAEEVGPFHIKADGKTLY  120

Query  395  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKG  574
             NPYSWN  AN+LF+DSP GVG+SYSNTSSD+L++GDKRTAEDSL FLLKWFERFPQYKG
Sbjct  121  LNPYSWNQVANILFLDSPVGVGFSYSNTSSDLLSNGDKRTAEDSLAFLLKWFERFPQYKG  180

Query  575  REFYITGESYAGHYV  619
            REFYITGESY GHYV
Sbjct  181  REFYITGESYGGHYV  195



>ref|XP_007202013.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
 gb|EMJ03212.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
Length=473

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 160/195 (82%), Gaps = 5/195 (3%)
 Frame = +2

Query  50   MSALSWGCLL--FVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  214
            M   SW  +L  F++LL     S+     + ++ QQKLD VL+LPG  FN+SFAHY+GY 
Sbjct  1    MVKPSWAFVLTYFIILLNLHLGSVFATIPTDALAQQKLDKVLELPGQTFNLSFAHYAGYA  60

Query  215  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  394
            TVN++SGRALFYW  EA EDP SKP+VLWLNGGPGCSSIA+G AEEVGPFH++ DGKTLY
Sbjct  61   TVNEDSGRALFYWLVEAAEDPGSKPIVLWLNGGPGCSSIAYGEAEEVGPFHIKADGKTLY  120

Query  395  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKG  574
             NPYSWN  AN+LF+DSP GVG+SYSNTSSD+L++GDKRTAEDSL FLLKWFERFPQYKG
Sbjct  121  LNPYSWNQVANILFLDSPVGVGFSYSNTSSDLLSNGDKRTAEDSLAFLLKWFERFPQYKG  180

Query  575  REFYITGESYAGHYV  619
            REFYITGESY GHYV
Sbjct  181  REFYITGESYGGHYV  195



>ref|XP_010531651.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=204

 Score =   275 bits (702),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 154/183 (84%), Gaps = 2/183 (1%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
             L+F  LLA +  G    SS  +Q+ D V  LPG GFNVSFAHYSGYVTV+++SGRALFY
Sbjct  12   ALIFFTLLANAHLGNCALSS--RQEQDRVSKLPGQGFNVSFAHYSGYVTVHEKSGRALFY  69

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WFFEAVEDP SKPL+LWLNGGPGCSSI +GLAEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  70   WFFEAVEDPDSKPLLLWLNGGPGCSSIGYGLAEEIGPFHIKPDGKTLYLNPYSWNQVANV  129

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  610
            LF+D P GVG+SYSNTSSD+LT+GDKRTA+DSL+FLLKW +RFP+YK R+FYI GESY G
Sbjct  130  LFLDMPVGVGFSYSNTSSDLLTNGDKRTAQDSLKFLLKWLDRFPKYKERDFYIAGESYGG  189

Query  611  HYV  619
            HY+
Sbjct  190  HYI  192



>ref|XP_009358402.1| PREDICTED: serine carboxypeptidase II-2 [Pyrus x bretschneideri]
Length=482

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 154/184 (84%), Gaps = 1/184 (1%)
 Frame = +2

Query  71   CLLFVLLLAT-SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            CL+ +L L   S+     ++   QQKLD V +LPG  FN+SFAH+SGYV VN+E+GRALF
Sbjct  12   CLIILLNLHLGSVFSAPPANPFAQQKLDRVAELPGQSFNLSFAHFSGYVPVNEETGRALF  71

Query  248  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
            YWF EA EDP SKP+VLWLNGGPGCSSIA+G+AEE+GPFH+E DGKTLY NPYSWN  AN
Sbjct  72   YWFVEAAEDPHSKPIVLWLNGGPGCSSIAYGMAEEIGPFHIEADGKTLYLNPYSWNQVAN  131

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
            +LF DSP GVG+SYSNTSSD+L++GDKRTA DSL FLLKWFERFPQYKGR+FYITGESY 
Sbjct  132  VLFFDSPVGVGFSYSNTSSDLLSNGDKRTANDSLTFLLKWFERFPQYKGRDFYITGESYG  191

Query  608  GHYV  619
            GHYV
Sbjct  192  GHYV  195



>ref|XP_006453577.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66817.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=474

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 153/183 (84%), Gaps = 6/183 (3%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFY
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  72   WFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANI  131

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  610
            LF+DSP GVG+SYSNTSSDI T+GDKRTAEDSL+FLLKW ERF Q+KGR+FYI+GESY G
Sbjct  132  LFLDSPVGVGFSYSNTSSDITTNGDKRTAEDSLKFLLKWLERFSQFKGRDFYISGESYGG  191

Query  611  HYV  619
            HYV
Sbjct  192  HYV  194



>gb|KDO62275.1| hypothetical protein CISIN_1g0418332mg, partial [Citrus sinensis]
Length=320

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFYWF EAVEDP SKPLVLWLNG
Sbjct  67   VAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFYWFVEAVEDPDSKPLVLWLNG  126

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSP GVG+SYSNTSSDI
Sbjct  127  GPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPVGVGFSYSNTSSDI  186

Query  491  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
             T+GDKRTAEDSL+FLLKW ERF Q+KGR+FYI+GESY GHYV
Sbjct  187  TTNGDKRTAEDSLKFLLKWLERFSQFKGRDFYISGESYGGHYV  229



>gb|KDP38717.1| hypothetical protein JCGZ_04070 [Jatropha curcas]
Length=478

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            QQ+LD V +LPG  FNVSFAHYSGYVTVN+ESGRALFYWF EAVEDP+SKPLVLWLNGGP
Sbjct  40   QQELDRVWELPGQNFNVSFAHYSGYVTVNEESGRALFYWFIEAVEDPASKPLVLWLNGGP  99

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSI FG AEE+GPFH+  DGKTLY NPYSWN  AN+LF+DSP GVG+SYSNTSSD++ 
Sbjct  100  GCSSIGFGEAEEIGPFHIHADGKTLYLNPYSWNQVANILFIDSPVGVGFSYSNTSSDLVN  159

Query  497  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            +GDKRTA DSL FLLKW ERFPQYKGR+FYITGESYAGHYV
Sbjct  160  NGDKRTAADSLIFLLKWVERFPQYKGRDFYITGESYAGHYV  200



>emb|CDP02851.1| unnamed protein product [Coffea canephora]
Length=472

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 160/196 (82%), Gaps = 8/196 (4%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSS---SVD---QQKLDAVLDLPGLGFNVSFAHYSGY  211
            M+ L+W  +L +L+    ID    SS   S D   QQ+LD VL LPG  FNVSFAHY+G+
Sbjct  1    MATLNW--VLVILISTLLIDLTNCSSCGFSADPYAQQQLDRVLHLPGQNFNVSFAHYAGF  58

Query  212  VTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  391
            VTVN+E+GR LFYWFFEA EDP+SKPLVLWLNGGPGCSSIA+G+AEE+GPFHVEKDGK L
Sbjct  59   VTVNEEAGRTLFYWFFEAAEDPASKPLVLWLNGGPGCSSIAYGVAEEIGPFHVEKDGKHL  118

Query  392  YWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYK  571
            Y NPYSWN AAN+LF+DSP GVGYSYSNT SD L +GD RTA DS  FLLKWF+RFPQYK
Sbjct  119  YLNPYSWNQAANMLFLDSPVGVGYSYSNTPSDHLNNGDLRTAADSHAFLLKWFDRFPQYK  178

Query  572  GREFYITGESYAGHYV  619
            GR+FYI+GESYAGHYV
Sbjct  179  GRDFYISGESYAGHYV  194



>ref|XP_006453578.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66818.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=491

 Score =   282 bits (722),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 153/183 (84%), Gaps = 6/183 (3%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFY
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  72   WFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANI  131

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  610
            LF+DSP GVG+SYSNTSSDI T+GDKRTAEDSL+FLLKW ERF Q+KGR+FYI+GESY G
Sbjct  132  LFLDSPVGVGFSYSNTSSDITTNGDKRTAEDSLKFLLKWLERFSQFKGRDFYISGESYGG  191

Query  611  HYV  619
            HYV
Sbjct  192  HYV  194



>ref|XP_010273729.1| PREDICTED: serine carboxypeptidase II-2 [Nelumbo nucifera]
Length=485

 Score =   282 bits (722),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            QQ+LD VL+LPG  FNVSFAHY+GYVTVN+ SGRALFYWFFEAVEDPSSKPLVLWLNGGP
Sbjct  48   QQQLDRVLELPGQTFNVSFAHYAGYVTVNEASGRALFYWFFEAVEDPSSKPLVLWLNGGP  107

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIA+G AEE+GPFH++ DGKTLY N YSWN  AN+LF++SP GVG+SYSN S D+L 
Sbjct  108  GCSSIAYGEAEEIGPFHIKADGKTLYLNQYSWNQVANVLFLESPVGVGFSYSNNSLDVLN  167

Query  497  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            +GDKRTAEDSL FLLKWFERFPQYKGR+FYITGESYAGHYV
Sbjct  168  NGDKRTAEDSLMFLLKWFERFPQYKGRDFYITGESYAGHYV  208



>emb|CBI36578.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   281 bits (720),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 161/191 (84%), Gaps = 3/191 (2%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            ALS   +  V +L T I+  + +SS D   QQ+LD VL LPG  FN+SFAHY+GYVTVN+
Sbjct  2    ALSPKWVFVVQILLTLINLNRATSSSDPLVQQELDKVLQLPGQTFNISFAHYAGYVTVNE  61

Query  227  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
             +GRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPY
Sbjct  62   YTGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPY  121

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  586
            SWN AAN+LF+D P GVG+SYSN+S DI ++GD RTA+DSL+FLL+WFERFPQYKGR+FY
Sbjct  122  SWNQAANILFLDFPVGVGFSYSNSSFDISSNGDLRTAKDSLKFLLEWFERFPQYKGRDFY  181

Query  587  ITGESYAGHYV  619
            ITGESYAGHYV
Sbjct  182  ITGESYAGHYV  192



>ref|XP_002273324.2| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
Length=510

 Score =   282 bits (722),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 161/191 (84%), Gaps = 3/191 (2%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            ALS   +  V +L T I+  + +SS D   QQ+LD VL LPG  FN+SFAHY+GYVTVN+
Sbjct  42   ALSPKWVFVVQILLTLINLNRATSSSDPLVQQELDKVLQLPGQTFNISFAHYAGYVTVNE  101

Query  227  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
             +GRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPY
Sbjct  102  YTGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPY  161

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  586
            SWN AAN+LF+D P GVG+SYSN+S DI ++GD RTA+DSL+FLL+WFERFPQYKGR+FY
Sbjct  162  SWNQAANILFLDFPVGVGFSYSNSSFDISSNGDLRTAKDSLKFLLEWFERFPQYKGRDFY  221

Query  587  ITGESYAGHYV  619
            ITGESYAGHYV
Sbjct  222  ITGESYAGHYV  232



>ref|XP_010526302.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=489

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 154/183 (84%), Gaps = 3/183 (2%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
             L+F+ LLA   +   G   + +Q+ D V  LPG  FNV+F HYSG+VTVN++ GRALFY
Sbjct  17   ALIFLTLLA---NAHLGICVLSRQQQDKVSKLPGQDFNVNFEHYSGFVTVNEKLGRALFY  73

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WFFEAVEDP SKPLVLWLNGGPGCSSIAFGLAEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  74   WFFEAVEDPDSKPLVLWLNGGPGCSSIAFGLAEEIGPFHIKPDGKTLYLNPYSWNQVANV  133

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  610
            LF+D+P GVGYSYSNTSSD+LT+GDKRTA+DSL+FLLKW ERFP+YKGREFYI GESY G
Sbjct  134  LFLDAPVGVGYSYSNTSSDLLTNGDKRTAQDSLKFLLKWLERFPKYKGREFYIAGESYGG  193

Query  611  HYV  619
            HYV
Sbjct  194  HYV  196



>ref|XP_002324520.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF03085.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=470

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+LWLNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLWLNG  97

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSP GVGYSYSNTSSD+
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPVGVGYSYSNTSSDL  157

Query  491  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            L +GDK+TA DSL FLL WFERFPQYKGR+FYITGESYAGHYV
Sbjct  158  LNNGDKKTAADSLAFLLNWFERFPQYKGRDFYITGESYAGHYV  200



>ref|XP_009410194.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVL  298
            G+S+ ++Q+ D VL LPG  FNVSFAHYSGYVTV+ + GRALFYWFFEAVEDP+SKPLVL
Sbjct  28   GASAFERQEKDRVLRLPGQSFNVSFAHYSGYVTVDDDPGRALFYWFFEAVEDPASKPLVL  87

Query  299  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  478
            WLNGGPGCSSIA+GLAEE+GPFH+  DGK+LY NPY+WN  AN+LF+DSP GVG+SYSN 
Sbjct  88   WLNGGPGCSSIAYGLAEELGPFHINADGKSLYLNPYTWNQVANILFLDSPVGVGFSYSNN  147

Query  479  SSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            S D+LT+GDKRTA+DSL FL KWF+RFPQYKGREFYITGESYAGHYV
Sbjct  148  SQDVLTNGDKRTAKDSLTFLKKWFKRFPQYKGREFYITGESYAGHYV  194



>ref|XP_002324616.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
 gb|EEF03181.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
Length=466

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+LWLNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLWLNG  97

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSP GVGYSYSNTSSD+
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPVGVGYSYSNTSSDL  157

Query  491  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            L +GDK+TA DSL FLL WFERFPQYKGR+FYITGESYAGHYV
Sbjct  158  LNNGDKKTAADSLAFLLNWFERFPQYKGRDFYITGESYAGHYV  200



>ref|XP_011018072.1| PREDICTED: serine carboxypeptidase-like 29 isoform X2 [Populus 
euphratica]
Length=410

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+L LNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLRLNG  97

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSPAGVGYSYSNTSSD+
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPAGVGYSYSNTSSDL  157

Query  491  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            L +GDK+TA DSL FLL WFERFPQYKGR+FYITGESYAGHYV
Sbjct  158  LNNGDKKTAADSLAFLLNWFERFPQYKGRDFYITGESYAGHYV  200



>ref|XP_008790133.1| PREDICTED: serine carboxypeptidase II-2 isoform X2 [Phoenix dactylifera]
Length=441

 Score =   278 bits (712),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 155/181 (86%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            L   + +  +DGG   S  + Q+ D VL LPG  FNVSFAHY+GYVTVN++SGRALFYWF
Sbjct  17   LLFFVFSADVDGG---SPFECQERDRVLHLPGQSFNVSFAHYAGYVTVNEDSGRALFYWF  73

Query  257  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  436
            FEAVEDP+SKPLVLWLNGGPGCSSIA+GLAEE+GPFHV  +GK+LY NPYSWN AAN+LF
Sbjct  74   FEAVEDPASKPLVLWLNGGPGCSSIAYGLAEELGPFHVNANGKSLYLNPYSWNQAANILF  133

Query  437  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHY  616
            +DSP GVG+SYSN S D+L++GD+RTA+DSL FL KWFERFPQYKG++FY+TGESYAGHY
Sbjct  134  LDSPVGVGFSYSNNSQDVLSNGDERTAKDSLVFLKKWFERFPQYKGQDFYLTGESYAGHY  193

Query  617  V  619
            V
Sbjct  194  V  194



>ref|XP_006474032.1| PREDICTED: serine carboxypeptidase-like 29-like [Citrus sinensis]
Length=474

 Score =   279 bits (713),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  301
            +  V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFYWF EAVEDP SKPLVLW
Sbjct  29   TDPVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFYWFVEAVEDPDSKPLVLW  88

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSP GVG+SYSNTS
Sbjct  89   LNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPVGVGFSYSNTS  148

Query  482  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            SDI T+GDKRTAEDSL+FLLKW ERF Q+KGR+FYI+GESY GHYV
Sbjct  149  SDITTNGDKRTAEDSLKFLLKWLERFSQFKGRDFYISGESYGGHYV  194



>ref|XP_008394291.1| PREDICTED: serine carboxypeptidase II-2 [Malus domestica]
Length=482

 Score =   279 bits (714),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 156/195 (80%), Gaps = 5/195 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSS-----VDQQKLDAVLDLPGLGFNVSFAHYSGYV  214
            M+   W   L VL++  ++  G   S+     + QQ LD V  LPG  FN+SFAH+SGYV
Sbjct  1    MAKPRWDSALKVLIILLNLHLGSVFSAPPADPIAQQNLDRVAXLPGQSFNLSFAHFSGYV  60

Query  215  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  394
             VN++SGRALFYWF EA EDP SKP+VLWLNGGPGCSSIA+G+AEE+GPFH+E DGKTLY
Sbjct  61   PVNEDSGRALFYWFVEAAEDPHSKPVVLWLNGGPGCSSIAYGMAEEIGPFHIEADGKTLY  120

Query  395  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKG  574
             NPYSWN  AN+LF DSP GVG+SYSNTSSD+L++GDKRTA DSL FLL+WFERFPQYKG
Sbjct  121  LNPYSWNQVANVLFFDSPVGVGFSYSNTSSDLLSNGDKRTANDSLTFLLQWFERFPQYKG  180

Query  575  REFYITGESYAGHYV  619
            R+FYITGESY GHYV
Sbjct  181  RDFYITGESYGGHYV  195



>ref|XP_004287151.1| PREDICTED: serine carboxypeptidase II-2 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   278 bits (711),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 155/185 (84%), Gaps = 5/185 (3%)
 Frame = +2

Query  80   FVLLLATSIDGGKGSSSVD-----QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            FVL+   ++  G   ++V      QQ+LD V  LPG  FNVSFAHY+GYV VN+++GRAL
Sbjct  8    FVLIFLLNLHLGSVFATVPTDPLVQQQLDRVHGLPGQTFNVSFAHYAGYVNVNEDAGRAL  67

Query  245  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            FYWF EA EDP+SKPLVLWLNGGPGCSSIA+G+AEEVGPFH++ DGKTLY NPYSWN  A
Sbjct  68   FYWFVEAAEDPTSKPLVLWLNGGPGCSSIAYGMAEEVGPFHIQADGKTLYLNPYSWNQVA  127

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  604
            N+LF+DSP GVG+SYSNTSSD++++GDKRTA DSL FLLKW ER+PQYKGR+FYITGESY
Sbjct  128  NILFLDSPVGVGFSYSNTSSDLMSNGDKRTASDSLAFLLKWLERYPQYKGRDFYITGESY  187

Query  605  AGHYV  619
            AGHYV
Sbjct  188  AGHYV  192



>ref|XP_008790132.1| PREDICTED: serine carboxypeptidase II-2 isoform X1 [Phoenix dactylifera]
Length=473

 Score =   278 bits (711),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 155/181 (86%), Gaps = 3/181 (2%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            L   + +  +DGG   S  + Q+ D VL LPG  FNVSFAHY+GYVTVN++SGRALFYWF
Sbjct  17   LLFFVFSADVDGG---SPFECQERDRVLHLPGQSFNVSFAHYAGYVTVNEDSGRALFYWF  73

Query  257  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  436
            FEAVEDP+SKPLVLWLNGGPGCSSIA+GLAEE+GPFHV  +GK+LY NPYSWN AAN+LF
Sbjct  74   FEAVEDPASKPLVLWLNGGPGCSSIAYGLAEELGPFHVNANGKSLYLNPYSWNQAANILF  133

Query  437  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHY  616
            +DSP GVG+SYSN S D+L++GD+RTA+DSL FL KWFERFPQYKG++FY+TGESYAGHY
Sbjct  134  LDSPVGVGFSYSNNSQDVLSNGDERTAKDSLVFLKKWFERFPQYKGQDFYLTGESYAGHY  193

Query  617  V  619
            V
Sbjct  194  V  194



>ref|XP_011018071.1| PREDICTED: serine carboxypeptidase II-2-like isoform X1 [Populus 
euphratica]
Length=478

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+L LNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLRLNG  97

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSPAGVGYSYSNTSSD+
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPAGVGYSYSNTSSDL  157

Query  491  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            L +GDK+TA DSL FLL WFERFPQYKGR+FYITGESYAGHYV
Sbjct  158  LNNGDKKTAADSLAFLLNWFERFPQYKGRDFYITGESYAGHYV  200



>ref|XP_010048771.1| PREDICTED: serine carboxypeptidase II-2 [Eucalyptus grandis]
 gb|KCW81143.1| hypothetical protein EUGRSUZ_C02514 [Eucalyptus grandis]
Length=473

 Score =   276 bits (707),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            QQ+LD VL+LPG  FN+SF HYSGY TVN+ESGR+LFYWF EA EDP SKPLVLWLNGGP
Sbjct  36   QQELDRVLELPGQSFNISFPHYSGYATVNEESGRSLFYWFTEAAEDPDSKPLVLWLNGGP  95

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIA+G+AEE+GPFH+  D  +LY NPYSWNL ANLLF+DSP GVG+SYSNTSSD+L 
Sbjct  96   GCSSIAYGMAEEIGPFHIRPD-MSLYLNPYSWNLVANLLFIDSPVGVGFSYSNTSSDLLN  154

Query  497  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            +GDKRTAEDSL FLLKWFERFPQ+KGREFYITGESY GHYV
Sbjct  155  NGDKRTAEDSLAFLLKWFERFPQFKGREFYITGESYGGHYV  195



>ref|XP_010040844.1| PREDICTED: serine carboxypeptidase II-2-like [Eucalyptus grandis]
 gb|KCW44872.1| hypothetical protein EUGRSUZ_L01547 [Eucalyptus grandis]
Length=473

 Score =   276 bits (706),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            QQ+LD VL+LPG  FN+SF HYSGY TVN+ESGR+LFYWF EA EDP SKPLVLWLNGGP
Sbjct  36   QQELDRVLELPGQSFNISFPHYSGYATVNEESGRSLFYWFTEAAEDPDSKPLVLWLNGGP  95

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIA+G+AEE+GPFH+  D  +LY NPYSWNL ANLLF+DSP GVG+SYSNTSSD+L 
Sbjct  96   GCSSIAYGMAEEIGPFHIRPD-MSLYLNPYSWNLVANLLFIDSPVGVGFSYSNTSSDLLN  154

Query  497  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            +GDKRTAEDSL FLLKWFERFPQ+KGREFYITGESY GHYV
Sbjct  155  NGDKRTAEDSLAFLLKWFERFPQFKGREFYITGESYGGHYV  195



>ref|XP_009395827.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   276 bits (706),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 154/184 (84%), Gaps = 4/184 (2%)
 Frame = +2

Query  68   GCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            G   F+L+LA+S++    +S  +QQ  + VL LPG  F+VSFAHYSGYVTVN+E+GRA F
Sbjct  17   GPFFFLLVLASSLE----ASVFEQQARERVLRLPGQSFDVSFAHYSGYVTVNEEAGRAFF  72

Query  248  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
            YWFFEA E+P+SKPLVLWLNGGPGCSSI  GLAEEVGPFHV  DGK+LY NPYSWN  AN
Sbjct  73   YWFFEATEEPASKPLVLWLNGGPGCSSIGLGLAEEVGPFHVNADGKSLYPNPYSWNQVAN  132

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
            +LF+DSP G G++YSN S D+LT+GDKRTA+D+L FL +WF+RFPQYKGR+FYITGESYA
Sbjct  133  ILFLDSPVGAGFAYSNNSQDVLTNGDKRTAKDNLTFLKRWFKRFPQYKGRDFYITGESYA  192

Query  608  GHYV  619
            GHYV
Sbjct  193  GHYV  196



>gb|KFK29659.1| hypothetical protein AALP_AA7G162000 [Arabis alpina]
Length=478

 Score =   276 bits (706),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M+     CL  + +LA +       + + Q++ D V  LPG  FNVSFAHYSGYVT N++
Sbjct  1    MAKTRGSCLFAITILAIA-HFCNCEAVLSQKEQDKVSTLPGQDFNVSFAHYSGYVTTNEK  59

Query  230  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  409
             GRALFYWFFEAVED +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWFFEAVEDANSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYS  119

Query  410  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYI  589
            WN AAN+LF+D+P GVGYSYSNTSSD+L++GDKRTA+DSL+FLLKW ERFP+YKGREFYI
Sbjct  120  WNQAANILFLDAPVGVGYSYSNTSSDLLSNGDKRTAQDSLKFLLKWVERFPEYKGREFYI  179

Query  590  TGESYAGHYV  619
             GESYAGHY+
Sbjct  180  VGESYAGHYI  189



>gb|KJB76660.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=407

 Score =   274 bits (700),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = +2

Query  80   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFF  259
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALFYWFF
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNEHSGRALFYWFF  78

Query  260  EAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  439
            EA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NPYSWN  AN+LF+
Sbjct  79   EAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNPYSWNQVANILFL  138

Query  440  DSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            +SP GVG+SYSNTSSD+L +GDKRTA+DSL FLLKW ERFPQYK R+FYI GESYAGHYV
Sbjct  139  ESPVGVGFSYSNTSSDLLNNGDKRTAKDSLTFLLKWLERFPQYKERDFYIAGESYAGHYV  198



>ref|XP_006845388.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
 gb|ERN07063.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
Length=473

 Score =   275 bits (704),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 155/191 (81%), Gaps = 12/191 (6%)
 Frame = +2

Query  71   CLLFVLLLATSI--------DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            CLLF++ L   +        D  +G+S V+    D VL LPG  F+VSFAHYSGYVTVN+
Sbjct  7    CLLFLIHLHIFLQVKGTIVEDEDRGASQVN----DRVLKLPGQAFDVSFAHYSGYVTVNK  62

Query  227  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
            E+GRALFYWFFEAV+DPSSKPLV+WLNGGPGCSSIA+G AEE+GPFH+  DGKTLY NP 
Sbjct  63   EAGRALFYWFFEAVDDPSSKPLVVWLNGGPGCSSIAYGEAEEIGPFHIRPDGKTLYLNPD  122

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  586
            SWN  ANLLFVDSP GVG+SYSNTS DI+++GDKRTAEDSL FL  W +RFPQYKGR+FY
Sbjct  123  SWNQVANLLFVDSPVGVGFSYSNTSEDIISNGDKRTAEDSLAFLHNWLKRFPQYKGRDFY  182

Query  587  ITGESYAGHYV  619
            +TGESYAGHYV
Sbjct  183  LTGESYAGHYV  193



>ref|XP_006387151.1| hypothetical protein POPTR_1689s00200g [Populus trichocarpa]
 gb|ERP46065.1| hypothetical protein POPTR_1689s00200g [Populus trichocarpa]
Length=324

