BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS038C12

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006382069.1|  hypothetical protein POPTR_0006s26420g             184   1e-50   
emb|CDX72363.1|  BnaC07g43850D                                          172   1e-50   
ref|XP_006382068.1|  hypothetical protein POPTR_0006s26420g             183   2e-50   
gb|KJB83316.1|  hypothetical protein B456_013G240700                    183   3e-50   Gossypium raimondii
gb|KJB83317.1|  hypothetical protein B456_013G240700                    182   5e-50   Gossypium raimondii
ref|XP_010322742.1|  PREDICTED: transcriptional corepressor LEUNI...    183   1e-49   Solanum lycopersicum
ref|XP_010322743.1|  PREDICTED: transcriptional corepressor LEUNI...    183   1e-49   Solanum lycopersicum
gb|KGN62903.1|  hypothetical protein Csa_2G379340                       182   1e-49   Cucumis sativus [cucumbers]
ref|XP_006353653.1|  PREDICTED: transcriptional corepressor LEUNI...    183   1e-49   Solanum tuberosum [potatoes]
ref|XP_009624260.1|  PREDICTED: transcriptional corepressor LEUNI...    182   2e-49   
ref|XP_006353652.1|  PREDICTED: transcriptional corepressor LEUNI...    182   2e-49   Solanum tuberosum [potatoes]
ref|XP_009787198.1|  PREDICTED: transcriptional corepressor LEUNI...    182   2e-49   Nicotiana sylvestris
ref|XP_002515594.1|  hypothetical protein RCOM_0927510                  168   2e-49   
ref|XP_004241804.1|  PREDICTED: transcriptional corepressor LEUNI...    182   2e-49   Solanum lycopersicum
ref|XP_010322741.1|  PREDICTED: transcriptional corepressor LEUNI...    182   2e-49   Solanum lycopersicum
ref|XP_010322740.1|  PREDICTED: transcriptional corepressor LEUNI...    182   2e-49   Solanum lycopersicum
ref|XP_009624257.1|  PREDICTED: transcriptional corepressor LEUNI...    182   2e-49   Nicotiana tomentosiformis
gb|EPS65391.1|  hypothetical protein M569_09387                         179   2e-49   Genlisea aurea
ref|XP_006353651.1|  PREDICTED: transcriptional corepressor LEUNI...    182   2e-49   Solanum tuberosum [potatoes]
ref|XP_009624258.1|  PREDICTED: transcriptional corepressor LEUNI...    182   2e-49   
ref|XP_006353650.1|  PREDICTED: transcriptional corepressor LEUNI...    182   2e-49   Solanum tuberosum [potatoes]
ref|XP_009787196.1|  PREDICTED: transcriptional corepressor LEUNI...    182   2e-49   Nicotiana sylvestris
ref|XP_009787197.1|  PREDICTED: transcriptional corepressor LEUNI...    182   2e-49   Nicotiana sylvestris
ref|XP_004138746.1|  PREDICTED: transcriptional corepressor LEUNI...    182   2e-49   Cucumis sativus [cucumbers]
ref|XP_011081899.1|  PREDICTED: transcriptional corepressor LEUNIG      182   3e-49   Sesamum indicum [beniseed]
ref|XP_011019744.1|  PREDICTED: transcriptional corepressor LEUNI...    181   3e-49   Populus euphratica
gb|EYU21923.1|  hypothetical protein MIMGU_mgv1a000972mg                182   3e-49   Erythranthe guttata [common monkey flower]
ref|XP_009372956.1|  PREDICTED: transcriptional corepressor LEUNI...    181   3e-49   
ref|XP_010526194.1|  PREDICTED: transcriptional corepressor LEUNI...    182   3e-49   Tarenaya hassleriana [spider flower]
ref|XP_007013777.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    182   3e-49   
ref|XP_007013780.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    182   3e-49   
ref|XP_004168288.1|  PREDICTED: transcriptional corepressor LEUNI...    182   3e-49   
ref|XP_003544623.1|  PREDICTED: transcriptional corepressor LEUNI...    182   3e-49   Glycine max [soybeans]
emb|CDP04840.1|  unnamed protein product                                178   3e-49   Coffea canephora [robusta coffee]
ref|XP_003550163.1|  PREDICTED: transcriptional corepressor LEUNI...    182   3e-49   
ref|XP_004138745.1|  PREDICTED: transcriptional corepressor LEUNI...    182   3e-49   Cucumis sativus [cucumbers]