 Score =   270 bits (691),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 143/169 (85%), Gaps = 6/169 (4%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            V QQ LD V  LPG  F+V+FAHYSGYVTVN++ GRALFYW  EAVEDP SKPL+LWLNG
Sbjct  38   VAQQHLDRVQKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWLVEAVEDPQSKPLLLWLNG  97

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN------LAANLLFVDSPAGVGYSYS  472
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN        AN+LF+DSP GVGYSYS
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQYFNQFAVANILFLDSPVGVGYSYS  157

Query  473  NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            NTSSD+L +GDK+TA DSL FLL WFERFPQYKGR+FYITGESYAGHYV
Sbjct  158  NTSSDLLNNGDKKTAADSLAFLLNWFERFPQYKGRDFYITGESYAGHYV  206



>ref|XP_004162685.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   274 bits (700),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNGGP
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  91

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIA+G AEE+GPFH+  DGK++Y NPYSWN  AN+LF+DSPAGVG+SYSNTSSD++ 
Sbjct  92   GCSSIAYGEAEEIGPFHINADGKSVYLNPYSWNEVANVLFLDSPAGVGFSYSNTSSDLMN  151

Query  497  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            +GDKRTAEDSL FLLKWFERFPQ+KGR+FYITGESY GHYV
Sbjct  152  NGDKRTAEDSLAFLLKWFERFPQFKGRDFYITGESYGGHYV  192



>gb|KJB76659.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=487

 Score =   273 bits (699),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = +2

Query  80   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFF  259
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALFYWFF
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNEHSGRALFYWFF  78

Query  260  EAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  439
            EA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NPYSWN  AN+LF+
Sbjct  79   EAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNPYSWNQVANILFL  138

Query  440  DSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            +SP GVG+SYSNTSSD+L +GDKRTA+DSL FLLKW ERFPQYK R+FYI GESYAGHYV
Sbjct  139  ESPVGVGFSYSNTSSDLLNNGDKRTAKDSLTFLLKWLERFPQYKERDFYIAGESYAGHYV  198



>ref|XP_004144720.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNGGP
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  91

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIA+G AEE+GPFH+  DGK +Y NPYSWN  AN+LF+DSPAGVG+SYSNTSSD++ 
Sbjct  92   GCSSIAYGEAEEIGPFHINADGKPVYLNPYSWNEVANVLFLDSPAGVGFSYSNTSSDLMN  151

Query  497  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            +GDKRTAEDSL FLLKWFERFPQ+KGR+FYITGESY GHYV
Sbjct  152  NGDKRTAEDSLAFLLKWFERFPQFKGRDFYITGESYGGHYV  192



>ref|XP_008452541.1| PREDICTED: serine carboxypeptidase II-2 [Cucumis melo]
Length=468

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNGGP
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  91

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIAFG AEE+GPFH+  DGK++Y NPYSWN  AN+LF+DSPAGVG+SYSNTSSD++ 
Sbjct  92   GCSSIAFGEAEEIGPFHINADGKSVYLNPYSWNEVANVLFLDSPAGVGFSYSNTSSDLMN  151

Query  497  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            +GDKRTAEDSL FLLKWFERFPQ+KG +FYITGESY GHYV
Sbjct  152  NGDKRTAEDSLAFLLKWFERFPQFKGSDFYITGESYGGHYV  192



>gb|KGN61064.1| hypothetical protein Csa_2G036620 [Cucumis sativus]
Length=542

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNGGP
Sbjct  106  QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  165

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIA+G AEE+GPFH+  DGK +Y NPYSWN  AN+LF+DSPAGVG+SYSNTSSD++ 
Sbjct  166  GCSSIAYGEAEEIGPFHINADGKPVYLNPYSWNEVANVLFLDSPAGVGFSYSNTSSDLMN  225

Query  497  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            +GDKRTAEDSL FLLKWFERFPQ+KGR+FYITGESY GHYV
Sbjct  226  NGDKRTAEDSLAFLLKWFERFPQFKGRDFYITGESYGGHYV  266



>ref|XP_007013884.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
 gb|EOY31503.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
Length=476

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 148/177 (84%), Gaps = 5/177 (3%)
 Frame = +2

Query  89   LLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAV  268
            ++ATS++      SV QQKLD V  LPG  FNVSFAHY+GYVTVN+ SGRALFYWFFEA 
Sbjct  27   VIATSLE-----DSVAQQKLDKVPKLPGQNFNVSFAHYAGYVTVNEGSGRALFYWFFEAA  81

Query  269  EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSP  448
            EDP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPYSWN  ANLLF++SP
Sbjct  82   EDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTLYLNPYSWNKVANLLFLESP  141

Query  449  AGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
             GVG+SYSNTS D+L +GDKRTA+DSL FLLKW ERFPQYK R+FYI GESY GHYV
Sbjct  142  IGVGFSYSNTSFDLLNNGDKRTAKDSLAFLLKWLERFPQYKERDFYIAGESYGGHYV  198



>ref|XP_006286217.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
 gb|EOA19115.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
Length=479

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 151/184 (82%), Gaps = 2/184 (1%)
 Frame = +2

Query  68   GCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
              L+ + LLAT+    +   S  +Q  D V  LPG  FNVSFAHYSG++T N++ GRALF
Sbjct  11   NALIAIALLATTAHLCEAGLSRKEQ--DKVSKLPGQNFNVSFAHYSGFITTNEKLGRALF  68

Query  248  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
            YWFFEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN
Sbjct  69   YWFFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAAN  128

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
            +LF+D+P GVGYSYSNTSSD+ T+GDKRTA+DSL+FLLKW ERFP+YKGR+FYI GESYA
Sbjct  129  ILFLDAPVGVGYSYSNTSSDLQTNGDKRTAQDSLKFLLKWVERFPEYKGRDFYIVGESYA  188

Query  608  GHYV  619
            GHY+
Sbjct  189  GHYI  192



>ref|XP_010905043.1| PREDICTED: serine carboxypeptidase II-2 [Elaeis guineensis]
Length=471

 Score =   271 bits (693),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +2

Query  116  KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLV  295
             G S   +Q+ D V  LPG  FNVSFAHY+GYVTVN++SGRALFYWFFEAVEDP SKPLV
Sbjct  25   NGGSPFVRQEGDRVQRLPGQSFNVSFAHYAGYVTVNEDSGRALFYWFFEAVEDPVSKPLV  84

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+GLAEEVGPFHV  DG++LY NPYSWN  AN+LF+DSP GVG+SYSN
Sbjct  85   LWLNGGPGCSSIAYGLAEEVGPFHVNADGQSLYLNPYSWNQVANILFLDSPVGVGFSYSN  144

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
             S D+L++GD+RTA+DSL FL KWFERFPQYKG++FY+TGESYAGHYV
Sbjct  145  NSQDVLSNGDERTAKDSLIFLKKWFERFPQYKGQDFYLTGESYAGHYV  192



>gb|KHG11306.1| Serine carboxypeptidase-like 29 [Gossypium arboreum]
Length=487

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = +2

Query  80   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFF  259
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALFYWFF
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNKHSGRALFYWFF  78

Query  260  EAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  439
            EA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NPYSWN   N+LF+
Sbjct  79   EAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNPYSWNQVVNILFL  138

Query  440  DSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            +SP GVG+SYSNTSSD+L +GDKRTA+DSL FLLKW ERFPQYK R+FYI GESY GHYV
Sbjct  139  ESPVGVGFSYSNTSSDLLNNGDKRTAKDSLTFLLKWLERFPQYKERDFYIAGESYGGHYV  198



>ref|XP_002869361.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45620.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 151/192 (79%), Gaps = 2/192 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSI--DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            M+     C L   L+A +         + + Q++ D V  LPG  FNVSFAHYSG+VT N
Sbjct  1    MAKTRGSCCLVNALIAIAFLATAHLCEAGLSQKEQDKVSKLPGQNFNVSFAHYSGFVTTN  60

Query  224  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  403
            ++ GRALFYW FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N 
Sbjct  61   EKLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQ  120

Query  404  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  583
            YSWN AAN+LF+D+P GVGYSYSNTSSD+ T+GDKRTAEDSL+FLLKW ERFP+YKGR+F
Sbjct  121  YSWNQAANILFLDAPVGVGYSYSNTSSDLKTNGDKRTAEDSLKFLLKWVERFPEYKGRDF  180

Query  584  YITGESYAGHYV  619
            YI GESYAGHY+
Sbjct  181  YIVGESYAGHYI  192



>ref|XP_010687643.1| PREDICTED: serine carboxypeptidase II-2 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   269 bits (687),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +2

Query  86   LLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA  265
            L L T       S  + QQK+D V  LPG  F+V+F HYSGY+TVN+E GRALFYWF EA
Sbjct  22   LQLGTCSSSSSSSDPITQQKIDRVNYLPGQNFDVAFTHYSGYITVNEEFGRALFYWFIEA  81

Query  266  VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDS  445
            VEDPSSKPL+LWLNGGPGCSSIAFG AEE+GPFH++KDGKTLY NP SWN  AN++F+D+
Sbjct  82   VEDPSSKPLLLWLNGGPGCSSIAFGEAEELGPFHIQKDGKTLYLNPNSWNKVANVIFLDA  141

Query  446  PAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            P GVG+SYSNT+SD+LT+GD RTA+DSL+FL+ WFERFP+YKGRE YI+GESY GHYV
Sbjct  142  PVGVGFSYSNTTSDLLTNGDNRTAQDSLKFLVGWFERFPEYKGRELYISGESYGGHYV  199



>gb|EPS71160.1| hypothetical protein M569_03591, partial [Genlisea aurea]
Length=441

 Score =   267 bits (682),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  313
            +QQ+LD V  LPG  F+V+FA Y+GYVTVN+ESGRA FYWFFEA EDPSSKPL+LWLNGG
Sbjct  6    NQQELDRVSKLPGQNFDVNFASYAGYVTVNEESGRAYFYWFFEADEDPSSKPLLLWLNGG  65

Query  314  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  493
            PGCSSIA+GLAEEVGPFH+EKDGKTLY N +SWN  AN+LFVDSP GVG+SYSNTSSD+L
Sbjct  66   PGCSSIAYGLAEEVGPFHIEKDGKTLYLNQFSWNKVANVLFVDSPVGVGFSYSNTSSDLL  125

Query  494  THGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
             +GDKRTA ++LEFLL WF RFPQYK R+F+I+GESYAGHYV
Sbjct  126  NNGDKRTASENLEFLLGWFNRFPQYKERDFFISGESYAGHYV  167



>ref|XP_010432944.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=480

 Score =   268 bits (685),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 154/192 (80%), Gaps = 3/192 (2%)
 Frame = +2

Query  44   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            ++ S+     L+ +  LAT+     G S   Q++ D V  LPG  FNVSFAHYSG+VT N
Sbjct  5    IKSSSCLVNALIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQDFNVSFAHYSGFVTTN  61

Query  224  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  403
            ++ GRALFYW FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N 
Sbjct  62   EKLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQ  121

Query  404  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  583
            YSWN AAN+LF+D+P GVGYSYSNTSSD+ T+GDKRTA+DSL+FLLKW ERFP+YKGR+F
Sbjct  122  YSWNQAANILFLDAPVGVGYSYSNTSSDLQTNGDKRTAQDSLKFLLKWVERFPEYKGRDF  181

Query  584  YITGESYAGHYV  619
            YI GESYAGHY+
Sbjct  182  YIVGESYAGHYI  193



>ref|XP_009127491.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=480

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 151/188 (80%), Gaps = 2/188 (1%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            A +  C ++ +++   +   +   S   Q  D V +LPG  FNV+FAHYSG+VT N++ G
Sbjct  16   AKTRSCFVYAIIVIAHLCNCEAVLSEKDQ--DKVWNLPGQNFNVNFAHYSGFVTTNEKMG  73

Query  236  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  415
            RALFYW FEA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N +SWN
Sbjct  74   RALFYWLFEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQHSWN  133

Query  416  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITG  595
             AAN+LF+D+P GVGYSYSNTSSD+LT+GDKRTA+DSL FLLKW ER+P+YKGREFYI G
Sbjct  134  QAANILFLDAPVGVGYSYSNTSSDLLTNGDKRTAQDSLTFLLKWVERYPEYKGREFYIVG  193

Query  596  ESYAGHYV  619
            ESYAGHY+
Sbjct  194  ESYAGHYI  201



>ref|XP_010447670.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=479

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            + Q++ D V  LPG  FNVSFAHYSG+VT N++ GRALFYW FEAVED  SKPLVLWLNG
Sbjct  30   LSQKEQDKVSKLPGQDFNVSFAHYSGFVTTNEKLGRALFYWLFEAVEDAKSKPLVLWLNG  89

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+LF+D+P GVGYSYSNTSSD+
Sbjct  90   GPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANILFLDAPVGVGYSYSNTSSDL  149

Query  491  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
             T+GDKRTA+DSL+FLLKW ERFP+YKGR+FYI GESYAGHY+
Sbjct  150  QTNGDKRTAQDSLKFLLKWVERFPEYKGRDFYIVGESYAGHYI  192



>ref|XP_003564183.1| PREDICTED: serine carboxypeptidase II-2 [Brachypodium distachyon]
Length=474

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 155/193 (80%), Gaps = 3/193 (2%)
 Frame = +2

Query  50   MSALSWGCLLFVL-LLATS-IDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTV  220
            MS  S   +L VL LLA S     +GSSS   +Q+ D V  +PG GFN SFAHY+GYVTV
Sbjct  1    MSGASRCAVLAVLFLLAVSGAAAAEGSSSWRGEQERDRVPRVPGQGFNASFAHYAGYVTV  60

Query  221  NQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  400
            ++E G ALFYWFFEA  +P+SKPLVLWLNGGPGCSSIAFGL EEVGPFH+  DGK ++ N
Sbjct  61   SEERGAALFYWFFEAAHEPASKPLVLWLNGGPGCSSIAFGLGEEVGPFHINADGKGVHMN  120

Query  401  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGRE  580
            PYSWN  AN+LF+DSP GVGYSYSNTS DIL++GD++TA+DSL FL KW ERFPQYKGRE
Sbjct  121  PYSWNRVANILFLDSPVGVGYSYSNTSGDILSNGDEKTAKDSLVFLTKWLERFPQYKGRE  180

Query  581  FYITGESYAGHYV  619
            FY+TGESYAGHYV
Sbjct  181  FYLTGESYAGHYV  193



>emb|CDY28217.1| BnaA01g06320D [Brassica napus]
Length=468

 Score =   266 bits (681),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M+     C ++ +L    +   +  + + Q++ D V  LPG  FNV+FAHYSG+VT N++
Sbjct  1    MAKTRRSCFVYAILAIAHLCNCE--AILSQKEQDKVSQLPGQNFNVNFAHYSGFVTTNEK  58

Query  230  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  409
             GRALFYW FEA EDP+ KPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N +S
Sbjct  59   MGRALFYWLFEAAEDPAYKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQHS  118

Query  410  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYI  589
            WN AAN+LF+D+P GVGYSYSNTSSD+LT+GDKRTA+DSL FLLKW ER+P+YKGREFYI
Sbjct  119  WNQAANILFLDAPVGVGYSYSNTSSDLLTNGDKRTAQDSLTFLLKWVERYPEYKGREFYI  178

Query  590  TGESYAGHYV  619
             GESYAGHY+
Sbjct  179  VGESYAGHYI  188



>emb|CDY23258.1| BnaA08g12880D [Brassica napus]
Length=478

 Score =   266 bits (681),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C + V+ L          + + Q++ D V  LPG  FNV FAHYSG+VT N++ GRALFY
Sbjct  9    CFVVVVALLAITHLCICEALLSQKEQDKVTKLPGQNFNVDFAHYSGFVTTNEKLGRALFY  68

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+
Sbjct  69   WFFEATDDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANI  128

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  610
            LF+D+P GVGYSYSNTSSD+ ++GDKRTA+DSL+FLLKW ER+P+YKGREFYI GESYAG
Sbjct  129  LFLDAPVGVGYSYSNTSSDLRSNGDKRTAQDSLKFLLKWVERYPEYKGREFYIVGESYAG  188

Query  611  HYV  619
            HYV
Sbjct  189  HYV  191



>ref|XP_009127511.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=481

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 150/193 (78%), Gaps = 3/193 (2%)
 Frame = +2

Query  50   MSALSWGCL---LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTV  220
            M+   W C    LF + +          S + +++ + V  LPG  FNV+FAHYSG+VT 
Sbjct  1    MAKTRWSCFVNALFAIAVLAIAHFSNCESVLSEKEQNKVSKLPGQNFNVNFAHYSGFVTT  60

Query  221  NQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  400
            N++ GRALFYW  EA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N
Sbjct  61   NEKLGRALFYWLIEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKPDGKTLYLN  120

Query  401  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGRE  580
             YSWN AAN+LF+D+P GVG+SYSNTSSD+LT+GDKRTA+DSL FLLKW ER+P+YKGRE
Sbjct  121  QYSWNQAANILFLDAPVGVGFSYSNTSSDLLTNGDKRTAQDSLTFLLKWVERYPEYKGRE  180

Query  581  FYITGESYAGHYV  619
            FYI GESYAGHY+
Sbjct  181  FYIVGESYAGHYI  193



>ref|XP_010438130.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=498

 Score =   267 bits (682),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 154/192 (80%), Gaps = 3/192 (2%)
 Frame = +2

Query  44   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            ++ S+     L+ +  LAT+     G S   Q++ D V  LPG  F+VSFAHYSG+VT N
Sbjct  23   IKSSSCLVNALIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQNFDVSFAHYSGFVTTN  79

Query  224  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  403
            ++ GRALFYW FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N 
Sbjct  80   EKLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQ  139

Query  404  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  583
            YSWN AAN+LF+D+P GVGYSYSNTSSD+ T+GDKRTA+DSL+FLLKW ERFP+YKGR+F
Sbjct  140  YSWNQAANILFLDAPVGVGYSYSNTSSDLQTNGDKRTAQDSLKFLLKWVERFPEYKGRDF  199

Query  584  YITGESYAGHYV  619
            YI GESYAGHY+
Sbjct  200  YIVGESYAGHYI  211



>emb|CDX68696.1| BnaC01g07570D [Brassica napus]
Length=504

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            + Q++ D V  LPG  FNV+FAHYSG+VT N++ GRALFYW FEA EDP+SKPLVLWLNG
Sbjct  63   LSQKEQDKVSQLPGQNFNVNFAHYSGFVTTNEKMGRALFYWLFEAAEDPASKPLVLWLNG  122

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSS+ FG AEE+GPFH++ DGKTLY N +SWN AAN+LF+D+P GVGYSYSNTSSD 
Sbjct  123  GPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQHSWNQAANILFLDAPVGVGYSYSNTSSDF  182

Query  491  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            LT+GDKRTA+DSL FLLKW ER+P+YKGREFYI GESYAGHY+
Sbjct  183  LTNGDKRTAQDSLTFLLKWVERYPEYKGREFYIVGESYAGHYI  225



>ref|XP_010111113.1| Serine carboxypeptidase-like 29 [Morus notabilis]
 gb|EXC30159.1| Serine carboxypeptidase-like 29 [Morus notabilis]
Length=495

 Score =   266 bits (680),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 143/180 (79%), Gaps = 19/180 (11%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG-  313
            QQ+LD V  LPG  F VSF HYSGYV VN+ESGRALFYWFFEA EDP+SKP+VLWLNGG 
Sbjct  38   QQRLDRVEKLPGQNFIVSFEHYSGYVRVNEESGRALFYWFFEAAEDPASKPIVLWLNGGL  97

Query  314  ------------------PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  439
                              PGCSSIA+G AEE+GPFH++ D KTLY NPYSWN  AN+LF+
Sbjct  98   PALLVFHLLCLVTMKSLGPGCSSIAYGEAEEIGPFHIKPDAKTLYLNPYSWNQVANILFI  157

Query  440  DSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            DSP GVG+SYSN SSD+L++GDKRTA+D+LEFLLKWFERFPQYKGREFYI GESYAGHYV
Sbjct  158  DSPVGVGFSYSNASSDLLSNGDKRTAKDNLEFLLKWFERFPQYKGREFYIAGESYAGHYV  217



>ref|NP_567854.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
 sp|Q949Q7.1|SCP29_ARATH RecName: Full=Serine carboxypeptidase-like 29; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK93635.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM91708.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEE85811.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
Length=479

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 150/192 (78%), Gaps = 2/192 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSI--DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            M+     C L   L+A +         + + Q++ D V  LPG  FNVSFAHYSG+V  N
Sbjct  1    MAKTRGSCCLVNALIAIAFLATAHLCEAGLSQKEQDKVSKLPGQNFNVSFAHYSGFVATN  60

Query  224  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  403
            ++ GRALFYW FEAVED  SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N 
Sbjct  61   EQLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADGKTLYLNQ  120

Query  404  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  583
            YSWN AAN+LF+D+P GVGYSYSNTSSD+ ++GDKRTAEDSL+FLLKW ERFP+YKGR+F
Sbjct  121  YSWNQAANILFLDAPVGVGYSYSNTSSDLKSNGDKRTAEDSLKFLLKWVERFPEYKGRDF  180

Query  584  YITGESYAGHYV  619
            YI GESYAGHY+
Sbjct  181  YIVGESYAGHYI  192



>ref|XP_009108967.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=477

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 150/183 (82%), Gaps = 1/183 (1%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C + V LLA +      ++ + Q++ D V  LPG  FNV F HYSG+VT N++ GRALFY
Sbjct  9    CFVVVALLAIT-HLCICAALLSQKEQDKVSKLPGQNFNVDFTHYSGFVTTNEKLGRALFY  67

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+
Sbjct  68   WFFEATDDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANI  127

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  610
            LF+D+P GVGYSYSNTSSD+ ++GDKRTA+DSL+FLLKW ER+P+YKGREFYI GESYAG
Sbjct  128  LFLDAPVGVGYSYSNTSSDLRSNGDKRTAQDSLKFLLKWVERYPEYKGREFYIVGESYAG  187

Query  611  HYV  619
            HYV
Sbjct  188  HYV  190



>emb|CDY28216.1| BnaA01g06330D [Brassica napus]
Length=481

 Score =   264 bits (674),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWL  304
            S + +++ D V  LPG  FNV+FAHYSG+VT N++ GRALFYW  EA EDP+SKPLVLWL
Sbjct  29   SVLSEKEQDKVSKLPGQNFNVNFAHYSGFVTTNEKLGRALFYWLIEAAEDPASKPLVLWL  88

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+ FG AEE+GPFH++ DGKTLY N YSWN AAN+LF+D+P GVG+SYSNTSS
Sbjct  89   NGGPGCSSVGFGEAEEIGPFHIKPDGKTLYLNQYSWNQAANILFLDAPVGVGFSYSNTSS  148

Query  485  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            D+LT+GDKRTA+DSL FLLKW ER+P+YKGREFYI GESYAGHY+
Sbjct  149  DLLTNGDKRTAQDSLTFLLKWVERYPEYKGREFYIVGESYAGHYI  193



>emb|CDY55623.1| BnaC03g77560D [Brassica napus]
Length=477

 Score =   264 bits (674),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 150/183 (82%), Gaps = 1/183 (1%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C + V LLA +       + + Q++ D V  LPG  FNV FAHYSG+VT N++ GRALFY
Sbjct  9    CFVVVALLAIT-HLCICEALLSQKEQDKVTKLPGQNFNVDFAHYSGFVTTNEKLGRALFY  67

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+
Sbjct  68   WFFEAADDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANI  127

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  610
            LF+D+P GVGYSYSNTS+D+ ++GDKRTA+DSL+FLLKW ER+P+YKGR+FYI GESYAG
Sbjct  128  LFLDAPVGVGYSYSNTSTDLRSNGDKRTAQDSLKFLLKWVERYPEYKGRDFYIVGESYAG  187

Query  611  HYV  619
            HY+
Sbjct  188  HYI  190



>ref|XP_006412667.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
 gb|ESQ54120.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
Length=480

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            + Q+  D V  LPG  FNV FAHYSG+VT N++ GRALFYW FEA ED  SKPLVLWLNG
Sbjct  31   LSQKAQDKVSILPGQNFNVDFAHYSGFVTTNEKLGRALFYWLFEATEDAESKPLVLWLNG  90

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+LF+D+P GVGYSYSNTSSD+
Sbjct  91   GPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYSWNQAANILFLDAPVGVGYSYSNTSSDL  150

Query  491  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
             ++GDKRTA+DSL+FLLKW ER+P+YKGREFYI GESYAGHY+
Sbjct  151  RSNGDKRTAQDSLKFLLKWVERYPEYKGREFYIVGESYAGHYI  193



>emb|CDY13387.1| BnaA03g51050D [Brassica napus]
Length=476

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 149/190 (78%), Gaps = 1/190 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M+   W C    LL+       +  + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWFCFAIALLVIARFCNCE-EAVLSQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  230  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  409
             GRALFYWFFEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWFFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQYS  119

Query  410  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYI  589
            WN  AN+LF+D+P GVGYSYSNTSSD+LT+GD+RTA+DSL+FLLKW E +P+YKGREFYI
Sbjct  120  WNQVANILFLDAPVGVGYSYSNTSSDLLTNGDQRTAKDSLKFLLKWVELYPEYKGREFYI  179

Query  590  TGESYAGHYV  619
             GESYAGHY+
Sbjct  180  AGESYAGHYI  189



>ref|XP_009137969.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=476

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 149/190 (78%), Gaps = 1/190 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M+   W C    LL+       +  + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWFCFAIALLVIARFCNCE-EAVLSQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  230  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  409
             GRALFYWFFEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWFFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQYS  119

Query  410  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYI  589
            WN  AN+LF+D+P GVGYSYSNTSSD+LT+GD+RTA+DSL+FLLKW E +P+YKGREFYI
Sbjct  120  WNQVANILFLDAPVGVGYSYSNTSSDLLTNGDQRTAKDSLKFLLKWVELYPEYKGREFYI  179

Query  590  TGESYAGHYV  619
             GESYAGHY+
Sbjct  180  AGESYAGHYI  189



>emb|CAN75200.1| hypothetical protein VITISV_014887 [Vitis vinifera]
Length=524

 Score =   262 bits (669),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 154/216 (71%), Gaps = 29/216 (13%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            M +L W  +L +L     ++    SS  + QQ+LD V  LPG  FN+SFAHYSGYVTVN+
Sbjct  1    MLSLKWVFVLQILFTLIYLNTPASSSDPLVQQRLDKVQHLPGQAFNISFAHYSGYVTVNE  60