ref|XP_009372954.1|  PREDICTED: transcriptional corepressor LEUNI...    182   3e-49   Pyrus x bretschneideri [bai li]
ref|XP_002309593.2|  LEUNIG family protein                              182   3e-49   
ref|XP_008445143.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    182   3e-49   
ref|XP_007225320.1|  hypothetical protein PRUPE_ppa001131mg             182   3e-49   
gb|KHG28610.1|  Transcriptional corepressor LEUNIG -like protein        181   4e-49   Gossypium arboreum [tree cotton]
emb|CBI20986.3|  unnamed protein product                                171   4e-49   Vitis vinifera
gb|KJB83313.1|  hypothetical protein B456_013G240700                    182   4e-49   Gossypium raimondii
ref|XP_008359610.1|  PREDICTED: transcriptional corepressor LEUNI...    182   4e-49   
ref|XP_008359611.1|  PREDICTED: transcriptional corepressor LEUNI...    182   4e-49   
ref|XP_007225321.1|  hypothetical protein PRUPE_ppa001131mg             181   4e-49   
gb|KJB83315.1|  hypothetical protein B456_013G240700                    182   4e-49   Gossypium raimondii
ref|XP_004498639.1|  PREDICTED: transcriptional corepressor LEUNI...    181   4e-49   Cicer arietinum [garbanzo]
ref|XP_009372955.1|  PREDICTED: transcriptional corepressor LEUNI...    181   4e-49   Pyrus x bretschneideri [bai li]
gb|KJB64522.1|  hypothetical protein B456_010G053000                    182   4e-49   Gossypium raimondii
ref|XP_011019743.1|  PREDICTED: transcriptional corepressor LEUNI...    181   4e-49   Populus euphratica
gb|KHN16498.1|  Transcriptional corepressor LEUNIG                      181   4e-49   Glycine soja [wild soybean]
ref|XP_011019742.1|  PREDICTED: transcriptional corepressor LEUNI...    181   4e-49   Populus euphratica
ref|XP_003522634.1|  PREDICTED: transcriptional corepressor LEUNI...    181   4e-49   Glycine max [soybeans]
ref|XP_007013778.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    182   4e-49   Theobroma cacao [chocolate]
ref|XP_008359612.1|  PREDICTED: transcriptional corepressor LEUNI...    181   4e-49   
ref|XP_003526430.1|  PREDICTED: transcriptional corepressor LEUNI...    181   4e-49   Glycine max [soybeans]
gb|AES73711.2|  transcriptional corepressor leunig-like protein         181   4e-49   Medicago truncatula
gb|KHN10378.1|  Transcriptional corepressor LEUNIG                      167   4e-49   Glycine soja [wild soybean]
ref|XP_003544622.1|  PREDICTED: transcriptional corepressor LEUNI...    181   4e-49   Glycine max [soybeans]
gb|KHN08101.1|  Transcriptional corepressor LEUNIG                      181   4e-49   Glycine soja [wild soybean]
gb|KDO79598.1|  hypothetical protein CISIN_1g002471mg                   181   4e-49   Citrus sinensis [apfelsine]
gb|KJB64524.1|  hypothetical protein B456_010G053000                    181   4e-49   Gossypium raimondii
ref|XP_003550164.1|  PREDICTED: transcriptional corepressor LEUNI...    181   4e-49   
ref|XP_003588695.1|  Transcriptional corepressor LEUNIG                 181   4e-49   Medicago truncatula
ref|XP_006450543.1|  hypothetical protein CICLE_v10007390mg             181   4e-49   
gb|KDO79599.1|  hypothetical protein CISIN_1g002471mg                   181   4e-49   Citrus sinensis [apfelsine]
ref|XP_008219869.1|  PREDICTED: transcriptional corepressor LEUNI...    181   5e-49   Prunus mume [ume]
gb|KJB83312.1|  hypothetical protein B456_013G240700                    182   5e-49   Gossypium raimondii
ref|XP_006596119.1|  PREDICTED: transcriptional corepressor LEUNI...    181   5e-49   Glycine max [soybeans]
ref|XP_009372951.1|  PREDICTED: transcriptional corepressor LEUNI...    181   5e-49   Pyrus x bretschneideri [bai li]
gb|KDO79596.1|  hypothetical protein CISIN_1g002471mg                   181   5e-49   Citrus sinensis [apfelsine]
gb|KJB83301.1|  hypothetical protein B456_013G240700                    182   5e-49   Gossypium raimondii
gb|KJB83300.1|  hypothetical protein B456_013G240700                    182   5e-49   Gossypium raimondii
ref|XP_006476206.1|  PREDICTED: transcriptional corepressor LEUNI...    181   5e-49   Citrus sinensis [apfelsine]
ref|XP_006581383.1|  PREDICTED: transcriptional corepressor LEUNI...    181   5e-49   Glycine max [soybeans]
ref|XP_009372950.1|  PREDICTED: transcriptional corepressor LEUNI...    181   5e-49   Pyrus x bretschneideri [bai li]
ref|XP_006450544.1|  hypothetical protein CICLE_v10007390mg             181   5e-49   Citrus clementina [clementine]
ref|XP_008359609.1|  PREDICTED: transcriptional corepressor LEUNI...    181   5e-49   
ref|XP_007225322.1|  hypothetical protein PRUPE_ppa001131mg             181   5e-49   
ref|XP_010648611.1|  PREDICTED: transcriptional corepressor LEUNI...    181   5e-49   Vitis vinifera
ref|XP_004501292.1|  PREDICTED: transcriptional corepressor LEUNI...    181   5e-49   Cicer arietinum [garbanzo]
ref|XP_008359608.1|  PREDICTED: transcriptional corepressor LEUNI...    181   5e-49   
gb|KDO79597.1|  hypothetical protein CISIN_1g002471mg                   181   5e-49   Citrus sinensis [apfelsine]
ref|XP_004498638.1|  PREDICTED: transcriptional corepressor LEUNI...    181   5e-49   Cicer arietinum [garbanzo]
gb|KJB64523.1|  hypothetical protein B456_010G053000                    181   5e-49   Gossypium raimondii
ref|XP_003522633.1|  PREDICTED: transcriptional corepressor LEUNI...    181   5e-49   Glycine max [soybeans]
gb|KJB64525.1|  hypothetical protein B456_010G053000                    181   5e-49   Gossypium raimondii
gb|KJB83302.1|  hypothetical protein B456_013G240700                    181   5e-49   Gossypium raimondii
gb|KJB83303.1|  hypothetical protein B456_013G240700                    181   5e-49   Gossypium raimondii
gb|KEH35932.1|  transcriptional corepressor leunig-like protein         181   5e-49   Medicago truncatula
ref|XP_007161251.1|  hypothetical protein PHAVU_001G054700g             181   5e-49   Phaseolus vulgaris [French bean]
ref|XP_006578171.1|  PREDICTED: transcriptional corepressor LEUNI...    181   6e-49   Glycine max [soybeans]
gb|KEH39820.1|  transcriptional corepressor leunig-like protein         181   6e-49   Medicago truncatula
ref|XP_011026513.1|  PREDICTED: transcriptional corepressor LEUNI...    181   6e-49   Populus euphratica
ref|XP_009372953.1|  PREDICTED: transcriptional corepressor LEUNI...    181   6e-49   Pyrus x bretschneideri [bai li]
ref|XP_008219867.1|  PREDICTED: transcriptional corepressor LEUNI...    181   6e-49   Prunus mume [ume]
ref|XP_008219868.1|  PREDICTED: transcriptional corepressor LEUNI...    181   6e-49   Prunus mume [ume]
gb|KJB83304.1|  hypothetical protein B456_013G240700                    181   7e-49   Gossypium raimondii
gb|KJB83305.1|  hypothetical protein B456_013G240700                    181   7e-49   Gossypium raimondii
gb|EPS68633.1|  hypothetical protein M569_06134                         180   7e-49   Genlisea aurea
ref|XP_006371728.1|  LEUNIG family protein                              181   7e-49   
ref|XP_002284900.1|  PREDICTED: transcriptional corepressor LEUNI...    181   7e-49   Vitis vinifera
gb|KJB83314.1|  hypothetical protein B456_013G240700                    181   7e-49   Gossypium raimondii
ref|XP_004501291.1|  PREDICTED: transcriptional corepressor LEUNI...    181   8e-49   Cicer arietinum [garbanzo]
ref|XP_003603460.1|  NAD(P)H-quinone oxidoreductase subunit             181   9e-49   
ref|XP_004501290.1|  PREDICTED: transcriptional corepressor LEUNI...    181   9e-49   Cicer arietinum [garbanzo]
ref|XP_011026511.1|  PREDICTED: transcriptional corepressor LEUNI...    181   9e-49   Populus euphratica
ref|XP_011026514.1|  PREDICTED: transcriptional corepressor LEUNI...    181   9e-49   Populus euphratica