Query  227  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
             SGRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPY
Sbjct  61   NSGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPY  120

Query  407  SWN----------------------------LAANLLFVDSPAGVGYSYSNTSSDILTHG  502
            SWN                              AN+LF+DSP GVG+SYSNTSSD+ T+G
Sbjct  121  SWNQDIDLQVKVYMFRRNNDVRFSIAERISITIANILFLDSPVGVGFSYSNTSSDVSTNG  180

Query  503  DKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  610
            D RTA+DSL FLLKW ERFPQYKGR+FYITGESYAG
Sbjct  181  DIRTAKDSLAFLLKWLERFPQYKGRDFYITGESYAG  216



>emb|CDX68695.1| BnaC01g07580D [Brassica napus]
Length=481

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 152/194 (78%), Gaps = 5/194 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDG----GKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  217
            M+     C ++VL  A ++ G        + + +++ D V  LPG  FNV+FA YSG+VT
Sbjct  1    MAKTRGSCFVYVLF-AIAVLGIAHFCNCEAVLSEKEQDKVSKLPGQNFNVNFAQYSGFVT  59

Query  218  VNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  397
             N++ GRALFYW  EA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY 
Sbjct  60   TNEKLGRALFYWLIEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKPDGKTLYL  119

Query  398  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGR  577
            N YSWN AAN+LF+D+P GVG+SYSNTSSD++T+GDKRTA+DSL FLLKW ER+P+YKGR
Sbjct  120  NQYSWNQAANILFLDAPVGVGFSYSNTSSDLVTNGDKRTAQDSLTFLLKWVERYPEYKGR  179

Query  578  EFYITGESYAGHYV  619
            EFYI GESYAGHY+
Sbjct  180  EFYIVGESYAGHYI  193



>gb|KHN02055.1| Serine carboxypeptidase II-2 [Glycine soja]
Length=469

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 149/192 (78%), Gaps = 2/192 (1%)
 Frame = +2

Query  44   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            +E     W  +L ++ L    D    +S   +Q+ D V  LPG GFN+SFAHY+GY+TVN
Sbjct  1    MEWRMALWSQILCIVTLLLCSDCA--ASFAKEQQKDRVGRLPGQGFNISFAHYAGYITVN  58

Query  224  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  403
            +++GR LFYWF EA+EDP SKPLVLWLNGGPGCSSIAFG +EEVGPFH+  D KTL++NP
Sbjct  59   EKAGRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEVGPFHINSDSKTLHFNP  118

Query  404  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  583
            YSWN  AN+LF+D+P GVG+SYSN  SD+L +GD+RTAED+L FLL WFERFPQYK   F
Sbjct  119  YSWNRVANILFLDTPVGVGFSYSNNKSDMLINGDERTAEDNLVFLLNWFERFPQYKRSNF  178

Query  584  YITGESYAGHYV  619
            +I+GESYAGHYV
Sbjct  179  FISGESYAGHYV  190



>emb|CAA18212.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
 emb|CAB79799.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
Length=425

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 148/190 (78%), Gaps = 2/190 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSI--DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            M+     C L   L+A +         + + Q++ D V  LPG  FNVSFAHYSG+V  N
Sbjct  1    MAKTRGSCCLVNALIAIAFLATAHLCEAGLSQKEQDKVSKLPGQNFNVSFAHYSGFVATN  60

Query  224  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  403
            ++ GRALFYW FEAVED  SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N 
Sbjct  61   EQLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADGKTLYLNQ  120

Query  404  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  583
            YSWN AAN+LF+D+P GVGYSYSNTSSD+ ++GDKRTAEDSL+FLLKW ERFP+YKGR+F
Sbjct  121  YSWNQAANILFLDAPVGVGYSYSNTSSDLKSNGDKRTAEDSLKFLLKWVERFPEYKGRDF  180

Query  584  YITGESYAGH  613
            YI GESYAG+
Sbjct  181  YIVGESYAGN  190



>ref|XP_003522937.2| PREDICTED: serine carboxypeptidase II-2-like [Glycine max]
Length=483

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 149/192 (78%), Gaps = 2/192 (1%)
 Frame = +2

Query  44   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            +E     W  +L ++ L    D    +S   +Q+ D V  LPG GFN+SFAHY+GY+TVN
Sbjct  15   MEWRMALWSQILCIVTLLLCSDCA--ASFAKEQQKDRVGRLPGQGFNISFAHYAGYITVN  72

Query  224  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  403
            +++GR LFYWF EA+EDP SKPLVLWLNGGPGCSSIAFG +EEVGPFH+  D KTL++NP
Sbjct  73   EKAGRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEVGPFHINSDSKTLHFNP  132

Query  404  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  583
            YSWN  AN+LF+D+P GVG+SYSN  SD+L +GD+RTAED+L FLL WFERFPQYK   F
Sbjct  133  YSWNRVANILFLDTPVGVGFSYSNNKSDMLINGDERTAEDNLVFLLNWFERFPQYKRSNF  192

Query  584  YITGESYAGHYV  619
            +I+GESYAGHYV
Sbjct  193  FISGESYAGHYV  204



>ref|XP_004964646.1| PREDICTED: serine carboxypeptidase II-2-like [Setaria italica]
Length=474

 Score =   258 bits (660),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  313
            ++Q  D V  +PG  F+ S+AHY+GYVTV++  G ALFYWFFEA +DP SKPLVLWLNGG
Sbjct  32   EEQARDRVPRVPGQAFDTSYAHYAGYVTVSEPRGAALFYWFFEAEKDPGSKPLVLWLNGG  91

Query  314  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  493
            PGCSSIA+GL EEVGPFHV  DGK ++ NPYSWN  ANLLFVDSP GVGYSYSNTS DIL
Sbjct  92   PGCSSIAYGLGEEVGPFHVNADGKGVHVNPYSWNKVANLLFVDSPVGVGYSYSNTSDDIL  151

Query  494  THGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
             +GD RTA+DSL FLLKW ERFPQYKGREFY+TGESYAGHYV
Sbjct  152  RNGDARTAKDSLAFLLKWLERFPQYKGREFYLTGESYAGHYV  193



>ref|XP_006655861.1| PREDICTED: serine carboxypeptidase II-2-like [Oryza brachyantha]
Length=484

 Score =   258 bits (660),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +2

Query  107  DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSK  286
            DG   ++   +Q+ D V  +PG  F+V FA Y+GYVTV++E G ALFYWFFEA EDP+SK
Sbjct  33   DGEAAATWRAEQEWDRVARVPGQDFDVGFAQYAGYVTVSEERGAALFYWFFEAAEDPASK  92

Query  287  PLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYS  466
            PLVLWLNGGPGCSSIA+G+AEEVGPFHV  DG+ ++ NPYSWN  AN+LF+DSP GVGYS
Sbjct  93   PLVLWLNGGPGCSSIAYGVAEEVGPFHVNADGQGVHLNPYSWNQVANILFLDSPVGVGYS  152

Query  467  YSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            YSN S DIL +GD RTA DSL FL KW ERFPQYKGREFY+TGESYAGHYV
Sbjct  153  YSNVSDDILNNGDARTANDSLTFLTKWIERFPQYKGREFYVTGESYAGHYV  203



>dbj|BAJ99024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   258 bits (658),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            +Q+ D V  +PG  FN SFAHY+GYVTV+++ G ALFYWFFEA  DP+SKPL+LWLNGGP
Sbjct  28   EQERDRVPRVPGQAFNASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWLNGGP  87

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIAFG+ EEVGPFHV  DGK ++ NPYSWN  AN+LF+DSP GVGYSYSNTS+DIL+
Sbjct  88   GCSSIAFGVGEEVGPFHVNADGKGVHMNPYSWNQVANILFLDSPVGVGYSYSNTSADILS  147

Query  497  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            +GD+RTA+DSL FL KW ERFPQYK REFY+TGESYAGHYV
Sbjct  148  NGDERTAKDSLVFLTKWLERFPQYKEREFYLTGESYAGHYV  188



>dbj|BAK02147.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   258 bits (658),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            +Q+ D V  +PG  FN SFAHY+GYVTV+++ G ALFYWFFEA  DP+SKPL+LWLNGGP
Sbjct  28   EQERDRVPRVPGQAFNASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWLNGGP  87

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIAFG+ EEVGPFHV  DGK ++ NPYSWN  AN+LF+DSP GVGYSYSNTS+DIL+
Sbjct  88   GCSSIAFGVGEEVGPFHVNADGKGVHMNPYSWNQVANILFLDSPVGVGYSYSNTSADILS  147

Query  497  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            +GD+RTA+DSL FL KW ERFPQYK REFY+TGESYAGHYV
Sbjct  148  NGDERTAKDSLVFLTKWLERFPQYKEREFYLTGESYAGHYV  188



>emb|CDX72270.1| BnaC07g42920D [Brassica napus]
Length=667

 Score =   262 bits (670),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 150/190 (79%), Gaps = 1/190 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M+   W CL  + LLA +       + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWSCLA-IALLAIARFCNCEEAVLCQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  230  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  409
             GRALFYW FEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWLFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQYS  119

Query  410  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYI  589
            WN  AN+LF+D+P GVGYSYSNTSSD+LT+GD+RTA+DSL+FLLKW E +P++KGREFYI
Sbjct  120  WNQVANILFLDAPVGVGYSYSNTSSDLLTNGDQRTAKDSLQFLLKWVELYPEFKGREFYI  179

Query  590  TGESYAGHYV  619
             GESYAGHY+
Sbjct  180  VGESYAGHYI  189



>gb|AFW85537.1| hypothetical protein ZEAMMB73_208131 [Zea mays]
Length=432

 Score =   254 bits (648),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  313
            ++Q  D V  +PG  FN SFA Y+GYVTV+++ G ALFYWFFEA +DP SKPLVLWLNGG
Sbjct  32   EEQARDRVPRVPGQAFNTSFAQYAGYVTVSEQRGAALFYWFFEAEKDPGSKPLVLWLNGG  91

Query  314  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  493
            PGCSSIAFGL EEVGPFHV  DGK ++ NPYSWN  ANLLF+DSP GVGYSYSNTS D L
Sbjct  92   PGCSSIAFGLGEEVGPFHVNADGKGVHVNPYSWNKVANLLFLDSPVGVGYSYSNTSDDAL  151

Query  494  THGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
             +GD RTA DSL FLLKW ERFPQYK REFY+TGESYAGHYV
Sbjct  152  KNGDARTATDSLAFLLKWLERFPQYKEREFYLTGESYAGHYV  193



>ref|NP_001146398.1| Serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39493.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACL53886.1| unknown [Zea mays]
 gb|AFW85536.1| Serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  313
            ++Q  D V  +PG  FN SFA Y+GYVTV+++ G ALFYWFFEA +DP SKPLVLWLNGG
Sbjct  32   EEQARDRVPRVPGQAFNTSFAQYAGYVTVSEQRGAALFYWFFEAEKDPGSKPLVLWLNGG  91

Query  314  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  493
            PGCSSIAFGL EEVGPFHV  DGK ++ NPYSWN  ANLLF+DSP GVGYSYSNTS D L
Sbjct  92   PGCSSIAFGLGEEVGPFHVNADGKGVHVNPYSWNKVANLLFLDSPVGVGYSYSNTSDDAL  151

Query  494  THGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
             +GD RTA DSL FLLKW ERFPQYK REFY+TGESYAGHYV
Sbjct  152  KNGDARTATDSLAFLLKWLERFPQYKEREFYLTGESYAGHYV  193



>ref|XP_004488608.1| PREDICTED: serine carboxypeptidase II-2-like [Cicer arietinum]
Length=485

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 151/199 (76%), Gaps = 8/199 (4%)
 Frame = +2

Query  47   EMSALSWGCLLF--VLLLAT----SIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAHYS  205
            EM+   W  +    +L+LAT    SI     +    QQ  D +   LPG  FN++F HYS
Sbjct  10   EMARFEWSQIWVTDILILATLFLCSISFAIATDPFVQQGKDRIGRALPGQNFNINFEHYS  69

Query  206  GYVTVNQESGRALFYWFFEAV-EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDG  382
            GY+TVN+++GR LFYWF EA  +DP+SKPL+LW NGGPGCSSIAFG AEE+GPFH+  DG
Sbjct  70   GYITVNEDTGRNLFYWFIEAEHQDPTSKPLLLWFNGGPGCSSIAFGEAEEIGPFHINPDG  129

Query  383  KTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFP  562
             TLY NPYSWN  AN+LFVDSP GVG+SYSNTSS++L +GDKRTAEDSL FLLKWFERFP
Sbjct  130  NTLYLNPYSWNQVANILFVDSPVGVGFSYSNTSSELLNNGDKRTAEDSLIFLLKWFERFP  189

Query  563  QYKGREFYITGESYAGHYV  619
            QYK  +F+I+GESYAGHYV
Sbjct  190  QYKKTDFFISGESYAGHYV  208



>ref|NP_001057009.1| Os06g0186400 [Oryza sativa Japonica Group]
 dbj|BAD72445.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAD72446.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAF18923.1| Os06g0186400 [Oryza sativa Japonica Group]
 gb|EAZ36073.1| hypothetical protein OsJ_20382 [Oryza sativa Japonica Group]
 dbj|BAG90330.1| unnamed protein product [Oryza sativa Japonica Group]
Length=484

 Score =   253 bits (646),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            +Q+ D V  +PG  F+V FA Y+GYV V++E G +LFYWFFEA +DP+SKPLVLWLNGGP
Sbjct  43   EQERDRVARVPGQDFDVGFAQYAGYVAVSEERGASLFYWFFEAADDPASKPLVLWLNGGP  102

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIA+G+AEEVGPFHV  DG+ ++ NPYSWN  AN+LF+DSP GVGYSYSN S DIL 
Sbjct  103  GCSSIAYGVAEEVGPFHVNADGQGVHLNPYSWNQVANILFLDSPVGVGYSYSNASDDILN  162

Query  497  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            +GD RTA DSL FL KW ERFPQYKGREFY+TGESYAGHYV
Sbjct  163  NGDARTANDSLTFLTKWIERFPQYKGREFYVTGESYAGHYV  203



>sp|P55748.1|CBP22_HORVU RecName: Full=Serine carboxypeptidase II-2; AltName: Full=CP-MII.2; 
Contains: RecName: Full=Serine carboxypeptidase II-2 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-2 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31590.1| CP-MII.2=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 436 aa]
 emb|CAB59202.1| serine carboxylase II-2 [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +2

Query  155  VLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIA  334
            V  +PG  F+ SFAHY+GYVTV+++ G ALFYWFFEA  DP+SKPL+LWLNGGPGCSSIA
Sbjct  1    VPRVPGQAFDASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWLNGGPGCSSIA  60

Query  335  FGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRT  514
            FG+ EEVGPFHV  DGK ++ NPYSWN  AN+LF+DSP GVGYSYSNTS+DIL++GD+RT
Sbjct  61   FGVGEEVGPFHVNADGKGVHMNPYSWNQVANILFLDSPVGVGYSYSNTSADILSNGDERT  120

Query  515  AEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            A+DSL FL KW ERFPQYK REFY+TGESYAGHYV
Sbjct  121  AKDSLVFLTKWLERFPQYKEREFYLTGESYAGHYV  155



>ref|XP_007138291.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
 gb|ESW10285.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
Length=472

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C   +LL +           + QQ  D V  LPG  FNVSFAHY+GY+TV + +GR LFY
Sbjct  10   CFATLLLCSAFATSFSTDPPLLQQHKDRVGRLPGQNFNVSFAHYAGYITVEENAGRTLFY  69

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WF EA+EDP SKPLVLWLNGGPGCSSIAFG +EE+GPFH+  DGKTL+ NPYSWN  AN+
Sbjct  70   WFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEIGPFHINPDGKTLHPNPYSWNRVANI  129

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  610
            LF+D+P GVG+SYSN  S++L +GD RTA+D+L FLLKWFERFPQY+  +F I+GESYAG
Sbjct  130  LFLDTPVGVGFSYSNNGSELLNNGDNRTAKDNLVFLLKWFERFPQYRSNDFLISGESYAG  189

Query  611  HYV  619
            HYV
Sbjct  190  HYV  192



>emb|CDY32091.1| BnaC04g44750D [Brassica napus]
Length=447

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  301
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALFYW  E+ + P SKPLVLW
Sbjct  18   SSCRDAQENDRISHLPGEPNDVSFSHYSGYVTVNESAGRALFYWLTESSDHPESKPLVLW  77

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSS+AFG AEE+GPF +  DGKTLY NPY+WN  ANLLF++SPAGVG+SYSNT+
Sbjct  78   LNGGPGCSSLAFGAAEEIGPFRINPDGKTLYHNPYAWNKLANLLFLESPAGVGFSYSNTT  137

Query  482  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            SD+ T GD+RTAED+  FL+KWFERFPQYK REFYI GESYAGHYV
Sbjct  138  SDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYV  183



>ref|XP_009141519.1| PREDICTED: serine carboxypeptidase-like 26 [Brassica rapa]
Length=447

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  301
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALFYW  E+ + P SKPLVLW
Sbjct  18   SSCRDAQEKDRISRLPGEPNDVSFSHYSGYVTVNESAGRALFYWLTESSQHPESKPLVLW  77

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  ANLLF++SPAGVG+SYSNT+
Sbjct  78   LNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYAWNKLANLLFLESPAGVGFSYSNTT  137

Query  482  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            SD+ T GD+RTAED+  FL+KWFERFPQYK REFYI GESYAGHYV
Sbjct  138  SDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYV  183



>gb|AFK34623.1| unknown [Lotus japonicus]
Length=174

 Score =   238 bits (607),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 133/166 (80%), Gaps = 3/166 (2%)
 Frame = +2

Query  74   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            +L + ++AT    I+    S    QQ  D V  LPG  FN SFAHYSGY+TVN ++GRAL
Sbjct  9    ILAIAIVATLFLCINFATSSDPFVQQHHDKVGRLPGQNFNTSFAHYSGYITVNDKAGRAL  68

Query  245  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            FYWF EA +DP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPY+WN  A
Sbjct  69   FYWFMEADQDPQSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYAWNQVA  128

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFP  562
            N+LFVD+PAGVG+SYSNTSSD+L HGD++TAEDSL FLLKWFERFP
Sbjct  129  NILFVDAPAGVGFSYSNTSSDLLNHGDRKTAEDSLIFLLKWFERFP  174



>ref|XP_003595890.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|ACJ85268.1| unknown [Medicago truncatula]
 gb|AES66141.1| serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AFK36219.1| unknown [Medicago truncatula]
Length=473

 Score =   248 bits (632),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 146/195 (75%), Gaps = 5/195 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAV-LDLPGLGFNVSFAHYSGYVT  217
            M+   W  +  + L    +     + + D   QQ+ D +   LPG  FN+SF HYSGY+T
Sbjct  1    MANSEWSQIFAITLATIFLCNNNFTFATDPFVQQEQDRIDRPLPGQNFNISFEHYSGYIT  60

Query  218  VNQESGRALFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  394
            VN+++GR LFYWF +A   DP+S PL+LWLNGGPGCSSIAFG AEE+GPFH+  D KTLY
Sbjct  61   VNEDAGRNLFYWFIQADHVDPTSMPLLLWLNGGPGCSSIAFGEAEEIGPFHINSDSKTLY  120

Query  395  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKG  574
             NPYSWN  AN+L++DSP GVG+SYS  SSDILT+GDKRTAED+L FLLKWFERFPQYK 
Sbjct  121  LNPYSWNQVANILYIDSPVGVGFSYSKNSSDILTNGDKRTAEDNLIFLLKWFERFPQYKN  180

Query  575  REFYITGESYAGHYV  619
             +F+I+GESYAGHYV
Sbjct  181  TDFFISGESYAGHYV  195



>emb|CDY40438.1| BnaA04g20790D [Brassica napus]
Length=447

 Score =   246 bits (629),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  301
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALFYW  E+ + P SKPLVLW
Sbjct  18   SSCRDSQENDRISHLPGEPNDVSFSHYSGYVTVNESAGRALFYWLTESSDHPESKPLVLW  77

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  ANLLF++SPAGVG+SYSNT+
Sbjct  78   LNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYAWNKLANLLFLESPAGVGFSYSNTT  137

Query  482  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            SD+ T GD+RTAED+  FL+KWFERFPQYK REFYI GESYAGHYV
Sbjct  138  SDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYV  183



>ref|XP_003548016.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=493

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 143/185 (77%), Gaps = 2/185 (1%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C  F + L  SI  G   +S ++Q+ D +  LPG   NV FAHYSGYVTVN+E+GRALFY
Sbjct  3    CSQFSVFLLLSIFVGICLASTEEQERDRIAKLPGQPENVLFAHYSGYVTVNEEAGRALFY  62

Query  251  WFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            W  E  A  +PSS+PLVLWLNGGPGCSSI +G AEE+GPF +  DG +LY NPY+WN  A
Sbjct  63   WLVETPASIEPSSRPLVLWLNGGPGCSSIGYGAAEEIGPFRINSDGNSLYSNPYAWNNLA  122

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  604
            N+LF+DSPAGVG+SYSNT+SD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI GESY
Sbjct  123  NILFLDSPAGVGFSYSNTTSDLYTAGDQRTAEDAYTFLVNWFERFPQYKHRDFYIAGESY  182

Query  605  AGHYV  619
            AGHYV
Sbjct  183  AGHYV  187



>ref|XP_006350225.1| PREDICTED: serine carboxypeptidase-like 27-like [Solanum tuberosum]
Length=456

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 143/184 (78%), Gaps = 2/184 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L +V+ L+    G   S S  +Q+ D +  LPG   NV F+ YSGYVTVNQ++GRALFYW
Sbjct  5    LCYVIFLSFLFVGSCYSFSNVEQENDRITYLPGQPENVQFSQYSGYVTVNQQAGRALFYW  64

Query  254  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              E+    +P  +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPYSWN  AN
Sbjct  65   LIESPSNRNPEKRPLVLWLNGGPGCSSVAYGAAEEIGPFHINADGKTLYLNPYSWNNLAN  124

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
            LLF++SPAGVG+SY+NTSSD+   GD+RTAED+ +FL+KWFERFPQYK REFYI GESYA
Sbjct  125  LLFLESPAGVGFSYTNTSSDLYDAGDQRTAEDTYQFLIKWFERFPQYKHREFYIAGESYA  184

Query  608  GHYV  619
            GHYV
Sbjct  185  GHYV  188



>emb|CDO99730.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   245 bits (625),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 145/185 (78%), Gaps = 3/185 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQ-QKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            L FV++L   +  G   S ++Q Q+ D +  LPG   NV F  YSGYVTVN+++GRALFY
Sbjct  8    LFFVVVLPLFLLFGTCYSRINQDQERDRIKSLPGQPANVDFDQYSGYVTVNKKAGRALFY  67

Query  251  WFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            WF E  A   P S+PL+LWLNGGPGCSS+A+G  EE+GPF V+ DGKTL++NPYSWN  A
Sbjct  68   WFIESPASRAPESRPLLLWLNGGPGCSSVAYGATEEIGPFRVKPDGKTLFFNPYSWNKLA  127

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  604
            NLLFV+SPAGVG+SYSNTSSD+ T GD+RTAED+  FL++WFERFPQYK REFYI GESY
Sbjct  128  NLLFVESPAGVGFSYSNTSSDLYTAGDQRTAEDAYTFLVQWFERFPQYKHREFYIAGESY  187

Query  605  AGHYV  619
            AGHYV
Sbjct  188  AGHYV  192



>emb|CDP11023.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   245 bits (625),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  301
            +  + +QKLD VL LPG  FN+SFAHYSGY+TVN  +G+A FYWF E+ EDPSSKPL LW
Sbjct  47   ADKIIEQKLDQVLKLPGQNFNLSFAHYSGYITVNASAGKAFFYWFVESAEDPSSKPLALW  106

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGP CSSIAFG AEE+GPF    DGK++Y NPY+WN  AN++FV+SPAG G+SYSNTS
Sbjct  107  LNGGPACSSIAFGEAEEIGPFRPTADGKSVYLNPYAWNQVANIIFVESPAGTGFSYSNTS  166

Query  482  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            SD+   GD+ T +D+L F+L W ERFPQYKGR+FY+ GESY GH+V
Sbjct  167  SDLYNTGDRSTGKDNLAFILGWLERFPQYKGRDFYLLGESYGGHFV  212



>ref|XP_003595892.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|AES66143.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=472

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 147/196 (75%), Gaps = 6/196 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLL--LATSIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAHYSGYVTV  220
            M+   W  +LF+++  LA        +    QQ  D +   LPG  FN+SF HYSGY+TV
Sbjct  1    MANSKWSQILFIVIITLANLFQCNIATDPFVQQGQDNIGRALPGQNFNISFEHYSGYITV  60

Query  221  NQESGRALFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  397
            N++ GR LFYWF +A   DP+SKPL+LW NGGPGCSSIA+G AEE+GPFH+  DGK L++
Sbjct  61   NEDVGRNLFYWFIQADHVDPTSKPLLLWFNGGPGCSSIAYGEAEEIGPFHINSDGKNLHF  120

Query  398  NPYSWNLAANLLFVDSPAGVGYSYS--NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYK  571
            NPYSWN  AN+L++DSP GVG+SYS  N+S DIL +GDKRTAED+L FLLKWFERFPQYK
Sbjct  121  NPYSWNQVANILYIDSPVGVGFSYSTKNSSDDILNNGDKRTAEDNLIFLLKWFERFPQYK  180

Query  572  GREFYITGESYAGHYV  619
              +F+I+GESYAGHYV
Sbjct  181  KTDFFISGESYAGHYV  196



>gb|KFK36474.1| hypothetical protein AALP_AA4G129400 [Arabis alpina]
Length=449

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 139/168 (83%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            SSS+  Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLV
Sbjct  18   SSSIYDQENDRITHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLV  77

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSN
Sbjct  78   LWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNKLANLLFLESPAGVGFSYSN  137

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            T+SD+ T GDKRTAED+  FL+KWFERFPQYK REFYI GESYAGHYV
Sbjct  138  TTSDLYTAGDKRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYV  185