ref|XP_011026512.1|  PREDICTED: transcriptional corepressor LEUNI...    181   1e-48   Populus euphratica
ref|XP_006412457.1|  hypothetical protein EUTSA_v10024343mg             181   1e-48   Eutrema salsugineum [saltwater cress]
gb|AAG32022.1|AF277458_1  LEUNIG                                        181   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007225319.1|  hypothetical protein PRUPE_ppa001131mg             180   1e-48   
ref|XP_010447372.1|  PREDICTED: transcriptional corepressor LEUNIG      181   1e-48   Camelina sativa [gold-of-pleasure]
gb|KFK29865.1|  hypothetical protein AALP_AA7G189100                    181   1e-48   Arabis alpina [alpine rockcress]
ref|NP_567896.1|  transcriptional corepressor LEUNIG                    181   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432701.1|  PREDICTED: transcriptional corepressor LEUNI...    181   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009377500.1|  PREDICTED: transcriptional corepressor LEUNI...    179   1e-48   
ref|XP_010112086.1|  Transcriptional corepressor LEUNIG                 181   1e-48   Morus notabilis
ref|XP_009377497.1|  PREDICTED: transcriptional corepressor LEUNI...    180   1e-48   
ref|XP_009377498.1|  PREDICTED: transcriptional corepressor LEUNI...    180   2e-48   
ref|NP_001190891.1|  transcriptional corepressor LEUNIG                 180   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006581384.1|  PREDICTED: transcriptional corepressor LEUNI...    180   2e-48   Glycine max [soybeans]
ref|XP_007137062.1|  hypothetical protein PHAVU_009G096600g             180   2e-48   Phaseolus vulgaris [French bean]
ref|XP_008394022.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    180   2e-48   
ref|XP_011459234.1|  PREDICTED: transcriptional corepressor LEUNI...    179   2e-48   Fragaria vesca subsp. vesca
ref|XP_009377499.1|  PREDICTED: transcriptional corepressor LEUNI...    179   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_009377494.1|  PREDICTED: transcriptional corepressor LEUNI...    180   2e-48   
gb|KDP32298.1|  hypothetical protein JCGZ_13223                         180   2e-48   Jatropha curcas
emb|CAF18245.1|  STYLOSA protein                                        180   2e-48   Antirrhinum majus [garden snapdragon]
ref|XP_009377496.1|  PREDICTED: transcriptional corepressor LEUNI...    179   3e-48   Pyrus x bretschneideri [bai li]
ref|XP_010670737.1|  PREDICTED: transcriptional corepressor LEUNIG      179   3e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004291496.1|  PREDICTED: transcriptional corepressor LEUNI...    179   3e-48   Fragaria vesca subsp. vesca
ref|XP_010049005.1|  PREDICTED: transcriptional corepressor LEUNIG      179   3e-48   
ref|XP_007137063.1|  hypothetical protein PHAVU_009G096600g             180   3e-48   Phaseolus vulgaris [French bean]
emb|CDX68860.1|  BnaC01g05930D                                          179   4e-48   
ref|XP_002869264.1|  hypothetical protein ARALYDRAFT_491464             179   4e-48   
ref|XP_009125844.1|  PREDICTED: transcriptional corepressor LEUNI...    179   5e-48   Brassica rapa
ref|XP_009125860.1|  PREDICTED: transcriptional corepressor LEUNI...    179   6e-48   Brassica rapa
ref|XP_009125852.1|  PREDICTED: transcriptional corepressor LEUNI...    179   6e-48   Brassica rapa
emb|CDX75254.1|  BnaA01g04480D                                          179   6e-48   
ref|XP_010548472.1|  PREDICTED: transcriptional corepressor LEUNI...    178   7e-48   Tarenaya hassleriana [spider flower]
ref|XP_009138136.1|  PREDICTED: transcriptional corepressor LEUNI...    177   1e-47   Brassica rapa
ref|XP_006829639.1|  hypothetical protein AMTR_s00122p00094620          175   5e-47   Amborella trichopoda
ref|NP_001183236.1|  uncharacterized protein LOC100501624               160   1e-46   
ref|XP_009108869.1|  PREDICTED: transcriptional corepressor LEUNIG      174   1e-46   Brassica rapa
emb|CAN74631.1|  hypothetical protein VITISV_024165                     173   1e-46   Vitis vinifera
emb|CDY23331.1|  BnaA08g12150D                                          174   2e-46   Brassica napus [oilseed rape]
emb|CDY51674.1|  BnaC03g67130D                                          174   2e-46   Brassica napus [oilseed rape]
ref|XP_004969116.1|  PREDICTED: transcriptional corepressor LEUNI...    174   2e-46   Setaria italica
ref|XP_008654518.1|  PREDICTED: uncharacterized protein LOC100217...    174   3e-46   
ref|XP_002458129.1|  hypothetical protein SORBIDRAFT_03g027380          173   3e-46   Sorghum bicolor [broomcorn]
tpg|DAA58910.1|  TPA: hypothetical protein ZEAMMB73_487398              172   4e-46   
gb|EMT04689.1|  Transcriptional corepressor LEUNIG                      172   4e-46   
ref|XP_008673192.1|  PREDICTED: hypothetical protein isoform X5         173   4e-46   Zea mays [maize]
ref|XP_008673193.1|  PREDICTED: hypothetical protein isoform X6         173   4e-46   Zea mays [maize]
ref|XP_008673196.1|  PREDICTED: hypothetical protein isoform X9         173   4e-46   Zea mays [maize]
ref|NP_001169538.1|  hypothetical protein                               172   5e-46   Zea mays [maize]
ref|XP_010910871.1|  PREDICTED: transcriptional corepressor LEUNI...    170   5e-46   Elaeis guineensis
ref|XP_008673194.1|  PREDICTED: hypothetical protein isoform X7         172   5e-46   Zea mays [maize]
ref|XP_008673188.1|  PREDICTED: hypothetical protein isoform X1         172   5e-46   Zea mays [maize]
ref|XP_008673190.1|  PREDICTED: hypothetical protein isoform X3         172   5e-46   Zea mays [maize]
ref|XP_008673189.1|  PREDICTED: hypothetical protein isoform X2         172   5e-46   Zea mays [maize]
ref|XP_008673191.1|  PREDICTED: hypothetical protein isoform X4         172   5e-46   Zea mays [maize]
emb|CDM83001.1|  unnamed protein product                                172   7e-46   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010249918.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    172   7e-46   
ref|XP_006283115.1|  hypothetical protein CARUB_v10004137mg             172   8e-46   
emb|CAB43692.1|  putative protein                                       172   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010254246.1|  PREDICTED: transcriptional corepressor LEUNI...    171   2e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010254245.1|  PREDICTED: transcriptional corepressor LEUNI...    171   2e-45   Nelumbo nucifera [Indian lotus]
ref|XP_006644351.1|  PREDICTED: transcriptional corepressor LEUNI...    171   2e-45   Oryza brachyantha
gb|EMS46090.1|  Transcriptional corepressor LEUNIG                      171   2e-45   Triticum urartu
ref|NP_001043531.2|  Os01g0607400                                       171   3e-45   
dbj|BAM17634.1|  HWC1                                                   171   3e-45   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK06260.1|  predicted protein                                      169   6e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003569328.1|  PREDICTED: transcriptional corepressor LEUNI...    170   6e-45   Brachypodium distachyon [annual false brome]
ref|XP_010232006.1|  PREDICTED: transcriptional corepressor LEUNI...    170   6e-45   
ref|XP_010232005.1|  PREDICTED: transcriptional corepressor LEUNI...    170   6e-45   Brachypodium distachyon [annual false brome]
ref|XP_009407638.1|  PREDICTED: transcriptional corepressor LEUNI...    170   7e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407639.1|  PREDICTED: transcriptional corepressor LEUNI...    170   7e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010915804.1|  PREDICTED: transcriptional corepressor LEUNI...    169   1e-44   