>ref|NP_181121.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
 sp|Q9ZQQ0.1|SCP26_ARATH RecName: Full=Serine carboxypeptidase-like 26; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD21479.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM15111.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM65590.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|ABJ17113.1| At2g35780 [Arabidopsis thaliana]
 gb|AEC09160.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
Length=452

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 138/169 (82%), Gaps = 2/169 (1%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  292
             S S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   E+P SKPL
Sbjct  18   ASCSRHEQEKDRIFHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSENPESKPL  77

Query  293  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  472
            VLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYS
Sbjct  78   VLWLNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNPYSWNKLANLLFLESPAGVGFSYS  137

Query  473  NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            NT+SD+ T GD+RTAED+  FL+KWFERFPQYK REFYI GESYAGHYV
Sbjct  138  NTTSDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYV  186



>ref|XP_006589433.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=460

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 142/183 (78%), Gaps = 2/183 (1%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            L+++LL +       +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LFYW 
Sbjct  8    LYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWL  67

Query  257  FEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
             EA     P S+PLVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+
Sbjct  68   VEAPVKRGPKSRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANV  127

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  610
            LF+DSPAGVG+SYSN S+D+ T GD++TAED+  FL+ WFERFPQYK REFYI GESYAG
Sbjct  128  LFLDSPAGVGFSYSNKSTDLYTFGDQKTAEDAYTFLVNWFERFPQYKHREFYIAGESYAG  187

Query  611  HYV  619
            HYV
Sbjct  188  HYV  190



>ref|XP_006410747.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
 gb|ESQ52200.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
Length=449

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 137/169 (81%), Gaps = 2/169 (1%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  292
             S   D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   + P SKPL
Sbjct  17   ASCCRDEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQHPESKPL  76

Query  293  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  472
            VLWLNGGPGCSSIAFG AEE+GPF +  DGKTLY NPY+WN  ANLLF++SPAGVG+SYS
Sbjct  77   VLWLNGGPGCSSIAFGAAEEIGPFRINPDGKTLYHNPYAWNQLANLLFLESPAGVGFSYS  136

Query  473  NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            NT+SD+ T GD+RTAED+  FL+KWFERFPQYK REFYI GESYAGHYV
Sbjct  137  NTTSDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYV  185



>ref|XP_007143689.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
 gb|ESW15683.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
Length=459

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 141/183 (77%), Gaps = 3/183 (2%)
 Frame = +2

Query  80   FVLLLATSIDGGKG-SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            F L+L  SI G    +S ++ QK D +  LPG   NV FA YSGYVTVN++S RALFYW 
Sbjct  8    FYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSERALFYWL  67

Query  257  FEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
             EA     P S+PLVLWLNGGPGCSSIA+G +EE+GPFH+  DG++LY NPY+WN  AN+
Sbjct  68   VEAPVSRGPRSRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGRSLYLNPYAWNKLANI  127

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  610
            LF+DSPAGVG+SYSN ++D+ T GD+RTAED+  FL+ WFERFPQYK REFYI GESYAG
Sbjct  128  LFLDSPAGVGFSYSNKTADLYTFGDQRTAEDAYAFLVNWFERFPQYKHREFYIAGESYAG  187

Query  611  HYV  619
            HYV
Sbjct  188  HYV  190



>gb|AES66787.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=474

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 133/163 (82%), Gaps = 2/163 (1%)
 Frame = +2

Query  137  QQKLDAV-LDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE-DPSSKPLVLWLNG  310
            QQ+ D +   LPG  FN++F HYSGY+TVN++ GR LFYWF EA   DP+SKPL+LW NG
Sbjct  34   QQEQDRIGTALPGQNFNINFEHYSGYITVNKDVGRTLFYWFIEADHIDPTSKPLLLWFNG  93

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSSIA+G AEE+GPFH+  DG TL+ NPYSWN  AN+L +DSP GVG+SYSN SSDI
Sbjct  94   GPGCSSIAYGEAEEIGPFHINSDGNTLHLNPYSWNQVANILLIDSPVGVGFSYSNASSDI  153

Query  491  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            L +GDKRT EDSL FLLKWFERFP+YK  +F+I+GESYAGHYV
Sbjct  154  LNNGDKRTTEDSLIFLLKWFERFPRYKETDFFISGESYAGHYV  196



>ref|XP_006294202.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
 gb|EOA27100.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
Length=451

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 137/164 (84%), Gaps = 2/164 (1%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWLN  307
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLVLWLN
Sbjct  22   DEQEKDRIYHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLVLWLN  81

Query  308  GGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSD  487
            GGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSNT+SD
Sbjct  82   GGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNKLANLLFLESPAGVGFSYSNTTSD  141

Query  488  ILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            + T GDKRTAED+  FLLKWFERFPQYK R+FYI GESYAGHYV
Sbjct  142  LYTAGDKRTAEDAYVFLLKWFERFPQYKHRDFYIAGESYAGHYV  185



>ref|XP_011076996.1| PREDICTED: serine carboxypeptidase-like 27 [Sesamum indicum]
Length=461

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 143/185 (77%), Gaps = 3/185 (2%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C + +L L + +  G   S++DQ++ D +  LPG   NV F  YSGY+TVNQ+SGRALFY
Sbjct  10   CAICILWLNSFVGIGYSLSNLDQER-DRITYLPGQPQNVGFNQYSGYITVNQQSGRALFY  68

Query  251  WFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            W  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  A
Sbjct  69   WLTEAPAYRGPDSRPLVLWLNGGPGCSSVAYGAAEEIGPFRINSDGKTLYLNPYSWNKLA  128

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  604
            NLLF++SPAGVG+SYSNTSSD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI GESY
Sbjct  129  NLLFLESPAGVGFSYSNTSSDLYTVGDQRTAEDAYAFLVGWFERFPQYKYRDFYIAGESY  188

Query  605  AGHYV  619
            AGHYV
Sbjct  189  AGHYV  193



>ref|XP_010253608.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   242 bits (618),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 136/168 (81%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  295
            SS +  Q+ D ++ LPG   NV F+ YSGYVTVNQ++GRALFYW  EA  +  P S+PLV
Sbjct  23   SSPLQDQERDRIIQLPGQPNNVGFSQYSGYVTVNQQAGRALFYWLVEAPANRRPESRPLV  82

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPFH+  DGKTL+ NPY+WN  ANLLF++SPAGVG+SYSN
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFHIRSDGKTLFLNPYAWNNLANLLFLESPAGVGFSYSN  142

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            TSSD+ T GD+RTAED+  FL+ W ERFPQYK R+FYI GESYAGHYV
Sbjct  143  TSSDLYTAGDQRTAEDAYAFLVNWIERFPQYKHRDFYIAGESYAGHYV  190



>ref|XP_010505098.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=453

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 137/169 (81%), Gaps = 2/169 (1%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPL  292
             S   D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+    +P SKPL
Sbjct  19   ASCCRDEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALFYWLTESPPSLNPDSKPL  78

Query  293  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  472
            VLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYS
Sbjct  79   VLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNQLANLLFLESPAGVGFSYS  138

Query  473  NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            NT+SD+ T GDKRTAED+  FL+KWFERFPQYK REFYI GESYAGHYV
Sbjct  139  NTTSDLYTAGDKRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYV  187



>gb|ACA61621.1| hypothetical protein AP7_B10.1 [Arabidopsis lyrata subsp. petraea]
Length=450

 Score =   242 bits (617),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = +2

Query  128  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLW  301
            S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLVLW
Sbjct  19   SRHEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLVLW  78

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSNT+
Sbjct  79   LNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNPYSWNKVANLLFLESPAGVGFSYSNTT  138

Query  482  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            SD+ T GDKRTAED+  FL+KWFERFPQYK REFYI GESYAGHYV
Sbjct  139  SDLYTAGDKRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYV  184



>gb|KDP25725.1| hypothetical protein JCGZ_23946 [Jatropha curcas]
Length=456

 Score =   242 bits (617),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  295
            SS+++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALFYW  E  A   P S+PLV
Sbjct  21   SSTLEDQERDKITYLPGQPTNVEFNQYSGYVTVNQQAGRALFYWLIESPASRGPESRPLV  80

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPF ++ DGKTL++NPY+WN  ANLLF++SPAGVG+SYSN
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIKPDGKTLFFNPYAWNKLANLLFLESPAGVGFSYSN  140

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            T+SD+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGHYV
Sbjct  141  TTSDLYTAGDQRTAEDSYAFLVNWFERFPQYKHRDFYIVGESYAGHYV  188



>ref|XP_004236634.1| PREDICTED: serine carboxypeptidase-like 27 [Solanum lycopersicum]
Length=456

 Score =   242 bits (617),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 142/184 (77%), Gaps = 2/184 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L +V+ L+    G   S    +Q+ D +  LPG   NV F+ YSGYVTVNQ++GRALFYW
Sbjct  5    LCYVMFLSFLFVGSCYSFYNVEQENDRITYLPGQPENVQFSQYSGYVTVNQQAGRALFYW  64

Query  254  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              E+    +P  +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPYSWN  AN
Sbjct  65   LIESPSTRNPEKRPLVLWLNGGPGCSSVAYGAAEEIGPFHINADGKTLYLNPYSWNNLAN  124

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
            LLF++SPAGVG+SY+NT+SD+   GD+RTAED+ +F++KWFERFPQYK REFYI GESYA
Sbjct  125  LLFLESPAGVGFSYTNTTSDLYDAGDQRTAEDTYQFVIKWFERFPQYKHREFYIAGESYA  184

Query  608  GHYV  619
            GHYV
Sbjct  185  GHYV  188



>ref|XP_002881414.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57673.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   241 bits (616),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = +2

Query  128  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLW  301
            S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLVLW
Sbjct  19   SRHEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLVLW  78

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSNT+
Sbjct  79   LNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNPYSWNKVANLLFLESPAGVGFSYSNTT  138

Query  482  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            SD+ T GDKRTAED+  FL+KWFERFPQYK REFYI GESYAGHYV
Sbjct  139  SDLYTAGDKRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYV  184



>ref|XP_009802382.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana sylvestris]
Length=456

 Score =   242 bits (617),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 140/184 (76%), Gaps = 2/184 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L FV+ L+    G    S   +Q  D +  LPG   NV F  YSGYVTVN+++GRALFYW
Sbjct  5    LPFVICLSLLFLGSCYCSINVEQLRDKITYLPGQPANVEFNQYSGYVTVNEQAGRALFYW  64

Query  254  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              E+    +P  +PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPYSWN  AN
Sbjct  65   LIESPMSRNPEKRPLILWLNGGPGCSSVAYGAAEEIGPFHINSDGKTLYLNPYSWNNLAN  124

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
            LLF++SPAGVG+SY+NTSSD+   GD+RTAED+ +FL+KWFERFPQYK REFYI GESYA
Sbjct  125  LLFLESPAGVGFSYTNTSSDLYNAGDQRTAEDTYQFLVKWFERFPQYKHREFYIAGESYA  184

Query  608  GHYV  619
            GHYV
Sbjct  185  GHYV  188



>ref|XP_002312024.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE89391.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   242 bits (617),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 134/167 (80%), Gaps = 2/167 (1%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVL  298
            S ++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALFYW  EA     P S+PLVL
Sbjct  23   SPLEDQQRDKITSLPGQPVNVEFNQYSGYVTVNQQAGRALFYWLVEAPTSRSPESRPLVL  82

Query  299  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  478
            WLNGGPGCSS+A+G AEE+GPF +  DGKTLY+NPY+WN  ANLLF++SPAGVG+SYSNT
Sbjct  83   WLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNPYAWNKLANLLFLESPAGVGFSYSNT  142

Query  479  SSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            SSD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI GESYAGHYV
Sbjct  143  SSDLYTAGDQRTAEDAYTFLVNWFERFPQYKYRDFYIAGESYAGHYV  189



>ref|XP_010509560.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=451

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 136/164 (83%), Gaps = 2/164 (1%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPLVLWLN  307
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+    +P SKPLVLWLN
Sbjct  22   DEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALFYWLTESPPSLNPESKPLVLWLN  81

Query  308  GGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSD  487
            GGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSNT+SD
Sbjct  82   GGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNQLANLLFLESPAGVGFSYSNTTSD  141

Query  488  ILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            + T GDKRTAED+  FL+KWFERFPQYK REFYI GESYAGHYV
Sbjct  142  LYTAGDKRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYV  185



>gb|KJB78940.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
 gb|KJB78941.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=375

 Score =   239 bits (609),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 139/184 (76%), Gaps = 6/184 (3%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYAWNKLAN  124

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
             LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ERFPQYK R+FYI GESYA
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLERFPQYKYRDFYIAGESYA  184

Query  608  GHYV  619
            GHYV
Sbjct  185  GHYV  188



>ref|XP_009592854.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana tomentosiformis]
Length=456

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 149/199 (75%), Gaps = 13/199 (7%)
 Frame = +2

Query  29   LTKIPLEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSG  208
            + KIP  +  LS   LLF+     SI+       V+Q + D +  LPG   NV F  YSG
Sbjct  1    MEKIPPFVICLS---LLFLSSCYCSIN-------VEQLR-DKITYLPGQPANVQFNQYSG  49

Query  209  YVTVNQESGRALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDG  382
            YVTVN+++GRALFYW  E+    +P  +PL+LWLNGGPGCSS+A+G AEE+GPFH++ DG
Sbjct  50   YVTVNEQAGRALFYWLIESPVSRNPEKRPLILWLNGGPGCSSVAYGAAEEIGPFHIDSDG  109

Query  383  KTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFP  562
            KTLY NPYSWN  ANLLF++SPAGVG+SY+NTSSD+   GD+RTAED+ +FL+KWFERFP
Sbjct  110  KTLYLNPYSWNNLANLLFLESPAGVGFSYTNTSSDLYNAGDQRTAEDTYQFLVKWFERFP  169

Query  563  QYKGREFYITGESYAGHYV  619
            QYK REFYI GESYAGHYV
Sbjct  170  QYKHREFYIAGESYAGHYV  188



>ref|XP_011031767.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 134/167 (80%), Gaps = 2/167 (1%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVL  298
            S ++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALFYW  EA     P ++PLVL
Sbjct  23   SPLEDQQRDKITSLPGQPVNVEFNQYSGYVTVNQQAGRALFYWLVEAPTSRSPEARPLVL  82

Query  299  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  478
            WLNGGPGCSS+A+G AEE+GPF +  DGKTLY+NPY+WN  ANLLF++SPAGVG+SYSNT
Sbjct  83   WLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNPYAWNKLANLLFLESPAGVGFSYSNT  142

Query  479  SSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            SSD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI GESYAGHYV
Sbjct  143  SSDLYTAGDQRTAEDAYTFLVNWFERFPQYKYRDFYIAGESYAGHYV  189



>ref|XP_003596536.1| Serine carboxypeptidase [Medicago truncatula]
Length=562

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 133/163 (82%), Gaps = 2/163 (1%)
 Frame = +2

Query  137  QQKLDAV-LDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE-DPSSKPLVLWLNG  310
            QQ+ D +   LPG  FN++F HYSGY+TVN++ GR LFYWF EA   DP+SKPL+LW NG
Sbjct  34   QQEQDRIGTALPGQNFNINFEHYSGYITVNKDVGRTLFYWFIEADHIDPTSKPLLLWFNG  93

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSSIA+G AEE+GPFH+  DG TL+ NPYSWN  AN+L +DSP GVG+SYSN SSDI
Sbjct  94   GPGCSSIAYGEAEEIGPFHINSDGNTLHLNPYSWNQVANILLIDSPVGVGFSYSNASSDI  153

Query  491  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            L +GDKRT EDSL FLLKWFERFP+YK  +F+I+GESYAGHYV
Sbjct  154  LNNGDKRTTEDSLIFLLKWFERFPRYKETDFFISGESYAGHYV  196



>ref|XP_010516783.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=454

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 136/169 (80%), Gaps = 2/169 (1%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPL  292
             S   D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+    +P SKPL
Sbjct  20   ASCCRDEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALFYWLTESPPSLNPESKPL  79

Query  293  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  472
            VLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYS
Sbjct  80   VLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNQLANLLFLESPAGVGFSYS  139

Query  473  NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            NT+SD+ T GDKRTAED+  FL+ WFERFPQYK REFYI GESYAGHYV
Sbjct  140  NTTSDLYTAGDKRTAEDAYVFLVNWFERFPQYKQREFYIAGESYAGHYV  188



>ref|XP_009378094.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 148/191 (77%), Gaps = 10/191 (5%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  232
            S  ++ C+L + L      GG  +S+ DQ + D +  LPG   NV FA YSGYVTVN+++
Sbjct  5    SPFAFLCILLLFL------GGCFASNQDQVR-DRITQLPGQP-NVGFAQYSGYVTVNRKA  56

Query  233  GRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
            GRALFYW  E+ E+  P S+PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY
Sbjct  57   GRALFYWLTESPENRQPESRPLVLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPY  116

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  586
            +WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+RTA+D+  FL+ WFERFPQYK R+FY
Sbjct  117  AWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTAQDAYAFLVNWFERFPQYKHRDFY  176

Query  587  ITGESYAGHYV  619
            I GESYAGHYV
Sbjct  177  IAGESYAGHYV  187



>gb|KHN13367.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=493

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 142/185 (77%), Gaps = 2/185 (1%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C  F + L  SI  G   +S ++Q+ D +  LPG   NV FAHYSGYVTVN+E+GRALFY
Sbjct  3    CSQFSVFLLLSIFVGICLASTEEQERDRIAKLPGQPENVLFAHYSGYVTVNEEAGRALFY  62

Query  251  WFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            W  E  A  +PSS+PLVLWLNGGPGCSSI +G AEE+GPF +  DG +LY NPY+WN + 
Sbjct  63   WLVETPASIEPSSRPLVLWLNGGPGCSSIGYGAAEEIGPFRINSDGNSLYSNPYAWNNSV  122

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  604
             ++F+DSPAGVG+SYSNT+SD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI GESY
Sbjct  123  VIVFLDSPAGVGFSYSNTTSDLYTAGDQRTAEDAYTFLVNWFERFPQYKHRDFYIAGESY  182

Query  605  AGHYV  619
            AGHYV
Sbjct  183  AGHYV  187



>ref|XP_004307401.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469671.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
Length=458

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 132/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  295
            +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALFYW  E  A   P S+PLV
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLVESPAQRGPESRPLV  82

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY+WN  ANLLF++SPAGVG+SYSN
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPYAWNNLANLLFLESPAGVGFSYSN  142

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            TSSD+ T GD+RTAED+  FL+ WFERFPQYK R FYI GESYAGHYV
Sbjct  143  TSSDLYTAGDQRTAEDAYTFLVNWFERFPQYKHRNFYIAGESYAGHYV  190



>ref|XP_003595891.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES66142.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=473

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 145/195 (74%), Gaps = 5/195 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAV-LDLPGLGFNVSFAHYSGYVT  217
            M+   W  +  + L    +     + + D   QQ+ D +   LPG  FN+SF HYSGY+T
Sbjct  1    MANSEWSQIFAITLATIFLCNNNFTFATDPFVQQEHDRIDRPLPGQNFNISFEHYSGYIT  60

Query  218  VNQESGRALFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  394
            VN+++GR LFYWF +A   DP+SKPL+LWLNGGPGCSSIA+G AEE+GPFH+  DGK L+
Sbjct  61   VNEDAGRNLFYWFIQADHVDPTSKPLLLWLNGGPGCSSIAYGEAEEIGPFHINSDGKNLH  120

Query  395  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKG  574
            +NPY WN  AN L+++SP GVG+SYS  SSDIL +GDKRTAED+L FLLKWFERFPQYK 
Sbjct  121  FNPYYWNQVANFLYIESPVGVGFSYSKNSSDILNNGDKRTAEDNLIFLLKWFERFPQYKK  180

Query  575  REFYITGESYAGHYV  619
             +F+I+GESYAGHY+
Sbjct  181  TDFFISGESYAGHYI  195



>gb|EYU39591.1| hypothetical protein MIMGU_mgv1a009171mg [Erythranthe guttata]
Length=350

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 140/188 (74%), Gaps = 3/188 (2%)
 Frame = +2

Query  62   SWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRA  241
            S  C + +L L   +  G    + DQ+  D +  LPG   N+ F  YSGYVTVNQ+SGRA
Sbjct  7    SISCSICLLWLNLFVGIGYSLYNADQEN-DRITYLPGQPENIGFDQYSGYVTVNQQSGRA  65

Query  242  LFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  415
            LFYW  EA  +  P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N YSWN
Sbjct  66   LFYWLTEAPTNRGPDSRPLVLWLNGGPGCSSVAYGAAEEIGPFRINSDGKTLYSNSYSWN  125

Query  416  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITG  595
              ANLLF++SPAGVGYSYSNTSSD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI G
Sbjct  126  KLANLLFLESPAGVGYSYSNTSSDLYTVGDQRTAEDAYAFLVNWFERFPQYKHRDFYIAG  185

Query  596  ESYAGHYV  619
            ESYAGHYV
Sbjct  186  ESYAGHYV  193



>gb|KJB78942.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=422

 Score =   239 bits (609),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 139/184 (76%), Gaps = 6/184 (3%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYAWNKLAN  124

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
             LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ERFPQYK R+FYI GESYA
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLERFPQYKYRDFYIAGESYA  184

Query  608  GHYV  619
            GHYV
Sbjct  185  GHYV  188



>gb|KHG25905.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=470

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 140/184 (76%), Gaps = 6/184 (3%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY+NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNPYAWNKLAN  124

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
             LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ERFPQYK R+FYI GESYA
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLERFPQYKYRDFYIAGESYA  184

Query  608  GHYV  619
            GHYV
Sbjct  185  GHYV  188



>gb|KJB76564.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=333

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 132/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            T+SD+ T GDKRTAED+  FL+ WFERFPQYK R+FYI GESYAGHYV
Sbjct  137  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYIAGESYAGHYV  184



>gb|KHN17121.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=459

 Score =   239 bits (611),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 141/183 (77%), Gaps = 2/183 (1%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            L+++LL +       +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LFYW 
Sbjct  7    LYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWL  66

Query  257  FEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
             EA     P S+ LVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+
Sbjct  67   VEAPVRRGPRSRSLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANV  126

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  610
            LF+DSPAGVG+SYSN S+D+ T GD++TAED+  FL+ WFERFPQYK REFYI GESYAG
Sbjct  127  LFLDSPAGVGFSYSNKSTDLYTFGDQKTAEDAYTFLVNWFERFPQYKHREFYIAGESYAG  186

Query  611  HYV  619
            HYV
Sbjct  187  HYV  189



>gb|KJB78939.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=432

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 139/184 (76%), Gaps = 6/184 (3%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYAWNKLAN  124

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
             LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ERFPQYK R+FYI GESYA
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLERFPQYKYRDFYIAGESYA  184

Query  608  GHYV  619
            GHYV
Sbjct  185  GHYV  188



>ref|XP_002315292.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF01463.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   239 bits (610),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 142/191 (74%), Gaps = 7/191 (4%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  232
            S LS  CLL  L + + I      + ++ Q  D +  LPG   +V F  YSGYVTVNQ+S
Sbjct  4    SLLSILCLLVSLFVYSCI-----CAPLEDQGRDKITYLPGQPGSVEFNQYSGYVTVNQQS  58

Query  233  GRALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
            GRALFYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  59   GRALFYWLVEAPTSRRPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPY  118

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  586
            +WN  ANLLF++SPAGVG+SYSNTSSD+ T GD+RTAED+  FL+ WFERFPQYK R+FY
Sbjct  119  AWNKLANLLFLESPAGVGFSYSNTSSDLYTAGDQRTAEDAYTFLVNWFERFPQYKYRDFY  178

Query  587  ITGESYAGHYV  619
            I GESYAGHYV
Sbjct  179  IAGESYAGHYV  189



>gb|KJB76565.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=342

 Score =   236 bits (601),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 132/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            T+SD+ T GDKRTAED+  FL+ WFERFPQYK R+FYI GESYAGHYV
Sbjct  137  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYIAGESYAGHYV  184



>ref|XP_003556225.1| PREDICTED: serine carboxypeptidase-like 27-like isoform 1 [Glycine 
max]
 gb|KHN00830.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=460

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 141/183 (77%), Gaps = 2/183 (1%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            L+++LL +       +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LFYW 
Sbjct  8    LYLVLLLSICGVVSLASPIEDQKKDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWL  67

Query  257  FEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
             EA     P S+ LVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+
Sbjct  68   VEAPVRRGPRSRSLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANV  127

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  610
            LF+DSPAGVG+SYSN ++D+ T GD++TAED+  FL+ WFERFPQYK REFYI GESYAG
Sbjct  128  LFLDSPAGVGFSYSNKTTDLYTFGDQKTAEDAYTFLVNWFERFPQYKHREFYIAGESYAG  187

Query  611  HYV  619
            HYV
Sbjct  188  HYV  190



>gb|KJB78938.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=470

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 139/184 (76%), Gaps = 6/184 (3%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYAWNKLAN  124

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
             LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ERFPQYK R+FYI GESYA
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLERFPQYKYRDFYIAGESYA  184

Query  608  GHYV  619
            GHYV
Sbjct  185  GHYV  188



>ref|XP_010264739.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 136/168 (81%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            +S +  Q+ D + +LPG   NV FA YSGYVTV+Q++GRALFYW  EA     P S+PLV
Sbjct  23   TSPLQDQERDKITELPGQPTNVGFAQYSGYVTVDQQAGRALFYWLTEAPASRRPESRPLV  82

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTL++NPY+WN  AN+LF++SPAGVG+SYSN
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFRIHPDGKTLFFNPYAWNNLANILFLESPAGVGFSYSN  142

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            TSSD+ T GD+RTAED+  F++ WFERFPQYK R+FYI GESYAGHYV
Sbjct  143  TSSDLYTAGDQRTAEDAYTFIVNWFERFPQYKHRDFYIAGESYAGHYV  190



>ref|XP_002534550.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF27834.1| serine carboxypeptidase, putative [Ricinus communis]
Length=385

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 141/184 (77%), Gaps = 3/184 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L F  LL ++I   +  S+ ++Q+ D ++ LPG   NV F+ YSGYVTV+  +GRALFYW
Sbjct  16   LSFATLLLSTI-SARLISNKEEQERDRIIKLPGQPPNVYFSQYSGYVTVDPLAGRALFYW  74

Query  254  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DGKTLY NPY+WN  AN
Sbjct  75   LIEAPKMARPKSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRSDGKTLYLNPYTWNKVAN  134