ref|XP_010915881.1|  PREDICTED: transcriptional corepressor LEUNI...    169   1e-44   Elaeis guineensis
ref|XP_010915729.1|  PREDICTED: transcriptional corepressor LEUNI...    169   1e-44   Elaeis guineensis
ref|XP_010915657.1|  PREDICTED: transcriptional corepressor LEUNI...    169   2e-44   Elaeis guineensis
ref|XP_008811606.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    169   2e-44   
ref|XP_010527324.1|  PREDICTED: transcriptional corepressor LEUNI...    154   2e-44   
ref|XP_010688121.1|  PREDICTED: transcriptional corepressor LEUNI...    167   3e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010548471.1|  PREDICTED: transcriptional corepressor LEUNI...    168   3e-44   Tarenaya hassleriana [spider flower]
ref|XP_010688120.1|  PREDICTED: transcriptional corepressor LEUNI...    167   3e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010548470.1|  PREDICTED: transcriptional corepressor LEUNI...    168   3e-44   Tarenaya hassleriana [spider flower]
ref|XP_009403020.1|  PREDICTED: transcriptional corepressor LEUNI...    167   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403018.1|  PREDICTED: transcriptional corepressor LEUNI...    167   4e-44   
ref|XP_004969117.1|  PREDICTED: transcriptional corepressor LEUNI...    167   5e-44   
ref|XP_002962710.1|  hypothetical protein SELMODRAFT_79275              167   5e-44   
ref|XP_002980381.1|  hypothetical protein SELMODRAFT_112245             167   6e-44   
gb|KJB64845.1|  hypothetical protein B456_010G067800                    167   6e-44   Gossypium raimondii
gb|KJB64846.1|  hypothetical protein B456_010G067800                    167   6e-44   Gossypium raimondii
ref|XP_010925121.1|  PREDICTED: transcriptional corepressor LEUNI...    167   8e-44   Elaeis guineensis
emb|CDY13494.1|  BnaA03g52120D                                          166   1e-43   Brassica napus [oilseed rape]
ref|XP_010925120.1|  PREDICTED: transcriptional corepressor LEUNI...    166   1e-43   Elaeis guineensis
ref|XP_009784360.1|  PREDICTED: transcriptional corepressor LEUNI...    160   1e-43   Nicotiana sylvestris
ref|XP_009405103.1|  PREDICTED: transcriptional corepressor LEUNI...    166   1e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405109.1|  PREDICTED: transcriptional corepressor LEUNI...    166   1e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405115.1|  PREDICTED: transcriptional corepressor LEUNI...    166   1e-43   
ref|XP_009784357.1|  PREDICTED: transcriptional corepressor LEUNI...    160   1e-43   Nicotiana sylvestris
ref|XP_010656383.1|  PREDICTED: transcriptional corepressor LEUNI...    166   2e-43   Vitis vinifera
ref|XP_010656382.1|  PREDICTED: transcriptional corepressor LEUNI...    166   2e-43   Vitis vinifera
gb|KDO80402.1|  hypothetical protein CISIN_1g003177mg                   162   2e-43   Citrus sinensis [apfelsine]
ref|XP_002458130.1|  hypothetical protein SORBIDRAFT_03g027390          164   2e-43   
ref|XP_009371420.1|  PREDICTED: transcriptional corepressor LEUNI...    164   4e-43   
ref|XP_009371419.1|  PREDICTED: transcriptional corepressor LEUNI...    164   4e-43   Pyrus x bretschneideri [bai li]
gb|EEE54961.1|  hypothetical protein OsJ_02550                          164   4e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010533194.1|  PREDICTED: transcriptional corepressor LEUNI...    164   4e-43   
gb|EEC71055.1|  hypothetical protein OsI_02792                          164   5e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_008242693.1|  PREDICTED: transcriptional corepressor LEUNI...    164   6e-43   Prunus mume [ume]
ref|XP_008242692.1|  PREDICTED: transcriptional corepressor LEUNI...    164   6e-43   Prunus mume [ume]
gb|KDP32334.1|  hypothetical protein JCGZ_13259                         163   1e-42   Jatropha curcas
gb|KDO80401.1|  hypothetical protein CISIN_1g003177mg                   162   1e-42   Citrus sinensis [apfelsine]