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
            LLF+DSPAGVG+SYSNTSSDI   GDKRT++D+ +FL+ WF+RFPQY  R FYI GESYA
Sbjct  135  LLFLDSPAGVGFSYSNTSSDIYAVGDKRTSQDAHKFLINWFKRFPQYNHRPFYIAGESYA  194

Query  608  GHYV  619
            GHY+
Sbjct  195  GHYI  198



>ref|XP_010669644.1| PREDICTED: serine carboxypeptidase-like 27 [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  301
            S+++  Q  D +  LPG   N +FA YSGYVTV++ +GR LFYW  E+  +P +KPLVLW
Sbjct  20   SAAIANQNNDRITWLPGQPENTNFAQYSGYVTVDKSAGRTLFYWLTESPSNPETKPLVLW  79

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSSIA+G AEE+GPFH++ DGKTL+ NPYSWN  ANLLF++SPAGVG+SYSN S
Sbjct  80   LNGGPGCSSIAYGAAEEIGPFHIQSDGKTLFLNPYSWNNEANLLFLESPAGVGFSYSNRS  139

Query  482  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            SD+ T GD RTA+DS +FL++WF RFPQYK REFYI GESYAGHYV
Sbjct  140  SDLYTVGDSRTAKDSYKFLVRWFNRFPQYKYREFYIAGESYAGHYV  185



>ref|XP_010067291.1| PREDICTED: serine carboxypeptidase-like 28 [Eucalyptus grandis]
 gb|KCW65387.1| hypothetical protein EUGRSUZ_G02817 [Eucalyptus grandis]
Length=467

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 130/163 (80%), Gaps = 2/163 (1%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLVLWLNG  310
            QQK D ++ LPG   NV+F+ Y+GYVTV+  +GRALFYW  E      P+SKPLVLWLNG
Sbjct  33   QQKKDKIVKLPGQPANVTFSQYAGYVTVDPSAGRALFYWLIEVPRHLRPASKPLVLWLNG  92

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSS+A+G +EEVGPF V  +GKTLY NPY+WN  ANLLF+DSPAGVG+SYSNTSSD+
Sbjct  93   GPGCSSVAYGASEEVGPFRVRPNGKTLYLNPYAWNREANLLFLDSPAGVGFSYSNTSSDV  152

Query  491  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
             T GDKRTA+D+  FL+ W ERFPQYK R FYI GESYAGHY+
Sbjct  153  YTPGDKRTAQDAFTFLMNWLERFPQYKHRPFYIAGESYAGHYI  195



>ref|XP_004142401.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 ref|XP_004157517.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 gb|KGN52285.1| hypothetical protein Csa_5G623490 [Cucumis sativus]
Length=455

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 144/184 (78%), Gaps = 3/184 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
              ++ LL + +    GS + +Q++ D +  LPG   NV FA YSGYVTV++++GRALFYW
Sbjct  5    FFYLCLLLSLVAISYGSYNAEQER-DRITQLPGQPKNVDFAQYSGYVTVDKQAGRALFYW  63

Query  254  FFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              E      P+S+PLVLWLNGGPGCSS+A+G AEE+GPFH++ DG+TLY NPY+WN  AN
Sbjct  64   LTETPTSRVPNSRPLVLWLNGGPGCSSVAYGAAEEIGPFHIKPDGRTLYLNPYAWNKLAN  123

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
            LLF++SPAGVG+SYSNT+SD+ T GD++TAED+  FL+ WFERFPQYK R+FYI GESYA
Sbjct  124  LLFLESPAGVGFSYSNTTSDLYTAGDQKTAEDAHRFLVNWFERFPQYKHRDFYIAGESYA  183

Query  608  GHYV  619
            GHYV
Sbjct  184  GHYV  187



>gb|AFK37459.1| unknown [Lotus japonicus]
Length=463

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 143/192 (74%), Gaps = 1/192 (1%)
 Frame = +2

Query  44   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            + M   + G LLF+  L  S      SS   +Q+LD +  LPG    V+FA +SGYVTVN
Sbjct  1    MSMVFQTKGLLLFLCALIFSFSCILASSVPKEQELDRISALPGQP-PVTFAQFSGYVTVN  59

Query  224  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  403
            +E GRALFYWF EA   P +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +L+ N 
Sbjct  60   EEHGRALFYWFTEATTSPQNKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLFLNK  119

Query  404  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  583
            Y+WN  AN+LF++SPAGVG+SY+NTSSD+ T GDKRTA+D+L FLL+W  RFPQYK REF
Sbjct  120  YAWNKEANILFLESPAGVGFSYTNTSSDLTTSGDKRTAQDALIFLLRWMARFPQYKYREF  179

Query  584  YITGESYAGHYV  619
            YI GESYAGHYV
Sbjct  180  YIAGESYAGHYV  191



>ref|XP_007009788.1| Serine carboxypeptidase-like 27 isoform 2 [Theobroma cacao]
 gb|EOY18598.1| Serine carboxypeptidase-like 27 isoform 2 [Theobroma cacao]
Length=423

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 132/167 (79%), Gaps = 2/167 (1%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVL  298
            SS   Q LD + +LPG   NV F  YSGYVTVN+++GRALFYW  E      P ++PLVL
Sbjct  22   SSFGDQNLDKITELPGQPKNVEFNQYSGYVTVNEQAGRALFYWLIELPVSRSPETRPLVL  81

Query  299  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  478
            WLNGGPGCSS+A+G AEE+GPFH+  DG+TLY N Y+WN  AN+LF++SPAGVG+SYSNT
Sbjct  82   WLNGGPGCSSLAYGAAEEIGPFHIRPDGRTLYLNRYAWNNLANMLFLESPAGVGFSYSNT  141

Query  479  SSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            +SD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI GESYAGHYV
Sbjct  142  TSDLYTAGDRRTAEDAYAFLVNWFERFPQYKHRDFYIAGESYAGHYV  188



>ref|XP_008368824.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 144/191 (75%), Gaps = 10/191 (5%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  232
            S  ++ C+L + L       G   +S+  Q  D +  LPG   NV FA YSGYVTVN+++
Sbjct  5    SPFAFLCILLLFL-------GGCFASIQDQVRDRITQLPGQP-NVGFAQYSGYVTVNRKA  56

Query  233  GRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
            GRALFYW  E+ E+  P S+PLVLWLNGGPGCSS+A+G AEE+G FH+  DGKTLY NPY
Sbjct  57   GRALFYWLTESPENRQPESRPLVLWLNGGPGCSSVAYGAAEEIGAFHIRPDGKTLYLNPY  116

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  586
            +WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+RTAED+  FL+ WFERFPQYK R+FY
Sbjct  117  AWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTAEDAYAFLVNWFERFPQYKHRDFY  176

Query  587  ITGESYAGHYV  619
            I GESYAGHYV
Sbjct  177  IAGESYAGHYV  187



>ref|XP_011469672.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 132/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  295
            +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALFYW  E  A   P S+PLV
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLVESPAQRGPESRPLV  82

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWL GGPGCSS+A+G AEE+GPFH+  DGKTLY NPY+WN  ANLLF++SPAGVG+SY+N
Sbjct  83   LWLTGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPYAWNNLANLLFLESPAGVGFSYTN  142

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            TSSD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI G+SYAGHYV
Sbjct  143  TSSDLYTAGDQRTAEDAYTFLVNWFERFPQYKHRDFYIAGDSYAGHYV  190



>ref|XP_008381976.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 142/191 (74%), Gaps = 10/191 (5%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  232
            S  ++ C+L + L       G   +SV  Q  D +  LPG    V FA YSGYVTVN+++
Sbjct  5    SPFAFPCILLLFL-------GGCFASVQDQVRDRITQLPGQP-TVGFAQYSGYVTVNRKA  56

Query  233  GRALFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
            GRALFYW  E  A   P S+PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY
Sbjct  57   GRALFYWLTESPANRRPESRPLMLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPY  116

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  586
            +WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+RTAED+  FL+ WFERFPQYK R+FY
Sbjct  117  AWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTAEDAYAFLVNWFERFPQYKHRDFY  176

Query  587  ITGESYAGHYV  619
            I GESYAGHYV
Sbjct  177  IAGESYAGHYV  187



>ref|XP_004307399.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=458

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 132/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  295
            +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALFYW  E  A   P S+PLV
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLVESPAQRGPESRPLV  82

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWL GGPGCSS+A+G AEE+GPFH+  DGKTLY NPY+WN  ANLLF++SPAGVG+SY+N
Sbjct  83   LWLTGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPYAWNNLANLLFLESPAGVGFSYTN  142

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            TSSD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI G+SYAGHYV
Sbjct  143  TSSDLYTAGDQRTAEDAYTFLVNWFERFPQYKHRDFYIAGDSYAGHYV  190



>ref|XP_009333715.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 142/191 (74%), Gaps = 10/191 (5%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  232
            S  ++ C+L + L       G   +SV  Q  D +  LPG    V FA YSGYVTVN+++
Sbjct  5    SPFAFPCILLLFL-------GGCFASVQDQVRDRITQLPGQP-TVGFAQYSGYVTVNRKA  56

Query  233  GRALFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
            GRALFYW  E  A   P S+PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY
Sbjct  57   GRALFYWLTESPANRRPESRPLMLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPY  116

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  586
            +WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+RTAED+  FL+ WFERFPQYK R+FY
Sbjct  117  AWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTAEDAYAFLVNWFERFPQYKHRDFY  176

Query  587  ITGESYAGHYV  619
            I GESYAGHYV
Sbjct  177  IAGESYAGHYV  187



>ref|XP_002312023.1| hypothetical protein POPTR_0008s04130g [Populus trichocarpa]
 gb|EEE89390.1| hypothetical protein POPTR_0008s04130g [Populus trichocarpa]
Length=466

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 141/196 (72%), Gaps = 6/196 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLL----LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  217
            M   S  C LF +L    L  S         +++Q+ D ++ LPG   NVSF+ +SGY+T
Sbjct  1    MRIKSSSCFLFSVLNFAILLLSTPAVTTHDHLEEQRRDRIMKLPGQPPNVSFSQFSGYIT  60

Query  218  VNQESGRALFYWFFEAVE--DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  391
            V+   GRALFYW  EA +   P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DG+TL
Sbjct  61   VDPVEGRALFYWLIEAPKTVKPRSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGETL  120

Query  392  YWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYK  571
            + NPY+WN  ANLLF+DSPAGVG+SYSNTSSDI T GD+RTAED+  FL+ W ERFP+YK
Sbjct  121  HLNPYAWNKVANLLFLDSPAGVGFSYSNTSSDIYTVGDERTAEDAYTFLINWLERFPRYK  180

Query  572  GREFYITGESYAGHYV  619
             R FYI GESYAGHY+
Sbjct  181  HRSFYIAGESYAGHYI  196



>ref|XP_011040962.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=468

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 140/187 (75%), Gaps = 5/187 (3%)
 Frame = +2

Query  74   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            LL+VL LAT   S         +++Q+ D ++ L G   NVSF+ +SGY+TV+  +GRAL
Sbjct  12   LLYVLNLATLLLSTIAATNHGHLEEQRRDKIIKLHGQPPNVSFSQFSGYITVDPLAGRAL  71

Query  245  FYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  418
            FYW  E   +  P SKPL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY+WN 
Sbjct  72   FYWLIEVPKIVKPKSKPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPYAWNK  131

Query  419  AANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGE  598
             ANLLF+DSPAGVG+SYSNTSSD  T GDKRTA+D+  FL+ WFERFPQYK R FYI GE
Sbjct  132  VANLLFLDSPAGVGFSYSNTSSDTYTVGDKRTAKDAYTFLVNWFERFPQYKHRPFYIAGE  191

Query  599  SYAGHYV  619
            SYAGHY+
Sbjct  192  SYAGHYI  198



>ref|XP_008446902.1| PREDICTED: serine carboxypeptidase-like 27 [Cucumis melo]
Length=457

 Score =   236 bits (602),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 139/169 (82%), Gaps = 3/169 (2%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPL  292
            GS + +Q++ D +  LPG   NV FA YSGYVTV++++GRALFYW  E      P+S+PL
Sbjct  22   GSYNAEQER-DRITQLPGQPKNVDFAQYSGYVTVDKQAGRALFYWLTETPTSRVPNSRPL  80

Query  293  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  472
            VLWLNGGPGCSS+A+G AEE+GPFH++ DG+TLY NPY+WN  ANLLF++SPAGVG+SYS
Sbjct  81   VLWLNGGPGCSSVAYGAAEEIGPFHIKPDGRTLYLNPYAWNKLANLLFLESPAGVGFSYS  140

Query  473  NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            NT+SD+ T GD++TAED+ +FL+ WFERFPQYK R+FYI GESYAGHYV
Sbjct  141  NTTSDLYTAGDQKTAEDAHKFLVNWFERFPQYKHRDFYIAGESYAGHYV  189



>ref|XP_009141517.1| PREDICTED: serine carboxypeptidase-like 28 [Brassica rapa]
Length=469

 Score =   236 bits (603),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 140/185 (76%), Gaps = 2/185 (1%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSS--SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C+  + ++   +D    SS  + +Q+  D +L LPG   N++F+ +SGYVTVN  +GRAL
Sbjct  16   CIFLLSMIIALLDVVMSSSEDAKEQKMRDRILSLPGQPPNLNFSQFSGYVTVNSAAGRAL  75

Query  245  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            FYW  EA +   +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  NPY+WNL A
Sbjct  76   FYWLTEAPKPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNPYAWNLEA  135

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  604
            NLLF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+YK R FYI GESY
Sbjct  136  NLLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMERFPEYKERPFYIAGESY  195

Query  605  AGHYV  619
            AGHY+
Sbjct  196  AGHYI  200



>ref|XP_008233341.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
 ref|XP_008233342.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
Length=455

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 146/193 (76%), Gaps = 10/193 (5%)
 Frame = +2

Query  47   EMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            + S  ++ C+L +         G   +S+  Q  D + +LPG   NV FA +SGYVTVN+
Sbjct  3    DHSPFAFLCILLLFF-------GACFASIQDQVRDRITNLPGQP-NVGFAQFSGYVTVNK  54

Query  227  ESGRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  400
            ++GRALFYW  E+ ++  P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N
Sbjct  55   KAGRALFYWLIESPKNRGPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYLN  114

Query  401  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGRE  580
            PY+WN  ANLLF++SPAGVG+SYSNT++D+ T+GD+RTAED+  FL+ WFERFPQYK R+
Sbjct  115  PYTWNNLANLLFLESPAGVGFSYSNTTTDLYTNGDQRTAEDAYAFLINWFERFPQYKHRD  174

Query  581  FYITGESYAGHYV  619
            FYI GESYAGHYV
Sbjct  175  FYIAGESYAGHYV  187



>ref|XP_010547376.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547377.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547378.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
Length=457

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  295
            +S ++ QK D + +LPG   NVSF+ YSGYVTVN++ GRALFYW  E+  +  P ++PLV
Sbjct  21   ASYLEDQKRDRIRELPGQPRNVSFSQYSGYVTVNEQRGRALFYWLTESPVNRVPKARPLV  80

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPF +  DGK+LY NPY+WN  ANLLF++SPAGVG+SY+N
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKSLYLNPYAWNKLANLLFLESPAGVGFSYTN  140

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            T+SD+ T GD+RTAED+  FL+KWFERFPQYK R+ YI GESYAGH+V
Sbjct  141  TTSDLYTTGDERTAEDAYTFLVKWFERFPQYKHRDLYIVGESYAGHFV  188



>gb|KJB76563.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=452

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 132/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            T+SD+ T GDKRTAED+  FL+ WFERFPQYK R+FYI GESYAGHYV
Sbjct  137  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYIAGESYAGHYV  184



>emb|CDY40439.1| BnaA04g20780D [Brassica napus]
Length=469

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 139/185 (75%), Gaps = 2/185 (1%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSS--SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C+  + ++   +D    SS  + +Q+  D +L LPG   N++F+ +SGYVTVN  +GRAL
Sbjct  16   CIFLLSMIIALLDVVMSSSEDAKEQKMRDRILSLPGQPPNLNFSQFSGYVTVNSAAGRAL  75

Query  245  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  NPY+WNL A
Sbjct  76   FYWLTEAPTPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNPYAWNLDA  135

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  604
            NLLF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+YK R FYI GESY
Sbjct  136  NLLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMERFPEYKERPFYIAGESY  195

Query  605  AGHYV  619
            AGHY+
Sbjct  196  AGHYI  200



>gb|KJB76567.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=482

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 132/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            T+SD+ T GDKRTAED+  FL+ WFERFPQYK R+FYI GESYAGHYV
Sbjct  137  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYIAGESYAGHYV  184



>gb|KJB76566.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=484

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 132/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            T+SD+ T GDKRTAED+  FL+ WFERFPQYK R+FYI GESYAGHYV
Sbjct  137  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYIAGESYAGHYV  184



>ref|XP_002274723.1| PREDICTED: serine carboxypeptidase-like 27 [Vitis vinifera]
 emb|CBI31485.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 135/168 (80%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  295
            SS ++ Q+ D + +LPG   N+ FA YSGYVTVN+++GRALFYW  +  A     S+PLV
Sbjct  21   SSYLEDQERDRITELPGQPKNIGFAQYSGYVTVNKQAGRALFYWLVQSPASRGAESRPLV  80

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTL+ NPY+WN  ANLLF++SPAGVG+SYSN
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLFINPYAWNNLANLLFLESPAGVGFSYSN  140

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            T+SD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI GESYAGHYV
Sbjct  141  TTSDLYTAGDQRTAEDAYTFLINWFERFPQYKHRDFYIAGESYAGHYV  188



>ref|XP_004288721.2| PREDICTED: serine carboxypeptidase 24 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 140/181 (77%), Gaps = 1/181 (1%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            + V +L+ +      +++  +Q+LD +  LPG    VSF+ YSGYVTVN++ GRALFYWF
Sbjct  19   ILVFMLSLTTTTINVAATAKEQELDRITALPGQP-PVSFSQYSGYVTVNKKHGRALFYWF  77

Query  257  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  436
             EA   P +KPLVLW NGGPGCSS+A+G +EE+GPF + + G +LY N YSWN  AN+LF
Sbjct  78   TEATASPHNKPLVLWFNGGPGCSSVAYGASEEIGPFRINRTGSSLYLNKYSWNREANILF  137

Query  437  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHY  616
            ++SPAGVG+SY+NTS+D++  GDKRTA+D+L FLL+W  RFPQYK REFYI+GESYAGHY
Sbjct  138  LESPAGVGFSYTNTSADLIDSGDKRTAQDALTFLLQWLSRFPQYKYREFYISGESYAGHY  197

Query  617  V  619
            V
Sbjct  198  V  198



>gb|KFK38250.1| hypothetical protein AALP_AA3G088900 [Arabis alpina]
Length=461

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query  116  KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKP  289
              S+ V++QK D +++LPG   N+ F  YSGY+TVNQE GRALFYW  E+     P S+P
Sbjct  23   NASTYVEEQKRDRIIELPGQPSNIDFRQYSGYITVNQEHGRALFYWLVESPLTRVPKSRP  82

Query  290  LVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSY  469
            LVLWLNGGPGCSS+A+G AEE+GPF V  DGKTLY   Y+WN  ANLLF++SPAGVG+SY
Sbjct  83   LVLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLYSKLYAWNKLANLLFLESPAGVGFSY  142

Query  470  SNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            +NT+SD+   GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+V
Sbjct  143  TNTTSDLYITGDQRTAEDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFV  192



>ref|XP_006407773.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
 gb|ESQ49226.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
Length=456

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 133/169 (79%), Gaps = 2/169 (1%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPL  292
             SS V++QK D + +LPG   NV F  YSGY+TVN+E GRALFYW  E  A  DP S+PL
Sbjct  19   ASSYVEEQKRDRISELPGQPSNVDFRQYSGYITVNEERGRALFYWLVESPATRDPKSRPL  78

Query  293  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  472
            VLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SY+
Sbjct  79   VLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYT  138

Query  473  NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            NT+SD+ T GD+RTAED+  FL+ W ERFPQYK R+FYI GESYAGH+V
Sbjct  139  NTTSDLYTTGDQRTAEDAYRFLVNWLERFPQYKHRDFYIVGESYAGHFV  187



>ref|XP_007009787.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
 gb|EOY18597.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
Length=552

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 132/167 (79%), Gaps = 2/167 (1%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVL  298
            SS   Q LD + +LPG   NV F  YSGYVTVN+++GRALFYW  E      P ++PLVL
Sbjct  85   SSFGDQNLDKITELPGQPKNVEFNQYSGYVTVNEQAGRALFYWLIELPVSRSPETRPLVL  144

Query  299  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  478
            WLNGGPGCSS+A+G AEE+GPFH+  DG+TLY N Y+WN  AN+LF++SPAGVG+SYSNT
Sbjct  145  WLNGGPGCSSLAYGAAEEIGPFHIRPDGRTLYLNRYAWNNLANMLFLESPAGVGFSYSNT  204

Query  479  SSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            +SD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI GESYAGHYV
Sbjct  205  TSDLYTAGDRRTAEDAYAFLVNWFERFPQYKHRDFYIAGESYAGHYV  251



>ref|XP_003591950.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62201.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=459

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 140/189 (74%), Gaps = 2/189 (1%)
 Frame = +2

Query  59   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  239  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  412
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y+W
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAW  120

Query  413  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYIT  592
            N  AN+LF+DSPAGVG+SY N ++D+ T GD++TAED+  FL+ WFERFPQYK REFYI 
Sbjct  121  NNLANILFLDSPAGVGFSYCNKTTDLYTFGDQKTAEDAYIFLVNWFERFPQYKHREFYIA  180

Query  593  GESYAGHYV  619
            GESYAGHYV
Sbjct  181  GESYAGHYV  189



>ref|XP_003591949.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003638560.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=461

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 140/189 (74%), Gaps = 2/189 (1%)
 Frame = +2

Query  59   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  239  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  412
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y+W
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAW  120

Query  413  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYIT  592
            N  AN+LF+DSPAGVG+SY N ++D+ T GD++TAED+  FL+ WFERFPQYK REFYI 
Sbjct  121  NNLANILFLDSPAGVGFSYCNKTTDLYTFGDQKTAEDAYIFLVNWFERFPQYKHREFYIA  180

Query  593  GESYAGHYV  619
            GESYAGHYV
Sbjct  181  GESYAGHYV  189



>gb|EPS66906.1| hypothetical protein M569_07869, partial [Genlisea aurea]
Length=410

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 130/166 (78%), Gaps = 2/166 (1%)
 Frame = +2

Query  128  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLVLW  301
            SV  Q+ D +  LPG   N++F  YSGYVTVN  +GRALFYW  EA  D  P S+PL+LW
Sbjct  20   SVQDQESDRITYLPGQPENIAFNQYSGYVTVNHTAGRALFYWLTEASVDSVPDSRPLLLW  79

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSSIA+G AEE+GPF +  +GKTLY N YSWN   NLLF++SPAGVGYSYSNTS
Sbjct  80   LNGGPGCSSIAYGAAEEIGPFRINSNGKTLYLNSYSWNKLVNLLFLESPAGVGYSYSNTS  139

Query  482  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            SD+ T GD+RTAEDS  FL+ WFE+FP+YK R+FYI GESYAGHYV
Sbjct  140  SDLYTAGDRRTAEDSYAFLVSWFEKFPKYKHRDFYIAGESYAGHYV  185



>gb|KJB76571.1| hypothetical protein B456_012G095000 [Gossypium raimondii]
Length=472

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 136/184 (74%), Gaps = 2/184 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L++ L++ + +          +Q  D ++ LPG   NV F+ YSGY+TV  ++GRALFYW
Sbjct  15   LVYFLVIGSLVVWSAEGGHRKEQARDRIVKLPGQPRNVKFSQYSGYITVEAKAGRALFYW  74

Query  254  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              EA     P +KPLVLWLNGGPGCSSIA+G +EEVGPF V +DGK+L  NPY+WN  AN
Sbjct  75   LTEAPAKSRPETKPLVLWLNGGPGCSSIAYGASEEVGPFRVREDGKSLRLNPYAWNQEAN  134

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
            LLF+DSPAGVG+SYSNTSSDI T GDKRTAED+  FL+KW ERFP YK R FYI GESYA
Sbjct  135  LLFLDSPAGVGFSYSNTSSDIYTAGDKRTAEDAYTFLMKWLERFPNYKHRPFYIAGESYA  194

Query  608  GHYV  619
            GHY+
Sbjct  195  GHYI  198



>ref|XP_009147010.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Brassica 
rapa]
Length=450

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  304
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G  EEVGPF V  DGKTLY   Y+WN  ANLLF++SPAGVG+SY+N++S
Sbjct  86   NGGPGCSSVAYGATEEVGPFRVGSDGKTLYNKLYAWNKLANLLFLESPAGVGFSYTNSTS  145

Query  485  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            D+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+V
Sbjct  146  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFV  190



>gb|AES62200.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=491

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 140/189 (74%), Gaps = 2/189 (1%)
 Frame = +2

Query  59   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  239  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  412
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y+W
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAW  120

Query  413  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYIT  592
            N  AN+LF+DSPAGVG+SY N ++D+ T GD++TAED+  FL+ WFERFPQYK REFYI 
Sbjct  121  NNLANILFLDSPAGVGFSYCNKTTDLYTFGDQKTAEDAYIFLVNWFERFPQYKHREFYIA  180

Query  593  GESYAGHYV  619
            GESYAGHYV
Sbjct  181  GESYAGHYV  189



>ref|XP_007009790.1| Serine carboxypeptidase-like 28 [Theobroma cacao]
 gb|EOY18600.1| Serine carboxypeptidase-like 28 [Theobroma cacao]
Length=464

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 132/169 (78%), Gaps = 2/169 (1%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  292
            G +   +Q+ D ++ LPG    V+F+ YSGY+TV+ ++GRALFYW  +A     P+SKPL
Sbjct  22   GGNHRKEQERDRIVKLPGQPPKVNFSQYSGYITVDPKAGRALFYWLIKAPFKSQPASKPL  81

Query  293  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  472
            VLWLNGGPGCSS+A+G +EEVGPF V  DGKTL  NPY+WN  ANLLF+DSPAGVG+SYS
Sbjct  82   VLWLNGGPGCSSVAYGASEEVGPFRVRSDGKTLRLNPYAWNQEANLLFLDSPAGVGFSYS  141

Query  473  NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            NTSSDI T GDKRTAED+  FL+KW ERFP YK R FYI GESYAGHY+
Sbjct  142  NTSSDIYTVGDKRTAEDAYTFLIKWLERFPNYKHRPFYIAGESYAGHYI  190



>ref|XP_010460785.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=457

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 138/184 (75%), Gaps = 2/184 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
             L ++LL T       SS V++Q  D +  LPG   NV F  YSGYVTVN+E GRALFYW
Sbjct  5    FLVIILLFTISSSWSASSYVEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYW  64

Query  254  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              E+    DP S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  AN
Sbjct  65   LVESPLTRDPKSRPLVLWLNGGPGCSSVAYGGAEEIGPFRVGSDGKTLHPKLYAWNKLAN  124

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
            LLF+++PAGVG+SYSNTSSD+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYA
Sbjct  125  LLFLEAPAGVGFSYSNTSSDLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIIGESYA  184

Query  608  GHYV  619
            GH+V
Sbjct  185  GHFV  188



>ref|XP_011031766.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=466

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 140/196 (71%), Gaps = 6/196 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLL----LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  217
            M   S  C LF +L    L  S         +++Q+ D ++ LPG   NVSF+ +SGY+T
Sbjct  1    MRIKSSSCFLFSVLNFATLLLSTPAVTNHDHLEEQRRDRIIKLPGQPPNVSFSQFSGYIT  60

Query  218  VNQESGRALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  391
            V+   GRALFYW  EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DG+TL
Sbjct  61   VDPVEGRALFYWLNEAPKIVKPRSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGETL  120

Query  392  YWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYK  571
            + NPY+WN  ANLLF+DSPAGVG+SYSNTSSD+ T GD RTA+D+  FL+ W ERFP+YK
Sbjct  121  HLNPYAWNKVANLLFLDSPAGVGFSYSNTSSDVYTVGDGRTAKDAYTFLINWLERFPRYK  180

Query  572  GREFYITGESYAGHYV  619
             R FYI GESYAGHY+
Sbjct  181  HRPFYIAGESYAGHYI  196



>ref|XP_009147009.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Brassica 
rapa]
Length=459

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  304
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G  EEVGPF V  DGKTLY   Y+WN  ANLLF++SPAGVG+SY+N++S
Sbjct  86   NGGPGCSSVAYGATEEVGPFRVGSDGKTLYNKLYAWNKLANLLFLESPAGVGFSYTNSTS  145

Query  485  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            D+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+V
Sbjct  146  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFV  190



>emb|CDY35977.1| BnaA05g29730D [Brassica napus]
Length=459

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  304
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G AEEVGPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SY+N++S
Sbjct  86   NGGPGCSSVAYGAAEEVGPFRVGSDGKTLHNKLYAWNKLANLLFLESPAGVGFSYTNSTS  145

Query  485  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            D+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+V
Sbjct  146  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFV  190



>ref|XP_002274699.1| PREDICTED: serine carboxypeptidase-like 28 [Vitis vinifera]
Length=472

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 144/191 (75%), Gaps = 5/191 (3%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  232
            S+L +  L F +LL +S   G  + + + Q  D ++ LPG   NV F+ YSGY+TV+  +
Sbjct  11   SSLFFCVLGFFILLVSS---GATAGNREDQVRDRIVKLPGEPPNVGFSQYSGYITVDPRA  67

Query  233  GRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
            GRALFYW  EA +   P+S+PL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY
Sbjct  68   GRALFYWLIEAPKSRGPASRPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPY  127

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  586
            +WN  ANLLF+DSPAGVG+SYSNTSSD+   GDKRTA+D+ +FL+ W +RFPQYK R FY
Sbjct  128  AWNAEANLLFLDSPAGVGFSYSNTSSDLPNVGDKRTAKDAYKFLINWLQRFPQYKHRPFY  187

Query  587  ITGESYAGHYV  619
            I GESYAGHY+
Sbjct  188  IAGESYAGHYI  198



>emb|CBI31484.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 144/191 (75%), Gaps = 5/191 (3%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  232
            S+L +  L F +LL +S   G  + + + Q  D ++ LPG   NV F+ YSGY+TV+  +
Sbjct  22   SSLFFCVLGFFILLVSS---GATAGNREDQVRDRIVKLPGEPPNVGFSQYSGYITVDPRA  78

Query  233  GRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
            GRALFYW  EA +   P+S+PL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY
Sbjct  79   GRALFYWLIEAPKSRGPASRPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPY  138

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  586
            +WN  ANLLF+DSPAGVG+SYSNTSSD+   GDKRTA+D+ +FL+ W +RFPQYK R FY
Sbjct  139  AWNAEANLLFLDSPAGVGFSYSNTSSDLPNVGDKRTAKDAYKFLINWLQRFPQYKHRPFY  198

Query  587  ITGESYAGHYV  619
            I GESYAGHY+
Sbjct  199  IAGESYAGHYI  209



>gb|KDO48447.1| hypothetical protein CISIN_1g012819mg [Citrus sinensis]
Length=456

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 130/168 (77%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  295
            S S+  Q  D +  LPG   NV F  YSGYV+VNQ++GRALFYW  E  A   P S+PL+
Sbjct  21   SYSLADQDKDKITVLPGQPTNVDFNQYSGYVSVNQQAGRALFYWLIESPASRKPESRPLI  80

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SY+N
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYLNPYSWNKLANLLFLESPAGVGFSYTN  140

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            T+SD+ T GD RTAED+  FL+ WFERFPQYK  +FYI GESYAGHYV
Sbjct  141  TTSDLYTAGDGRTAEDAYTFLVNWFERFPQYKHTDFYIAGESYAGHYV  188



>ref|NP_187456.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
 sp|Q9SFB5.1|SCP27_ARATH RecName: Full=Serine carboxypeptidase-like 27; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF21209.1|AC013483_33 putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAT71955.1| At3g07990 [Arabidopsis thaliana]
 gb|AAU95440.1| At3g07990 [Arabidopsis thaliana]
 gb|AEE74628.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
Length=459

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            SS V++Q  D + +LPG   NV F  YSGYVTV++E GRALFYW  E+    DP S+PLV
Sbjct  23   SSYVEEQLRDRISNLPGQPSNVDFRQYSGYVTVHEERGRALFYWLVESPLARDPKSRPLV  82

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSN
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHSKLYAWNKLANLLFLESPAGVGFSYSN  142

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            T+SD+ T GD+RTAEDS  FL+ WFERFPQYK REFYI GESYAGH+V
Sbjct  143  TTSDLYTTGDQRTAEDSYIFLVNWFERFPQYKHREFYIVGESYAGHFV  190



>emb|CDY28004.1| BnaC05g44060D [Brassica napus]
Length=459

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  304
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G AEEVGPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SY+N++S
Sbjct  86   NGGPGCSSVAYGAAEEVGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYTNSTS  145

Query  485  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            D+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+V
Sbjct  146  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFV  190



>emb|CAN74854.1| hypothetical protein VITISV_028701 [Vitis vinifera]
Length=452

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 131/162 (81%), Gaps = 2/162 (1%)
 Frame = +2

Query  140  QKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVLWLNGG  313
            Q+ D + +LPG   N+ FA YSGYVTVN+++GRALFYW  +  A     S+PLVLWLNGG
Sbjct  23   QERDRITELPGQPKNIGFAQYSGYVTVNKQAGRALFYWLVQSPASRGAESRPLVLWLNGG  82

Query  314  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  493
            PGCSS+A+G AEE+GPF +  DGKTL+ NPY+WN  ANLLF++SPAGVG+SYSNT+SD+ 
Sbjct  83   PGCSSVAYGAAEEIGPFRIRPDGKTLFINPYAWNNLANLLFLESPAGVGFSYSNTTSDLY  142

Query  494  THGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            T GD+RTAED+  FL+ WFERFPQYK R+FYI GESYAGHYV
Sbjct  143  TAGDQRTAEDAYTFLINWFERFPQYKHRDFYIAGESYAGHYV  184



>ref|XP_006436271.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
 ref|XP_006485878.1| PREDICTED: serine carboxypeptidase-like 27-like [Citrus sinensis]
 gb|ESR49511.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
Length=456

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 130/168 (77%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  295
            S S+  Q  D +  LPG   NV F  YSGYV+VNQ++GRALFYW  E  A   P S+PL+
Sbjct  21   SYSLADQDKDKITVLPGQPTNVDFNQYSGYVSVNQQAGRALFYWLIESPASRKPESRPLI  80

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SY+N
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYLNPYSWNKLANLLFLESPAGVGFSYTN  140

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            T+SD+ T GD RTAED+  FL+ WFERFPQYK  +FYI GESYAGHYV
Sbjct  141  TTSDLYTAGDGRTAEDAYTFLVNWFERFPQYKHTDFYIAGESYAGHYV  188



>ref|XP_004496293.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X2 [Cicer 
arietinum]
Length=419

 Score =   231 bits (588),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 134/168 (80%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  295
            S+S++ Q+ D +  LPG   NV F  YSGYVTVN+E+ RALFYW  E+  +  P+ +PLV
Sbjct  24   SASMEDQRRDKIKLLPGQPKNVGFEQYSGYVTVNEENERALFYWLIESPMNRGPNLRPLV  83

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+LF+DSPAGVG+SY N
Sbjct  84   LWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANILFLDSPAGVGFSYCN  143

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
             ++D+ T GD++TAED+  FL+ WFERFPQYK REFYI GESYAGHYV
Sbjct  144  KTTDLYTFGDQKTAEDAYVFLVNWFERFPQYKHREFYIAGESYAGHYV  191



>ref|XP_010260054.1| PREDICTED: serine carboxypeptidase-like 25 isoform X2 [Nelumbo 
nucifera]
Length=421

 Score =   231 bits (588),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 137/166 (83%), Gaps = 1/166 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  301
            SSS ++++ D +  LPG   NVSF  +SGYVTV+Q +GRALFYW  EAV+DP SKPLV+W
Sbjct  22   SSSHEEEEADRITALPGQP-NVSFQQFSGYVTVDQVAGRALFYWLTEAVQDPVSKPLVVW  80

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSS+A+G +EE+GPF + + G  LY N +SWN+ ANLLF+++PAGVG+SY+N S
Sbjct  81   LNGGPGCSSVAYGASEEIGPFRLNRSGSGLYINKFSWNILANLLFLETPAGVGFSYTNRS  140

Query  482  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            SD+L  GD+RTA+DSLEFL++W +RFP+YK RE Y+TGESYAGHYV
Sbjct  141  SDLLDTGDQRTAKDSLEFLIRWLDRFPRYKNREVYLTGESYAGHYV  186



>gb|KHG08205.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=452

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 131/168 (78%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            S+    Q  D + +LPG   NV F  YSGYVT+NQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTSDKITELPGQPKNVGFNQYSGYVTLNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            T+SD+ T GDKRTAED+  FL+ WFERFPQYK R+FYI GESYAGHYV
Sbjct  137  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYIAGESYAGHYV  184



>ref|XP_009399563.1| PREDICTED: serine carboxypeptidase 24-like [Musa acuminata subsp. 
malaccensis]
Length=458

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWL  304
            ++ D+Q LD +  LPG    VSFA ++GYVTVNQE GRALFYW  EAV D + KPLVLWL
Sbjct  22   AAADRQALDRISALPGQP-RVSFAQFAGYVTVNQERGRALFYWLTEAVTDAAKKPLVLWL  80

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G +EE+GPF +++ G +LY N +SWN  ANLLF++SPAGVG+SY+N SS
Sbjct  81   NGGPGCSSVAYGASEEIGPFRIDRTGSSLYLNKFSWNREANLLFLESPAGVGFSYANVSS  140

Query  485  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            D+ + GD+RTA+D+L FL++W  RFP+YK REFYI+GESYAGHYV
Sbjct  141  DLQSVGDERTAQDALAFLIRWMSRFPEYKHREFYISGESYAGHYV  185



>gb|KCW65386.1| hypothetical protein EUGRSUZ_G02816 [Eucalyptus grandis]
Length=467

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 133/163 (82%), Gaps = 2/163 (1%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVLWLNG  310
            +++ D + +LPG   N  FA YSGYVTVN+++GRALFYW  E  A   P S+PLVLWLNG
Sbjct  37   ERERDRIGELPGQPPNAGFAQYSGYVTVNRQAGRALFYWLVESPASRRPESRPLVLWLNG  96

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSS+A+GLAEE+GPF +  DGKTLY NPY+W+  ANLLF++SPAG+G+SY+NT+SD+
Sbjct  97   GPGCSSVAYGLAEEIGPFRIRPDGKTLYSNPYAWSKLANLLFLESPAGIGFSYTNTTSDL  156

Query  491  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
             T GD+RTAED+  FL+ WFERFP+YK R+FYI GESYAGHYV
Sbjct  157  YTTGDQRTAEDAYAFLVNWFERFPEYKHRDFYIAGESYAGHYV  199



>gb|KJB76569.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=451

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 132/168 (79%), Gaps = 3/168 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  +N+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWN-NSNVLFLESPAGVGFSYTN  135

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            T+SD+ T GDKRTAED+  FL+ WFERFPQYK R+FYI GESYAGHYV
Sbjct  136  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYIAGESYAGHYV  183



>ref|XP_011040963.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 138/189 (73%), Gaps = 7/189 (4%)
 Frame = +2

Query  59   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            LS  CLL    + + I      +  + Q  D +  LPG   +  F  YSGYVTV ++SGR
Sbjct  6    LSILCLLVSPFVYSCI-----CAPFEDQGRDKITYLPGQPGSAEFNQYSGYVTVKKQSGR  60

Query  239  ALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  412
            ALFYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF + +DGKTLY NPY+W
Sbjct  61   ALFYWLVEAPTSRRPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRRDGKTLYSNPYAW  120

Query  413  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYIT  592
            N  ANLLF++SPAGVG+SYSNTSSD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI 
Sbjct  121  NKLANLLFLESPAGVGFSYSNTSSDLYTAGDQRTAEDAYTFLVNWFERFPQYKYRDFYIA  180

Query  593  GESYAGHYV  619
            GESYAGHYV
Sbjct  181  GESYAGHYV  189



>ref|XP_002315293.2| hypothetical protein POPTR_0010s22700g [Populus trichocarpa]
 gb|EEF01464.2| hypothetical protein POPTR_0010s22700g [Populus trichocarpa]
Length=469

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 140/188 (74%), Gaps = 6/188 (3%)
 Frame = +2

Query  74   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            LL+VL LAT   S         +++Q+ D ++ L G   NVSF+ +SGY+TV+  +GRAL
Sbjct  12   LLYVLNLATLLLSTIAATNHGHLEEQRRDKIIKLQGQPPNVSFSQFSGYITVDPLAGRAL  71

Query  245  FYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  418
            FYW  EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY+WN 
Sbjct  72   FYWLIEAPKIVKPKSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPYAWNK  131

Query  419  AANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGE  598
             ANLLF+DSPAGVG+SYSNTSSD  T GDKRTA+D+  FL+ WFERF QYK R FYI GE
Sbjct  132  VANLLFLDSPAGVGFSYSNTSSDTYTVGDKRTAKDAYTFLVNWFERFTQYKHRPFYIAGE  191

Query  599  SYA-GHYV  619
            SYA GHY+
Sbjct  192  SYAGGHYI  199



>ref|XP_010464446.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  304
            V++Q  D +  LPG   NV F  YSGYVTVN+E GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYWLVESPLTRDPKSRPLVLWL  85

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSNTSS
Sbjct  86   NGGPGCSSVAYGGAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTSS  145

Query  485  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            D+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+V
Sbjct  146  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIIGESYAGHFV  190



>ref|XP_009386999.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=474

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWL  304
            S  +QQ+ D V  LPG    V FA YSGYVTV   +GRALFYW  EA       PLVLWL
Sbjct  40   SPAEQQEQDRVARLPGQP-RVDFAQYSGYVTVEARAGRALFYWLVEAPPSAQPAPLVLWL  98

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSSIA+G +EE+GPF ++ DGKTLY NPY+WN  AN+LF+DSPAGVG+SY+NTSS
Sbjct  99   NGGPGCSSIAYGASEELGPFRIDSDGKTLYLNPYAWNTVANVLFLDSPAGVGFSYTNTSS  158

Query  485  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            D+ T GD RTA D+  FL+KWFERFPQYK REFYI GESYAGHYV
Sbjct  159  DLHTSGDHRTAVDAYNFLVKWFERFPQYKHREFYIAGESYAGHYV  203



>ref|XP_010486379.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  304
            V++Q  D +  LPG   NV F  YSGYVTVN+E GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYWLVESPLTRDPKSRPLVLWL  85

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSNTSS
Sbjct  86   NGGPGCSSVAYGGAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTSS  145

Query  485  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            D+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+V
Sbjct  146  DLYTTGDQRTAEDSYRFLVSWFERFPQYKHRDFYIIGESYAGHFV  190



>ref|XP_010260044.1| PREDICTED: serine carboxypeptidase-like 25 isoform X1 [Nelumbo 
nucifera]
Length=462

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 137/166 (83%), Gaps = 1/166 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  301
            SSS ++++ D +  LPG   NVSF  +SGYVTV+Q +GRALFYW  EAV+DP SKPLV+W
Sbjct  22   SSSHEEEEADRITALPGQP-NVSFQQFSGYVTVDQVAGRALFYWLTEAVQDPVSKPLVVW  80

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSS+A+G +EE+GPF + + G  LY N +SWN+ ANLLF+++PAGVG+SY+N S
Sbjct  81   LNGGPGCSSVAYGASEEIGPFRLNRSGSGLYINKFSWNILANLLFLETPAGVGFSYTNRS  140

Query  482  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            SD+L  GD+RTA+DSLEFL++W +RFP+YK RE Y+TGESYAGHYV
Sbjct  141  SDLLDTGDQRTAKDSLEFLIRWLDRFPRYKNREVYLTGESYAGHYV  186



>ref|XP_010067290.1| PREDICTED: serine carboxypeptidase-like 27 [Eucalyptus grandis]
Length=528

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 133/163 (82%), Gaps = 2/163 (1%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVLWLNG  310
            +++ D + +LPG   N  FA YSGYVTVN+++GRALFYW  E  A   P S+PLVLWLNG
Sbjct  98   ERERDRIGELPGQPPNAGFAQYSGYVTVNRQAGRALFYWLVESPASRRPESRPLVLWLNG  157

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSS+A+GLAEE+GPF +  DGKTLY NPY+W+  ANLLF++SPAG+G+SY+NT+SD+
Sbjct  158  GPGCSSVAYGLAEEIGPFRIRPDGKTLYSNPYAWSKLANLLFLESPAGIGFSYTNTTSDL  217

Query  491  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
             T GD+RTAED+  FL+ WFERFP+YK R+FYI GESYAGHYV
Sbjct  218  YTTGDQRTAEDAYAFLVNWFERFPEYKHRDFYIAGESYAGHYV  260



>ref|XP_004496292.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X1 [Cicer 
arietinum]
Length=462

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 134/168 (80%), Gaps = 2/168 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  295
            S+S++ Q+ D +  LPG   NV F  YSGYVTVN+E+ RALFYW  E+  +  P+ +PLV
Sbjct  24   SASMEDQRRDKIKLLPGQPKNVGFEQYSGYVTVNEENERALFYWLIESPMNRGPNLRPLV  83

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+LF+DSPAGVG+SY N
Sbjct  84   LWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANILFLDSPAGVGFSYCN  143

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
             ++D+ T GD++TAED+  FL+ WFERFPQYK REFYI GESYAGHYV
Sbjct  144  KTTDLYTFGDQKTAEDAYVFLVNWFERFPQYKHREFYIAGESYAGHYV  191



>ref|XP_010505097.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=469

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 136/185 (74%), Gaps = 2/185 (1%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVD--QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C+  V ++   +D    S   D  Q+  D ++ LPG   N++F+ +SGYVTV+  +GRAL
Sbjct  12   CMFLVCMMIALLDVVSSSDDADKEQKTKDKIISLPGQPPNLNFSQFSGYVTVDSTAGRAL  71

Query  245  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF +  DGKTL +N Y+WN  A
Sbjct  72   FYWLTEAPRPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRINPDGKTLRFNIYAWNKVA  131

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  604
            N+LF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+YK R FYI GESY
Sbjct  132  NVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMERFPEYKERPFYIAGESY  191

Query  605  AGHYV  619
            AGHY+
Sbjct  192  AGHYI  196



>ref|XP_003591947.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62198.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=458

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 138/189 (73%), Gaps = 2/189 (1%)
 Frame = +2

Query  59   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            +S      VL L     G   +SS+ +QK D +  LPG    V F  YSGYVTVN+ESGR
Sbjct  1    MSHSIFCVVLFLTIFCVGISLASSIKEQKRDKIKWLPGQPKIVGFEQYSGYVTVNEESGR  60

Query  239  ALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  412
            ALFYW  EA     P+SKPLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+LY NPY+W
Sbjct  61   ALFYWLTEAPLSHGPNSKPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLYLNPYAW  120

Query  413  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYIT  592
            N  AN+LF++SPAGVG+SY N ++D+   GD++TAED+  FL+ WFERFPQYK REFY+ 
Sbjct  121  NNLANILFLESPAGVGFSYCNKTTDMQNFGDQKTAEDAYIFLVNWFERFPQYKHREFYMA  180

Query  593  GESYAGHYV  619
            GESYAGHYV
Sbjct  181  GESYAGHYV  189



>gb|KDO48446.1| hypothetical protein CISIN_1g016137mg [Citrus sinensis]
Length=394

 Score =   228 bits (580),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 138/184 (75%), Gaps = 2/184 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            LL VL LA  +     S+   +Q+ D ++ LPG   NV+F+ YSGY+TV++++GRALFYW
Sbjct  12   LLCVLGLAIVLFPSPVSAIFKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYW  71

Query  254  FFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              EA  D  P+SKPLVLWLNGGPGCSS+A+G +EEVGPF V +DGK L  NPY+WN  AN
Sbjct  72   LVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNKEAN  131

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
            +LF+DSPAGVG+SY+ T  DI T GDKRT +D+  FL+ WF RFPQYK R FY+ GESYA
Sbjct  132  ILFLDSPAGVGFSYTKTREDIYTVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLAGESYA  191

Query  608  GHYV  619
            GHY+
Sbjct  192  GHYI  195



>ref|XP_006297634.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30532.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=434

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  304
            V++Q  D + +LPG   NV F  YSGYVTVN++ GRALFYW  E+     P S+PLVLWL
Sbjct  29   VEEQLRDRISELPGQPSNVDFRQYSGYVTVNEKRGRALFYWLVESPLTRSPKSRPLVLWL  88

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSNT+S
Sbjct  89   NGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTTS  148

Query  485  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            D+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+V
Sbjct  149  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFV  193



>ref|XP_009792407.1| PREDICTED: serine carboxypeptidase 24-like [Nicotiana sylvestris]
Length=468

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 137/181 (76%), Gaps = 2/181 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            LL +L L  +I+    +S   +Q+ D ++ LPG    V+F+ +SGYVTVN+  GRALFYW
Sbjct  16   LLIILSLTITINN-VAASLTKEQEFDRIISLPGQP-PVTFSQFSGYVTVNENHGRALFYW  73

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
              EA   P  KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSWN  AN+L
Sbjct  74   LTEATTQPEKKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSWNKVANIL  133

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  613
            F++SPAGVG+SY+NTSSD+   GDKRTA+D+L FL++W  RFPQYK R+FYI+GESYAGH
Sbjct  134  FLESPAGVGFSYTNTSSDLKDSGDKRTAQDALIFLIRWMSRFPQYKYRDFYISGESYAGH  193

Query  614  Y  616
            Y
Sbjct  194  Y  194



>ref|NP_181120.2| serine carboxypeptidase-like 28 [Arabidopsis thaliana]
 sp|Q8S8K6.2|SCP28_ARATH RecName: Full=Serine carboxypeptidase-like 28; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEC09159.1| serine carboxypeptidase-like 28 [Arabidopsis thaliana]
Length=462

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 135/183 (74%), Gaps = 5/183 (3%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C++  LL   S D  K     +Q+  D ++ LPG   N++F+ +SGYVTV+  +GRALFY
Sbjct  15   CMVIALLDVVSSDDAK-----EQKMKDKIISLPGQPPNLNFSQFSGYVTVDPAAGRALFY  69

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            W  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+WN  AN+
Sbjct  70   WLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAWNKVANV  129

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  610
            LF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+YK R FYI GESYAG
Sbjct  130  LFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWLERFPEYKERAFYIAGESYAG  189

Query  611  HYV  619
            HY+
Sbjct  190  HYI  192



>emb|CBI21207.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 138/191 (72%), Gaps = 5/191 (3%)
 Frame = +2

Query  59   LSWGCLLFVLLLATSIDGG----KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            +S   +L  LLL   +D G     G    ++++ D +  LPG    VSF  YSGYVTVN 
Sbjct  6    ISASMVLLSLLLIAVVDAGSHGVNGVRGGEEEEADRITALPGQP-KVSFQQYSGYVTVNH  64

Query  227  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
             +GRALFYW  EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +
Sbjct  65   VAGRALFYWLNEAVHDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKF  124

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  586
            SWN  ANLLF+++PAGVG+SYSN SSD+L  GD+RTA+DSL FL++W ERFP+YK RE Y
Sbjct  125  SWNTLANLLFLETPAGVGFSYSNKSSDLLDTGDRRTAKDSLVFLVRWLERFPRYKHREVY  184

Query  587  ITGESYAGHYV  619
            I GESYAGHYV
Sbjct  185  INGESYAGHYV  195



>ref|XP_002280058.1| PREDICTED: serine carboxypeptidase-like 25 [Vitis vinifera]
Length=473

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 138/191 (72%), Gaps = 5/191 (3%)
 Frame = +2

Query  59   LSWGCLLFVLLLATSIDGG----KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            +S   +L  LLL   +D G     G    ++++ D +  LPG    VSF  YSGYVTVN 
Sbjct  8    ISASMVLLSLLLIAVVDAGSHGVNGVRGGEEEEADRITALPGQP-KVSFQQYSGYVTVNH  66

Query  227  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
             +GRALFYW  EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +
Sbjct  67   VAGRALFYWLNEAVHDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKF  126

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  586
            SWN  ANLLF+++PAGVG+SYSN SSD+L  GD+RTA+DSL FL++W ERFP+YK RE Y
Sbjct  127  SWNTLANLLFLETPAGVGFSYSNKSSDLLDTGDRRTAKDSLVFLVRWLERFPRYKHREVY  186

Query  587  ITGESYAGHYV  619
            I GESYAGHYV
Sbjct  187  INGESYAGHYV  197



>ref|XP_006436272.1| hypothetical protein CICLE_v10031437mg [Citrus clementina]
 ref|XP_006485877.1| PREDICTED: serine carboxypeptidase-like 28-like [Citrus sinensis]
 gb|ESR49512.1| hypothetical protein CICLE_v10031437mg [Citrus clementina]
Length=468

 Score =   229 bits (583),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 138/184 (75%), Gaps = 2/184 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            LL VL LA  +     S+   +Q+ D ++ LPG   NV+F+ YSGY+TV++++GRALFYW
Sbjct  12   LLCVLGLAIVLFPSPVSAIFKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYW  71

Query  254  FFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              EA  D  P+SKPLVLWLNGGPGCSS+A+G +EEVGPF V +DGK L  NPY+WN  AN
Sbjct  72   LVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNREAN  131

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
            +LF+DSPAGVG+SY+ T  DI T GDKRT +D+  FL+ WF RFPQYK R FY+ GESYA
Sbjct  132  ILFLDSPAGVGFSYTKTREDIYTVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLAGESYA  191

Query  608  GHYV  619
            GHY+
Sbjct  192  GHYI  195



>gb|AFK43035.1| unknown [Medicago truncatula]
Length=459

 Score =   228 bits (582),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 138/189 (73%), Gaps = 2/189 (1%)
 Frame = +2

Query  59   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  239  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  412
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y+W
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAW  120

Query  413  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYIT  592
            N  AN+LF+DSPAGVG+SY N ++D+ T GD++TAE +  FL+ WFERFPQYK REFYI 
Sbjct  121  NNLANILFLDSPAGVGFSYCNKTTDLYTFGDQKTAEGAYIFLVNWFERFPQYKHREFYIA  180

Query  593  GESYAGHYV  619
            GESY GHYV
Sbjct  181  GESYVGHYV  189



>ref|XP_006297635.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30533.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=460

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  304
            V++Q  D + +LPG   NV F  YSGYVTVN++ GRALFYW  E+     P S+PLVLWL
Sbjct  27   VEEQLRDRISELPGQPSNVDFRQYSGYVTVNEKRGRALFYWLVESPLTRSPKSRPLVLWL  86

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSNT+S
Sbjct  87   NGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTTS  146

Query  485  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            D+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+V
Sbjct  147  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFV  191



>ref|XP_006294164.1| hypothetical protein CARUB_v10023157mg [Capsella rubella]
 gb|EOA27062.1| hypothetical protein CARUB_v10023157mg [Capsella rubella]
Length=464

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 139/194 (72%), Gaps = 2/194 (1%)
 Frame = +2

Query  44   LEMSALSWGCLLFVLLLATSIDGGKGSSSVD--QQKLDAVLDLPGLGFNVSFAHYSGYVT  217
            + ++   + C+  V ++   +D    S   D  Q+  D ++ LPG   N++F+ +SGYVT
Sbjct  1    MMITKKQYQCVFLVCMVIALLDQVSSSDDGDKVQKMKDKIISLPGQPPNLNFSQFSGYVT  60

Query  218  VNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  397
            V+  +GRALFYW  EA     +KPLVLWLNGGPGCSSIA+G +EE+GPF V  DGKTL  
Sbjct  61   VDSTAGRALFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEIGPFRVNPDGKTLRL  120

Query  398  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGR  577
            N Y+WN  AN+LF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+YK R
Sbjct  121  NIYAWNKVANVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMERFPEYKER  180

Query  578  EFYITGESYAGHYV  619
             FYI GESYAGHY+
Sbjct  181  PFYIAGESYAGHYI  194



>ref|XP_010265559.1| PREDICTED: serine carboxypeptidase 24-like isoform X1 [Nelumbo 
nucifera]
Length=456

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 141/188 (75%), Gaps = 5/188 (3%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            A  W  +L +L ++     G G S+ +Q+ LD +  LPG    V+F+ YSGY+TV+   G
Sbjct  2    ASQWRTILMILFISLI---GVGESATEQE-LDRISALPGQP-QVTFSQYSGYITVDSTHG  56

Query  236  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  415
            RALFYWF EA  DP +KPLVLWLNGGPGCSSIA+G +EE+GPF + KDG +LY N YSWN
Sbjct  57   RALFYWFTEATTDPQNKPLVLWLNGGPGCSSIAYGASEEIGPFRINKDGSSLYLNKYSWN  116

Query  416  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITG  595
              AN+LF++SPAGVG+SY+NTSS++   GD+RTA ++  F+++W  RFPQYK R+FYI+G
Sbjct  117  KEANILFLESPAGVGFSYTNTSSELKHSGDRRTAREAFLFMVRWMTRFPQYKYRDFYISG  176

Query  596  ESYAGHYV  619
            ESYAGHYV
Sbjct  177  ESYAGHYV  184



>ref|XP_006850617.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
 gb|ERN12198.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
Length=461

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 137/183 (75%), Gaps = 1/183 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNV-SFAHYSGYVTVNQESGRALFY  250
            L+F+       +   G SS D Q+ D +++LPG   NV  F+ YSGYVTV+Q +GRALFY
Sbjct  10   LMFLGFCLLIWEAEAGISSSDDQERDRIIELPGEPANVVDFSQYSGYVTVDQNAGRALFY  69

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            W  E+   PS +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGK+L+ NPY+WN  AN+
Sbjct  70   WLTESPTRPSLRPLVLWLNGGPGCSSVAYGAAEELGPFHINPDGKSLFLNPYAWNKLANI  129

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  610
            LF+DSPAGVG+SYSN+SSD+   GD +TA D+  FL+ W  RFPQYK REFYI GESYAG
Sbjct  130  LFLDSPAGVGFSYSNSSSDLKHPGDNQTAADAYAFLVNWLGRFPQYKYREFYIAGESYAG  189

Query  611  HYV  619
            HYV
Sbjct  190  HYV  192



>ref|XP_006410746.1| hypothetical protein EUTSA_v10016610mg [Eutrema salsugineum]
 gb|ESQ52199.1| hypothetical protein EUTSA_v10016610mg [Eutrema salsugineum]
Length=465

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 136/184 (74%), Gaps = 1/184 (1%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKL-DAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C+  + ++   +D    S    +QK+ D ++ LPG    ++F+ +SGYVTV+  +GRALF
Sbjct  15   CMCLLCMVIALLDVVTSSDDAKEQKMKDKIISLPGQPPQLNFSQFSGYVTVDSAAGRALF  74

Query  248  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
            YW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+WN  AN
Sbjct  75   YWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNIYAWNKVAN  134

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
            +LF+DSPAGVG+SY+NTSSD LT GDKRT ED+ +FL++W ERFP+YK R FYI GESYA
Sbjct  135  VLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDTYKFLVRWIERFPEYKERPFYIAGESYA  194

Query  608  GHYV  619
            GHY+
Sbjct  195  GHYI  198



>gb|KJB75609.1| hypothetical protein B456_012G048700 [Gossypium raimondii]
Length=327

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 137/182 (75%), Gaps = 2/182 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L+ + LL   +   +G S+ +++  D +  LPG    VSF  +SGYVTVN+ +GRALFYW
Sbjct  26   LISMALLLLFVSNSEGYSAAEEEA-DRISALPGQP-KVSFPQFSGYVTVNEVAGRALFYW  83

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
              E+   PSSKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLL
Sbjct  84   LTESPNSPSSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKSASGLYLNKFSWNNVANLL  143

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  613
            F+++PAGVG+SY+N SSD+L  GD+RTA DSLEFL++W +RFP+YK RE YITGESYAGH
Sbjct  144  FLETPAGVGFSYTNRSSDLLDTGDRRTAMDSLEFLIRWLDRFPRYKNREVYITGESYAGH  203

Query  614  YV  619
            YV
Sbjct  204  YV  205



>ref|XP_009414289.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 135/181 (75%), Gaps = 1/181 (1%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            + +LLL  S+      +  +QQ+LD +  LPG    V FA YSGYVTV+  +GRALFYW 
Sbjct  25   MCLLLLVGSLAAAAACTPAEQQELDRIARLPGQP-PVDFAQYSGYVTVDARAGRALFYWL  83

Query  257  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  436
             EA       PLVLWLNGGPGCSS+A+G +EE+GPF +  DGKTLY NPY+WN  AN+LF
Sbjct  84   VEAAPAAQPAPLVLWLNGGPGCSSVAYGASEELGPFRIRSDGKTLYLNPYAWNTVANVLF  143

Query  437  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHY  616
            ++SPAGVG+SYSNTSSD+ T GD RTA D+ +FL+ WFERFPQYK REFYI GESYAGHY
Sbjct  144  LESPAGVGFSYSNTSSDLYTAGDNRTAADAYKFLVNWFERFPQYKHREFYIAGESYAGHY  203

Query  617  V  619
            V
Sbjct  204  V  204



>gb|KJB77373.1| hypothetical protein B456_012G134700 [Gossypium raimondii]
Length=483

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 141/198 (71%), Gaps = 7/198 (4%)
 Frame = +2

Query  44   LEMSALSWGCLLFVLLLATSIDGGKG------SSSVDQQKLDAVLDLPGLGFNVSFAHYS  205
            +  +A  W     ++LL+ + +G +       S  + QQ+ D V++LPG    V F  Y+
Sbjct  1    MASNAAVWLGFFVLVLLSVNSEGSRHGGELSHSDVLRQQEADRVVELPGQP-AVEFKQYA  59

Query  206  GYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGK  385
            GYVTVN+  GRALFYWFFEA   P  KPL+LWLNGGPGCSSI +G AEE+GPF  +KD +
Sbjct  60   GYVTVNESHGRALFYWFFEATSKPEKKPLLLWLNGGPGCSSIGYGEAEELGPFFTQKDEQ  119

Query  386  TLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQ  565
            TL  NP+ WN AANLLF++SP GVG+SY+NTSSDI   GDK TAEDS  FL+ WF+RFPQ
Sbjct  120  TLKLNPHRWNKAANLLFLESPVGVGFSYTNTSSDIHQLGDKITAEDSYIFLVNWFKRFPQ  179

Query  566  YKGREFYITGESYAGHYV  619
            +K R+FYI GESYAGHYV
Sbjct  180  FKSRDFYIAGESYAGHYV  197



>ref|XP_002882565.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58824.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 130/169 (77%), Gaps = 2/169 (1%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  292
             +S V++Q  D +  LPG   NV F  YSGYVTVN+  GRALFYW  E+    DP  +PL
Sbjct  19   NASYVEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEVRGRALFYWLVESPSTRDPKFRPL  78

Query  293  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  472
            VLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYS
Sbjct  79   VLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLYAWNQLANLLFLESPAGVGFSYS  138

Query  473  NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            NT+SD+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+V
Sbjct  139  NTTSDLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFV  187



>ref|XP_010920885.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=506

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 134/182 (74%), Gaps = 1/182 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L F L LA  ++ G        +  D +  LPG    V F+ YSGYVTVN  +GRALFYW
Sbjct  29   LSFSLTLALVLNYGVVGGLAASRASDRIYRLPGQP-PVGFSQYSGYVTVNARAGRALFYW  87

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
            F EA       PLVLWLNGGPGCSSIA+G +EE+GPF +  DGKTL+ NPY+WN  ANLL
Sbjct  88   FIEAPPATQPAPLVLWLNGGPGCSSIAYGASEEIGPFRIHPDGKTLFLNPYAWNSEANLL  147

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  613
            F+DSPAGVG+SYSNTSSD+ T GD+RTA D+ +FLL WFERFPQYK R+FYI+GESYAGH
Sbjct  148  FLDSPAGVGFSYSNTSSDLYTAGDQRTAIDAYKFLLNWFERFPQYKYRDFYISGESYAGH  207

Query  614  YV  619
            YV
Sbjct  208  YV  209



>gb|KJB77375.1| hypothetical protein B456_012G134700 [Gossypium raimondii]
Length=509

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 141/198 (71%), Gaps = 7/198 (4%)
 Frame = +2

Query  44   LEMSALSWGCLLFVLLLATSIDGGKG------SSSVDQQKLDAVLDLPGLGFNVSFAHYS  205
            +  +A  W     ++LL+ + +G +       S  + QQ+ D V++LPG    V F  Y+
Sbjct  1    MASNAAVWLGFFVLVLLSVNSEGSRHGGELSHSDVLRQQEADRVVELPGQP-AVEFKQYA  59

Query  206  GYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGK  385
            GYVTVN+  GRALFYWFFEA   P  KPL+LWLNGGPGCSSI +G AEE+GPF  +KD +
Sbjct  60   GYVTVNESHGRALFYWFFEATSKPEKKPLLLWLNGGPGCSSIGYGEAEELGPFFTQKDEQ  119

Query  386  TLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQ  565
            TL  NP+ WN AANLLF++SP GVG+SY+NTSSDI   GDK TAEDS  FL+ WF+RFPQ
Sbjct  120  TLKLNPHRWNKAANLLFLESPVGVGFSYTNTSSDIHQLGDKITAEDSYIFLVNWFKRFPQ  179

Query  566  YKGREFYITGESYAGHYV  619
            +K R+FYI GESYAGHYV
Sbjct  180  FKSRDFYIAGESYAGHYV  197



>ref|XP_002529402.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF32998.1| serine carboxypeptidase, putative [Ricinus communis]
Length=469

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 139/187 (74%), Gaps = 6/187 (3%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVD-----QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            + F+ L+     G   ++ VD     +Q+LD +  LPG    V+F+ +SGYVTVN++ GR
Sbjct  9    VFFLSLILVVFSGMDTTTIVDALANKEQELDRISALPGQP-PVTFSQFSGYVTVNEKHGR  67

Query  239  ALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  418
            ALFYW  EA   P  KPLVLWLNGGPGCSS+A+G +EE+GPF + + G +LY N YSWN 
Sbjct  68   ALFYWLTEATSSPHHKPLVLWLNGGPGCSSVAYGASEEIGPFRINRTGSSLYLNKYSWNT  127

Query  419  AANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGE  598
             AN+LF++SPAGVG+SY+NTSSD+   GDKRTA+D+L FLL+WF RFPQYK R+F+I GE
Sbjct  128  EANILFLESPAGVGFSYTNTSSDLKDSGDKRTAQDALVFLLRWFSRFPQYKYRDFFIAGE  187

Query  599  SYAGHYV  619
            SYAGHYV
Sbjct  188  SYAGHYV  194



>ref|XP_007139483.1| hypothetical protein PHAVU_008G033300g [Phaseolus vulgaris]
 gb|ESW11477.1| hypothetical protein PHAVU_008G033300g [Phaseolus vulgaris]
Length=465

 Score =   226 bits (577),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 138/182 (76%), Gaps = 7/182 (4%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            +L VL+ A+    G+G ++      D +L LPG    VSF  +SGYVTVN+ +GRALFYW
Sbjct  14   VLMVLVGASCAKAGEGEAA------DRILALPGQP-KVSFQQFSGYVTVNKLAGRALFYW  66

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
              EA ++P +KPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLL
Sbjct  67   LTEAAQNPLTKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYINKFSWNTVANLL  126

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  613
            F+++PAGVG+SY+N SSD+L  GD RTA+DSLEF+L+W ERFP+YK RE YITGESYAGH
Sbjct  127  FLEAPAGVGFSYTNRSSDLLDTGDHRTAQDSLEFVLQWLERFPRYKNRELYITGESYAGH  186

Query  614  YV  619
            YV
Sbjct  187  YV  188



>emb|CDO99728.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   226 bits (577),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 137/184 (74%), Gaps = 3/184 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L FV L   S      +     Q+ D ++ LPG   N++F+ YSGYVTV++ +GRALFYW
Sbjct  15   LCFVTLHLASPIFVANAKQGRHQESDRIIRLPGQPANITFSQYSGYVTVDKIAGRALFYW  74

Query  254  FFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              E  A E P +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  +PY+WN  AN
Sbjct  75   LIESPASEKPETKPLVLWLNGGPGCSSIAYGASEEVGPFRVSPDGKTLGLSPYAWNKVAN  134

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
            LLF+DSPAGVG+SYSNTS D++T GDKRTA+D+  FL +W+ERFPQYK R FYI GESYA
Sbjct  135  LLFLDSPAGVGFSYSNTSFDMVT-GDKRTAKDAYNFLKRWYERFPQYKNRPFYIAGESYA  193

Query  608  GHYV  619
            GHY+
Sbjct  194  GHYI  197



>emb|CDP10248.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   226 bits (577),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  313
            +QQ++D +L+LPG    VSF+ +SGYV VN++ GRALFYW  EA   P  KPLVLWLNGG
Sbjct  24   EQQEMDRILELPGQP-PVSFSQFSGYVPVNEDHGRALFYWLTEATSSPEKKPLVLWLNGG  82

Query  314  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  493
            PGCSS+A+G +EE+GPF + K   +LY N +SWN  AN+LF++SPAGVG+SY+NTSSD+ 
Sbjct  83   PGCSSVAYGASEEIGPFRISKTASSLYLNKHSWNREANILFLESPAGVGFSYTNTSSDLK  142

Query  494  THGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
              GDKRTA+D+L FLL+W  RFPQYK R+FYI+GESYAGHY 
Sbjct  143  DSGDKRTAQDALIFLLRWMSRFPQYKDRDFYISGESYAGHYA  184



>dbj|BAK05698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   224 bits (570),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 135/189 (71%), Gaps = 6/189 (3%)
 Frame = +2

Query  68   GCLLFV--LLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  232
            GC L +  LLL  ++ GG G+   +   QQ  D V  LPG    V FA Y+GYVTV++  
Sbjct  18   GCFLGLAFLLLCGAVRGGGGAPDAEAARQQAADRVGRLPGQP-AVKFAQYAGYVTVDEAH  76

Query  233  GRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  412
            GRALFYWFFEA    + KPLVLWLNGGPGCSSI +G AEE+GPF V+K    L WNPYSW
Sbjct  77   GRALFYWFFEATAGAAKKPLVLWLNGGPGCSSIGYGEAEELGPFLVQKGKPELKWNPYSW  136

Query  413  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYIT  592
            N  ANL+F++SP GVG+SY+NTSSD+   GDK TA D+  FLL WF+RFPQYK  EFYI 
Sbjct  137  NKEANLMFLESPVGVGFSYTNTSSDLGKLGDKITAADAYVFLLNWFKRFPQYKHHEFYIA  196

Query  593  GESYAGHYV  619
            GESYAGHYV
Sbjct  197  GESYAGHYV  205



>dbj|BAO04184.1| hypothetical protein [Delphinium grandiflorum]
Length=456

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 137/179 (77%), Gaps = 0/179 (0%)
 Frame = +2

Query  83   VLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE  262
             +LL T++         + ++ D + +LPG   NV F+ YSGYVTV+Q++GRALFYW  E
Sbjct  10   TILLTTALFIFFFCCRAEDEEGDKISELPGQPGNVGFSQYSGYVTVDQDAGRALFYWLVE  69

Query  263  AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVD  442
            A    ++ PL+LWLNGGPGCSSIA+G AEE+GPF +  +G+TL+ NPYSWN  ANLLF+D
Sbjct  70   AEAAAATAPLILWLNGGPGCSSIAYGSAEEIGPFRIHPNGRTLFSNPYSWNKLANLLFLD  129

Query  443  SPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            SPAGVGYSY+NT+SD+ T GD+RTAEDS  FLL W ERFP+YK REFYI GESYAGHY+
Sbjct  130  SPAGVGYSYTNTTSDLYTTGDQRTAEDSYAFLLNWLERFPRYKHREFYIVGESYAGHYI  188



>gb|AAM15112.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=447

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 134/182 (74%), Gaps = 5/182 (3%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            ++  LL   S D  K     +Q+  D ++ LPG   N++F+ +SGYVTV+  +GRALFYW
Sbjct  1    MVIALLDVVSSDDAK-----EQKMKDKIISLPGQPPNLNFSQFSGYVTVDPAAGRALFYW  55

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
              EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+WN  AN+L
Sbjct  56   LTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAWNKVANVL  115

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  613
            F+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+YK R FYI GESYAGH
Sbjct  116  FLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWLERFPEYKERAFYIAGESYAGH  175

Query  614  YV  619
            Y+
Sbjct  176  YI  177



>gb|KJB07560.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=405

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 137/188 (73%), Gaps = 9/188 (5%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  236  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  415
            RALFYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSWN
Sbjct  87   RALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSWN  146

Query  416  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITG  595
            + AN+LF++SPAGVG+SY+NTSSD+   GD RTA+D+L FL +W  RFP Y+ REFYI G
Sbjct  147  MEANILFLESPAGVGFSYTNTSSDLKDSGDDRTAQDALIFLTRWMSRFPAYRHREFYIAG  206

Query  596  ESYAGHYV  619
            ESYAGHYV
Sbjct  207  ESYAGHYV  214



>gb|ABR16028.1| unknown [Picea sitchensis]
Length=479

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 139/188 (74%), Gaps = 4/188 (2%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            AL   C+ F+ +L  + D   G ++   Q+ D V +LPG     SFAHY+GY+TVN+  G
Sbjct  14   ALMNICIYFLFMLVVNGDHKDGLTA---QQADRVYNLPGQP-KASFAHYAGYITVNESHG  69

Query  236  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  415
            RALFYWFFEA +  S KPLVLWLNGGPGCSS+ +G A+E+GPF V+ +G  L  N YSWN
Sbjct  70   RALFYWFFEAEDKSSKKPLVLWLNGGPGCSSVGYGAAQELGPFQVKTNGTGLSLNTYSWN  129

Query  416  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITG  595
              ANLLF++SP GVG+SY+NTSSD+L   D+ TAEDS EFLL+WF+RFPQYK  +FYI G
Sbjct  130  KEANLLFLESPVGVGFSYTNTSSDLLELNDQFTAEDSYEFLLRWFKRFPQYKTHDFYIGG  189

Query  596  ESYAGHYV  619
            ESYAGHYV
Sbjct  190  ESYAGHYV  197



>gb|KDP25724.1| hypothetical protein JCGZ_23945 [Jatropha curcas]
Length=467

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPLVLWL  304
            + +Q+ D ++ LPG   NV+F+ YSGY++V+  +GRALFYW  EA +   P  KPLVLWL
Sbjct  32   LKEQEKDRIIKLPGQPSNVNFSQYSGYISVDPVAGRALFYWLTEAPKTVQPKLKPLVLWL  91

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSSIA+G +EEVGPF V  DGKTL+ NPY+WN  ANLLF+DSPAGVG+SYSNTSS
Sbjct  92   NGGPGCSSIAYGASEEVGPFRVRPDGKTLHLNPYAWNKEANLLFLDSPAGVGFSYSNTSS  151

Query  485  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            DI   GDKRTA+D+  FL+ W +RFPQYK R F+I GESYAGHY+
Sbjct  152  DISNVGDKRTAKDAYTFLVNWLKRFPQYKHRPFFIAGESYAGHYI  196



>ref|XP_003549539.1| PREDICTED: serine carboxypeptidase 24-like [Glycine max]
 gb|KHN17498.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 142/191 (74%), Gaps = 2/191 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSV-DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            M+  S   + F+ LL  +      + +V  +Q+ D +L LPG    V+F+ +SGYVTVN+
Sbjct  2    MTFQSKAGIFFLCLLIIAFSSINLAVAVPKEQEQDRILALPGQP-RVAFSQFSGYVTVNE  60

Query  227  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
            + GRALFYW  E+   P +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N Y
Sbjct  61   QHGRALFYWLTESPTSPQNKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKY  120

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  586
            +WN  A++LF++SPAGVG+SY+NTSSD+ T GDKRTA+D+L FL++W  RFPQYK REFY
Sbjct  121  AWNKEASILFLESPAGVGFSYTNTSSDLKTSGDKRTAQDALVFLIRWMSRFPQYKYREFY  180

Query  587  ITGESYAGHYV  619
            I GESYAGHYV
Sbjct  181  IAGESYAGHYV  191



>ref|XP_010273635.1| PREDICTED: serine carboxypeptidase 24-like [Nelumbo nucifera]
Length=458

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 134/182 (74%), Gaps = 7/182 (4%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            ++F+ L+  +ID  K      +Q+LD +  LPG    V F  YSGYVTV+   GRALFYW
Sbjct  11   IIFISLVGITIDAAK------EQELDRIWALPGQP-QVEFLQYSGYVTVDPVRGRALFYW  63

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
              EA  +P  KPLVLWLNGGPGCSSIA+G +EE+GPF + KDG +LY N YSWN  AN+L
Sbjct  64   LTEATAEPEKKPLVLWLNGGPGCSSIAYGASEEIGPFRINKDGSSLYLNEYSWNKEANIL  123

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  613
            F++SP GVG+SY+NTSSD+   GD+RTA ++  F+++W ERFPQYK R+FYI GESYAGH
Sbjct  124  FLESPVGVGFSYTNTSSDLKHSGDRRTAREAFVFMVRWMERFPQYKYRDFYIAGESYAGH  183

Query  614  YV  619
            YV
Sbjct  184  YV  185



>ref|XP_010509563.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=467

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 137/185 (74%), Gaps = 2/185 (1%)
 Frame = +2

Query  71   CLLFVLLLATSID--GGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C+L V ++   +D    +  ++ +Q+  D ++ LPG    ++F+ +SGYVTV+  +GRAL
Sbjct  12   CMLVVCMVIALVDVVSSRDDANKEQKIKDKIIALPGQPPKLNFSQFSGYVTVDSTAGRAL  71

Query  245  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            FYW  E      +KPLVLWLNGGPGCSSIA+G +EE+GPF +  DGKTL +N Y+WN  A
Sbjct  72   FYWLTETPRPSDTKPLVLWLNGGPGCSSIAYGASEEIGPFRINPDGKTLRFNIYAWNKVA  131

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  604
            N+LF+DSPAGVG+SY+NTSSD +T GDKRT ED+  FL++W ERFP+YK R FYI GESY
Sbjct  132  NVLFLDSPAGVGFSYTNTSSDEVTVGDKRTGEDAYRFLVRWMERFPEYKERPFYIAGESY  191

Query  605  AGHYV  619
            AGHY+
Sbjct  192  AGHYI  196



>ref|XP_009618061.1| PREDICTED: serine carboxypeptidase-like 34 [Nicotiana tomentosiformis]
Length=232

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            LL VL             ++ QQ+ D V  LPG    VSF  Y+GYVTVN+  GRALFYW
Sbjct  9    LLLVLNFGVLARSHISEKALAQQEADRVNRLPGQP-PVSFKQYAGYVTVNETHGRALFYW  67

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
            FFEA  +P  KPL+LWLNGGPGCSSI +G AEE+GPF  +K+   L +N +SWN AANLL
Sbjct  68   FFEATTNPEKKPLLLWLNGGPGCSSIGYGEAEELGPFFTQKNKPELKFNNFSWNKAANLL  127

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  613
            F++SP GVG+SY+NTSSDI   GD  TA+DS +FL+ WF RFPQ+K  EFYI GESYAGH
Sbjct  128  FLESPVGVGFSYTNTSSDITELGDTVTAQDSYKFLVNWFRRFPQFKTHEFYIAGESYAGH  187

Query  614  YV  619
            YV
Sbjct  188  YV  189



>ref|XP_006373363.1| hypothetical protein POPTR_0017s12960g [Populus trichocarpa]
 gb|ERP51160.1| hypothetical protein POPTR_0017s12960g [Populus trichocarpa]
Length=432

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 133/182 (73%), Gaps = 1/182 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            ++FVLLL          +  ++++ D +  LPG    VSF  +SGYVTVN+  GRALFYW
Sbjct  12   IVFVLLLVVFSSASHHHAVNEEEEADRISSLPGQP-KVSFQQFSGYVTVNKAVGRALFYW  70

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
              EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLL
Sbjct  71   LTEAVHDPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNSVANLL  130

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  613
            F+++PAGVG+SYSN SSD+L  GD RTA DSLEFLL W  RFP++K RE Y+TGESYAGH
Sbjct  131  FLETPAGVGFSYSNRSSDVLDTGDVRTAMDSLEFLLGWMNRFPRFKHREVYLTGESYAGH  190

Query  614  YV  619
            YV
Sbjct  191  YV  192



>ref|XP_002881413.1| hypothetical protein ARALYDRAFT_321290 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57672.1| hypothetical protein ARALYDRAFT_321290 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 133/183 (73%), Gaps = 0/183 (0%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C+  + ++   +D      + +Q+  D ++ LPG   N++F+ +SGYVTV+  +GR LFY
Sbjct  10   CMCLLCMVIAILDVVSSDDAKEQKMKDKIISLPGQPPNLNFSQFSGYVTVDSAAGRNLFY  69

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            W  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+WN  AN+
Sbjct  70   WLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAWNKVANV  129

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  610
            LF+DSPAGVG+SY+NTSSD LT GDKR  ED+  FL++W ERFP+YK R FYI GESYAG
Sbjct  130  LFLDSPAGVGFSYTNTSSDELTVGDKRAGEDAYRFLVRWMERFPEYKERPFYIAGESYAG  189

Query  611  HYV  619
            HY+
Sbjct  190  HYI  192



>ref|XP_010089631.1| Serine carboxypeptidase-like 25 [Morus notabilis]
 gb|EXB38102.1| Serine carboxypeptidase-like 25 [Morus notabilis]
Length=479

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 139/187 (74%), Gaps = 5/187 (3%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQK----LDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            C+L   L   +  G K      QQ+     D +++LPG    VSF  +SGYVTV++ +GR
Sbjct  15   CVLPFGLQVRASHGVKEEREKRQQREEEARDRIVELPGQP-KVSFQQFSGYVTVSRVAGR  73

Query  239  ALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  418
            ALFYW  EAV +P S+PLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN 
Sbjct  74   ALFYWLTEAVHEPLSRPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNT  133

Query  419  AANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGE  598
             ANLLF+++PAGVG+SYSN SSD+L  GD+RTA+DSLEFL++W +RFP+YKGRE ++TGE
Sbjct  134  VANLLFLETPAGVGFSYSNRSSDLLDTGDRRTAKDSLEFLIRWLDRFPRYKGREVFLTGE  193

Query  599  SYAGHYV  619
            SYAGHYV
Sbjct  194  SYAGHYV  200



>ref|XP_010516781.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=465

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 136/185 (74%), Gaps = 2/185 (1%)
 Frame = +2

Query  71   CLLFVLLLATSID--GGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C+L V ++   +D       ++ +Q+  D ++ LPG    ++F+ +SGYVTV+  +GRAL
Sbjct  10   CMLLVCMVIALLDVVSSSDDANKEQKMKDKIISLPGQPPKLNFSQFSGYVTVDSTAGRAL  69

Query  245  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  + Y+WN  A
Sbjct  70   FYWLTEAPSPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNTDGKTLRLSIYAWNKVA  129

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  604
            N+LF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+YK R FYI GESY
Sbjct  130  NVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMERFPEYKERPFYIAGESY  189

Query  605  AGHYV  619
            AGHY+
Sbjct  190  AGHYI  194



>ref|XP_010032541.1| PREDICTED: serine carboxypeptidase-like 25 [Eucalyptus grandis]
 gb|KCW51926.1| hypothetical protein EUGRSUZ_J01381 [Eucalyptus grandis]
Length=520

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 138/183 (75%), Gaps = 5/183 (3%)
 Frame = +2

Query  83   VLLLATSIDGGKGSSS----VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            V++L + ++   G  S       ++ D ++ LPG    V F  +SGYVTV++ +GRALFY
Sbjct  59   VVILISRLNATSGHDSREAAAAAEEADRIVSLPGQP-KVPFRQFSGYVTVHEAAGRALFY  117

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            W  EA  DPSSKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANL
Sbjct  118  WLTEAYSDPSSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNTEANL  177

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  610
            LF+++PAGVG+SYSN SSD+L  GD+RTAEDSLEFL++W ERFP+YKGRE ++TGESYAG
Sbjct  178  LFLETPAGVGFSYSNRSSDLLDTGDRRTAEDSLEFLVRWMERFPRYKGREVFLTGESYAG  237

Query  611  HYV  619
            HYV
Sbjct  238  HYV  240



>ref|XP_007032751.1| Serine carboxypeptidase-like 25 isoform 4 [Theobroma cacao]
 gb|EOY03677.1| Serine carboxypeptidase-like 25 isoform 4 [Theobroma cacao]
Length=363

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 128/165 (78%), Gaps = 1/165 (1%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWL  304
            S  ++++ D +  LPG    VSF  +SGYVTVN+ +GRALFYW  EA  DP SKPLV+WL
Sbjct  27   SVREEEEADRISALPGQP-KVSFQQFSGYVTVNKAAGRALFYWLTEAANDPLSKPLVIWL  85

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLLF+++PAGVG+SYSN SS
Sbjct  86   NGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNNVANLLFLETPAGVGFSYSNHSS  145

Query  485  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            D+   GD+RTA DSLEFL++W +RFP+YK R+ YITGESYAGHYV
Sbjct  146  DLFDTGDRRTAMDSLEFLIRWLDRFPRYKNRDIYITGESYAGHYV  190



>ref|XP_003519151.1| PREDICTED: serine carboxypeptidase 24-like isoform 1 [Glycine 
max]
Length=461

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
             L +L+ A S      ++   +Q+ D +  LPG    V+F+ +SGYVTVN++ GR+LFYW
Sbjct  12   FLCLLIFAFSSINILAAAVPKEQEQDRISALPGQP-RVAFSQFSGYVTVNEQHGRSLFYW  70

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
            F E+   P +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N Y+WN  AN+L
Sbjct  71   FTESPTSPQNKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYAWNREANVL  130

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  613
            F++SPAGVG+SY+NTSSD+ T GDKRTA+D+L F+++W  RFPQYK REFYI GESYAGH
Sbjct  131  FLESPAGVGFSYTNTSSDLKTSGDKRTAQDALIFVIRWMSRFPQYKYREFYIAGESYAGH  190

Query  614  YV  619
            YV
Sbjct  191  YV  192



>ref|XP_009631140.1| PREDICTED: serine carboxypeptidase 24-like [Nicotiana tomentosiformis]
Length=464

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            +Q+ D ++ LPG    V+F+ +SGYVTVN+  GRALFYW  EA   P  KPLVLWLNGGP
Sbjct  36   EQEFDRIISLPGQP-PVTFSQFSGYVTVNENHGRALFYWLTEATTQPEKKPLVLWLNGGP  94

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSS+A+G +EE+GPF + K G +LY N YSWN  AN+LF++SPAGVG+SY+NTSSD+  
Sbjct  95   GCSSVAYGASEEIGPFRINKTGSSLYLNKYSWNKVANILFLESPAGVGFSYTNTSSDLKD  154

Query  497  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
             GDKRTA+D+L FL +W  RFPQYK R+FYI+GESYAGHYV
Sbjct  155  SGDKRTAQDALIFLTRWMSRFPQYKYRDFYISGESYAGHYV  195



>ref|XP_011079399.1| PREDICTED: serine carboxypeptidase 24 [Sesamum indicum]
Length=462

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 141/190 (74%), Gaps = 1/190 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M  L    +L +  L++S+     ++    Q+LD +  LPG    V+F+ +SGYVTVN++
Sbjct  1    MEVLLRPHVLLLCFLSSSVLTALLAALPADQELDRISALPGQP-PVNFSQFSGYVTVNEQ  59

Query  230  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  409
             GRALFYW  EA  +  +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N YS
Sbjct  60   QGRALFYWLTEATSNAHTKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYS  119

Query  410  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYI  589
            WN  AN+LF++SPAGVG+SY+NTSS++   GDKRTA+D+L FL++W  RFPQY+ R+FYI
Sbjct  120  WNRVANILFLESPAGVGFSYTNTSSNLKDSGDKRTAQDALVFLIRWMHRFPQYRYRDFYI  179

Query  590  TGESYAGHYV  619
            +GESYAGHYV
Sbjct  180  SGESYAGHYV  189



>gb|KJB07562.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=448

 Score =   224 bits (570),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 137/188 (73%), Gaps = 9/188 (5%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  236  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  415
            RALFYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSWN
Sbjct  87   RALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSWN  146

Query  416  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITG  595
            + AN+LF++SPAGVG+SY+NTSSD+   GD RTA+D+L FL +W  RFP Y+ REFYI G
Sbjct  147  MEANILFLESPAGVGFSYTNTSSDLKDSGDDRTAQDALIFLTRWMSRFPAYRHREFYIAG  206

Query  596  ESYAGHYV  619
            ESYAGHYV
Sbjct  207  ESYAGHYV  214



>ref|XP_010258045.1| PREDICTED: serine carboxypeptidase-like 25 [Nelumbo nucifera]
Length=471

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 138/182 (76%), Gaps = 3/182 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            +LF  LL  S+    G+ +  +++ D +  LPG    VSF  +SGYVTVNQ +GRALFYW
Sbjct  17   VLFAFLLLVSVGASHGAGA--EEEADRIKALPGQP-KVSFQQFSGYVTVNQVAGRALFYW  73

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
              EAV +P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K G  LY N +SWN  ANLL
Sbjct  74   LTEAVHEPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRLNKSGSGLYLNKFSWNTVANLL  133

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  613
            F+++PAGVG+SYSN SSD+L  GD+RTA+DSLEFL++W  RF +YK RE ++TGESYAGH
Sbjct  134  FLETPAGVGFSYSNRSSDLLDTGDRRTAKDSLEFLIRWLGRFLRYKNREVFLTGESYAGH  193

Query  614  YV  619
            YV
Sbjct  194  YV  195



>gb|EYU39590.1| hypothetical protein MIMGU_mgv1a0101821mg, partial [Erythranthe 
guttata]
Length=183

 Score =   215 bits (548),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 132/184 (72%), Gaps = 7/184 (4%)
 Frame = +2

Query  68   GCLLFVLLL----ATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            G L+F L L    ATSI          QQ LD +  LPG   +V F+ YSGY+ VN+   
Sbjct  3    GQLIFALFLLPIIATSIS--TTPPYPKQQALDKITKLPGQPSSVKFSQYSGYIKVNENPI  60

Query  236  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  415
            RALFYWF EA + P SKPLVLWLNGGPGCSSIA+G +EEVGPF V  DG+TL  +  SWN
Sbjct  61   RALFYWFIEATKKPESKPLVLWLNGGPGCSSIAYGASEEVGPFRVGADGRTLSLSHTSWN  120

Query  416  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITG  595
              ANL+F+DSPAGVG+SYSN SSD+ T GD+RTA+D+ +FL KWF+RFPQYK R FY+ G
Sbjct  121  KEANLVFLDSPAGVGFSYSNDSSDLKT-GDQRTAKDAYKFLTKWFQRFPQYKYRSFYLAG  179

Query  596  ESYA  607
            ESYA
Sbjct  180  ESYA  183



>ref|XP_003552566.1| PREDICTED: serine carboxypeptidase-like 25-like isoform 1 [Glycine 
max]
Length=467

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = +2

Query  140  QKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPG  319
            +  D +L+LPG    VSF  +SGYVTVN+ +GRALFYW  EA ++P +KPLV+WLNGGPG
Sbjct  31   EAADRILELPGQP-KVSFQQFSGYVTVNKVAGRALFYWLTEAAQNPLTKPLVIWLNGGPG  89

Query  320  CSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTH  499
            CSS+A+G +EE+GPF + K    LY N +SWN  ANLLF+++PAGVG+SY+N SSD+L  
Sbjct  90   CSSVAYGASEEIGPFRINKTASGLYINKFSWNTVANLLFLEAPAGVGFSYANRSSDLLNT  149

Query  500  GDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            GD+RTA+DSLEF+++W ERFP+YK RE YITGESYAGHYV
Sbjct  150  GDRRTAQDSLEFVIQWLERFPRYKNRELYITGESYAGHYV  189



>ref|XP_003530438.1| PREDICTED: serine carboxypeptidase-like 25-like isoform X1 [Glycine 
max]
 ref|XP_006585779.1| PREDICTED: serine carboxypeptidase-like 25-like isoform X2 [Glycine 
max]
 ref|XP_006585780.1| PREDICTED: serine carboxypeptidase-like 25-like isoform X3 [Glycine 
max]
Length=471

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 139/181 (77%), Gaps = 3/181 (2%)
 Frame = +2

Query  83   VLLLATSIDGGKGSSSVD--QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            V+LL   + G + + + +  ++  D +L LPG    VSF  +SGYVTVN+ +GRALFYW 
Sbjct  11   VILLLMFLVGARFAKAKEGGEEAADRILKLPGQP-KVSFKQFSGYVTVNKVAGRALFYWL  69

Query  257  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  436
             EA ++P +KPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLLF
Sbjct  70   AEAAQNPLTKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYKNKFSWNSVANLLF  129

Query  437  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHY  616
            +++PAGVG+SY+N SSD+L  GD+RTA+DSLEF+++W ERFP+YK RE YITGESYAGHY
Sbjct  130  LEAPAGVGFSYTNRSSDLLDTGDRRTAQDSLEFVIQWLERFPRYKTRELYITGESYAGHY  189

Query  617  V  619
            V
Sbjct  190  V  190



>ref|XP_011018041.1| PREDICTED: serine carboxypeptidase 24-like isoform X2 [Populus 
euphratica]
Length=392

 Score =   222 bits (565),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
             +QQ+LD +  L G    V+F+ +SGYVTVN++ GRALFYW  EA   P  KPLVLWLNG
Sbjct  29   TEQQELDRISSLLGQP-PVTFSQFSGYVTVNEKHGRALFYWLTEATTTPDKKPLVLWLNG  87

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSS+A+G +EE+GPF + + G +LY N YSWN  AN+LF++SPAGVG+SY+NTSS++
Sbjct  88   GPGCSSVAYGASEEIGPFRINRTGSSLYMNKYSWNREANILFLESPAGVGFSYTNTSSNL  147

Query  491  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
               GDKRTA+D+L F+++W  RFPQYK REFYI GESYAGHYV
Sbjct  148  KDSGDKRTAQDALVFVIRWMSRFPQYKYREFYIAGESYAGHYV  190



>ref|XP_006453595.1| hypothetical protein CICLE_v10008182mg [Citrus clementina]
 gb|ESR66835.1| hypothetical protein CICLE_v10008182mg [Citrus clementina]
Length=356

 Score =   221 bits (562),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
              QQKLD +  LPG    V+F+ +SGYVTVN+  GRALFYW  EA      KPLVLWLNG
Sbjct  31   TKQQKLDRISALPGQP-PVTFSQFSGYVTVNENHGRALFYWLTEAASSALKKPLVLWLNG  89

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSS+A+G +EE+GPF + ++G +LY N YSW+  AN+LF++SPAGVG+SY+NTSS++
Sbjct  90   GPGCSSVAYGASEEIGPFRINRNGSSLYLNKYSWSREANILFLESPAGVGFSYTNTSSNL  149

Query  491  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
               GD RTA+D+L FL++W  RFPQYK REFYI GESYAGHYV
Sbjct  150  KDSGDNRTAQDALVFLIRWMSRFPQYKYREFYIAGESYAGHYV  192



>ref|XP_008789080.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
27 [Phoenix dactylifera]
Length=473

 Score =   224 bits (570),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 135/180 (75%), Gaps = 1/180 (1%)
 Frame = +2

Query  80   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFF  259
            F L LA  ++ G        Q+ D +  LPG    V F+ YSGYVTV+  +GRALFYWF 
Sbjct  25   FFLSLALVLNYGVAGGLAASQESDRITWLPGQP-PVGFSQYSGYVTVDARAGRALFYWFI  83

Query  260  EAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  439
            EA       PL+LWLNGGPGCSSIA+G +EE+GPFH+  DGKTL+ NPY+WN AANLLF+
Sbjct  84   EAPPAAQPAPLILWLNGGPGCSSIAYGASEELGPFHIHPDGKTLFLNPYAWNSAANLLFL  143

Query  440  DSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            +SPAGVG+SYSNTSSD+ T GD+RTA D+  FL+ WFERFPQYK R+FYITGESYAGHYV
Sbjct  144  ESPAGVGFSYSNTSSDLYTAGDRRTAMDAYNFLVNWFERFPQYKYRDFYITGESYAGHYV  203



>ref|XP_002324116.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF04249.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=468

 Score =   224 bits (570),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 133/182 (73%), Gaps = 1/182 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            ++FVLLL          +  ++++ D +  LPG    VSF  +SGYVTVN+  GRALFYW
Sbjct  12   IVFVLLLVVFSSASHHHAVNEEEEADRISSLPGQP-KVSFQQFSGYVTVNKAVGRALFYW  70

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
              EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLL
Sbjct  71   LTEAVHDPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNSVANLL  130

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  613
            F+++PAGVG+SYSN SSD+L  GD RTA DSLEFLL W  RFP++K RE Y+TGESYAGH
Sbjct  131  FLETPAGVGFSYSNRSSDVLDTGDVRTAMDSLEFLLGWMNRFPRFKHREVYLTGESYAGH  190

Query  614  YV  619
            YV
Sbjct  191  YV  192



>ref|XP_009420309.1| PREDICTED: serine carboxypeptidase 24-like [Musa acuminata subsp. 
malaccensis]
Length=464

 Score =   224 bits (570),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 127/163 (78%), Gaps = 1/163 (1%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
             DQQ  D +  LPG    V+FA +SGYVTVN+E GRALFYW  EA  D + KPLVLWLNG
Sbjct  33   ADQQAHDRITALPGQP-PVTFAQFSGYVTVNKEQGRALFYWLTEAATDAAKKPLVLWLNG  91

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSS+A+G +EE+GPF + +   +LY N +SWN  ANLLF++SPAGVG+SY+NTSSD+
Sbjct  92   GPGCSSVAYGASEEIGPFRISRTCSSLYLNQFSWNREANLLFLESPAGVGFSYTNTSSDL  151

Query  491  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
             T GD+RTA D+L FL+ W  RFPQYK R+FYI+GESYAGHYV
Sbjct  152  KTSGDERTAGDALMFLIGWMSRFPQYKARDFYISGESYAGHYV  194



>gb|KHN42831.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   223 bits (569),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
             L +L+ A S      ++   +Q+ D +  LPG    V+F+ +SGYVTVN++ GR+LFYW
Sbjct  11   FLCLLIFAFSSINILAAAVPKEQEQDRISALPGQP-RVAFSQFSGYVTVNEQHGRSLFYW  69

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
            F E+   P +KP+VLWLNGGPGCSS+A+G +EE+GPF + K G +LY N Y+WN  AN+L
Sbjct  70   FTESPTSPQNKPVVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYAWNREANVL  129

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  613
            F++SPAGVG+SY+NTSSD+ T GDKRTA+D+L F+++W  RFPQYK REFYI GESYAGH
Sbjct  130  FLESPAGVGFSYTNTSSDLKTSGDKRTAQDALIFVIRWMSRFPQYKYREFYIAGESYAGH  189

Query  614  YV  619
            YV
Sbjct  190  YV  191



>gb|KFK36473.1| hypothetical protein AALP_AA4G129300 [Arabis alpina]
Length=439

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = +2

Query  116  KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLV  295
            + + + +Q+  D ++ LPG   +++F+ YSGYVTV+  +GRALFYW  EA     +KPLV
Sbjct  3    RNNDAKEQKMKDKIISLPGQPPHLNFSQYSGYVTVDSAAGRALFYWLTEAPSPSGTKPLV  62

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G +EEVGPF V  DGK+L+ N Y+WN  ANLLF+DSPAGVG+SY+N
Sbjct  63   LWLNGGPGCSSIAYGASEEVGPFRVNPDGKSLHLNLYAWNKVANLLFLDSPAGVGFSYTN  122

Query  476  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
             SSD LT GDKRT ED+  FL++W ERFP+YK R FYI GESYAGHY+
Sbjct  123  ASSDELTVGDKRTGEDAYRFLVRWMERFPEYKQRPFYIAGESYAGHYI  170



>emb|CDY43258.1| BnaC05g48510D [Brassica napus]
Length=473

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 135/187 (72%), Gaps = 5/187 (3%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSV----DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            C+LF  L+A  I   +G S       Q + D +  LPG   NV+F  +SGYVTV + SGR
Sbjct  6    CVLFTTLMAILIMTSQGRSQAREGEKQAEADRITSLPGQP-NVTFEQFSGYVTVAKHSGR  64

Query  239  ALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  418
            +LFYW  EA   P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K G  LY N ++WN 
Sbjct  65   SLFYWLTEASHLPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRIRKGGSGLYLNKFAWNS  124

Query  419  AANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGE  598
             ANLLF+++PAGVG+SY+N SSD+   GD RTA+DSL+FL+KW +RFP+Y  RE YITGE
Sbjct  125  IANLLFLEAPAGVGFSYTNRSSDLFNTGDIRTAKDSLQFLIKWLQRFPRYNRREIYITGE  184

Query  599  SYAGHYV  619
            SYAGHYV
Sbjct  185  SYAGHYV  191



>gb|ACA61622.1| hypothetical protein AP7_B10.2 [Arabidopsis lyrata subsp. petraea]
Length=200

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 124/163 (76%), Gaps = 1/163 (1%)
 Frame = +2

Query  122  SSSVDQQKL-DAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVL  298
            S    +QK+ D ++ LPG   N++F+ +SGYVTV+  +GR LFYW  EA     +KPLVL
Sbjct  11   SDDAKEQKMKDKIISLPGQPPNLNFSQFSGYVTVDSAAGRNLFYWLTEAPRPSGTKPLVL  70

Query  299  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  478
            WLNGGPGCSSIA+G +EEVGPF +  DGKTL  N Y+WN  AN+LF+DSPAGVG+SY+NT
Sbjct  71   WLNGGPGCSSIAYGASEEVGPFRINPDGKTLRLNLYAWNKVANVLFLDSPAGVGFSYTNT  130

Query  479  SSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  607
            SSD LT GDKRT ED+  FL++W ERFP+YK R FYI GESYA
Sbjct  131  SSDKLTVGDKRTGEDAYRFLVRWMERFPEYKERPFYIAGESYA  173



>ref|XP_004232164.1| PREDICTED: serine carboxypeptidase-like 25 [Solanum lycopersicum]
Length=464

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 131/172 (76%), Gaps = 1/172 (1%)
 Frame = +2

Query  104  IDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSS  283
            +   K +   D++  D ++ LPG    VSF  YSGYVTVNQ +GRALFYW  EA+++P +
Sbjct  18   VSAAKLNKYQDEEDADRIISLPGQP-KVSFHQYSGYVTVNQFAGRALFYWLTEAIDEPLT  76

Query  284  KPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGY  463
            KPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLLF+++PAGVG+
Sbjct  77   KPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNKLANLLFLETPAGVGF  136

Query  464  SYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
            SYSN SSD+L  GD RTA+DSL+FL+ W  RFP+Y+ RE YITGESYAGHYV
Sbjct  137  SYSNRSSDLLDTGDIRTAKDSLQFLIHWMNRFPRYRNREVYITGESYAGHYV  188



>gb|KJB07564.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=488

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 137/188 (73%), Gaps = 9/188 (5%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  236  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  415
            RALFYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSWN
Sbjct  87   RALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSWN  146

Query  416  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITG  595
            + AN+LF++SPAGVG+SY+NTSSD+   GD RTA+D+L FL +W  RFP Y+ REFYI G
Sbjct  147  MEANILFLESPAGVGFSYTNTSSDLKDSGDDRTAQDALIFLTRWMSRFPAYRHREFYIAG  206

Query  596  ESYAGHYV  619
            ESYAGHYV
Sbjct  207  ESYAGHYV  214



>gb|KHN41581.1| Serine carboxypeptidase-like 25 [Glycine soja]
Length=453

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            ++  D +L LPG    VSF  +SGYVTVN+ +GRALFYW  EA ++P +KPLV+WLNGGP
Sbjct  16   EEAADRILKLPGQP-KVSFKQFSGYVTVNKVAGRALFYWLAEAAQNPLTKPLVIWLNGGP  74

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSS+A+G +EE+GPF + K    LY N +SWN  ANLLF+++PAGVG+SY+N SSD+L 
Sbjct  75   GCSSVAYGASEEIGPFRINKTASGLYKNKFSWNSVANLLFLEAPAGVGFSYTNRSSDLLD  134

Query  497  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  619
             GD+RTA+DSLEF+++W ERFP+YK RE YITGESYAGHYV
Sbjct  135  TGDRRTAQDSLEFVIQWLERFPRYKTRELYITGESYAGHYV  175



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950