gb|KDO80397.1|  hypothetical protein CISIN_1g003177mg                   162   1e-42   Citrus sinensis [apfelsine]
gb|KDO80400.1|  hypothetical protein CISIN_1g003177mg                   161   2e-42   Citrus sinensis [apfelsine]
ref|XP_002969651.1|  hypothetical protein SELMODRAFT_410492             162   2e-42   Selaginella moellendorffii
ref|XP_008386062.1|  PREDICTED: transcriptional corepressor LEUNI...    162   2e-42   
gb|KDO80394.1|  hypothetical protein CISIN_1g003177mg                   162   2e-42   Citrus sinensis [apfelsine]
ref|XP_009400486.1|  PREDICTED: transcriptional corepressor LEUNI...    162   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008386053.1|  PREDICTED: transcriptional corepressor LEUNI...    162   3e-42   
ref|XP_008386048.1|  PREDICTED: transcriptional corepressor LEUNI...    162   3e-42   
ref|NP_001053284.1|  Os04g0510200                                       157   3e-42   
gb|KDO80398.1|  hypothetical protein CISIN_1g003177mg                   161   3e-42   Citrus sinensis [apfelsine]
ref|XP_011458499.1|  PREDICTED: transcriptional corepressor LEUNI...    162   3e-42   Fragaria vesca subsp. vesca
ref|XP_004287384.1|  PREDICTED: transcriptional corepressor LEUNI...    162   3e-42   Fragaria vesca subsp. vesca
ref|XP_007013298.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    160   3e-42   
ref|XP_002970913.1|  hypothetical protein SELMODRAFT_94317              162   3e-42   
ref|XP_002266172.1|  PREDICTED: transcriptional corepressor LEUNI...    161   4e-42   Vitis vinifera
ref|XP_010652506.1|  PREDICTED: transcriptional corepressor LEUNI...    161   4e-42   Vitis vinifera
ref|XP_006475763.1|  PREDICTED: transcriptional corepressor LEUNI...    162   4e-42   Citrus sinensis [apfelsine]
gb|KDO80395.1|  hypothetical protein CISIN_1g003177mg                   162   4e-42   Citrus sinensis [apfelsine]
ref|XP_006451037.1|  hypothetical protein CICLE_v10007449mg             162   4e-42   Citrus clementina [clementine]
gb|KDO80396.1|  hypothetical protein CISIN_1g003177mg                   162   4e-42   Citrus sinensis [apfelsine]
ref|XP_006475762.1|  PREDICTED: transcriptional corepressor LEUNI...    162   4e-42   Citrus sinensis [apfelsine]
ref|XP_010264093.1|  PREDICTED: transcriptional corepressor LEUNI...    160   7e-42   Nelumbo nucifera [Indian lotus]
gb|KJB10968.1|  hypothetical protein B456_001G234100                    160   7e-42   Gossypium raimondii
gb|KJB10964.1|  hypothetical protein B456_001G234100                    160   8e-42   Gossypium raimondii
ref|XP_010684998.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    160   9e-42   
ref|XP_010532885.1|  PREDICTED: transcriptional corepressor LEUNI...    160   1e-41   Tarenaya hassleriana [spider flower]
gb|KHG14548.1|  Transcriptional corepressor LEUNIG -like protein        159   1e-41   Gossypium arboreum [tree cotton]
ref|XP_010532887.1|  PREDICTED: transcriptional corepressor LEUNI...    160   1e-41   Tarenaya hassleriana [spider flower]
ref|XP_010245981.1|  PREDICTED: transcriptional corepressor LEUNI...    160   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010934267.1|  PREDICTED: transcriptional corepressor LEUNI...    160   1e-41   Elaeis guineensis
ref|XP_007013296.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    160   1e-41   
ref|XP_010934265.1|  PREDICTED: transcriptional corepressor LEUNI...    160   1e-41   Elaeis guineensis
ref|XP_006352696.1|  PREDICTED: transcriptional corepressor LEUNI...    160   1e-41   Solanum tuberosum [potatoes]
ref|XP_008802409.1|  PREDICTED: transcriptional corepressor LEUNI...    160   1e-41   Phoenix dactylifera
ref|XP_008802406.1|  PREDICTED: transcriptional corepressor LEUNI...    160   1e-41   Phoenix dactylifera
gb|KJB10967.1|  hypothetical protein B456_001G234100                    159   1e-41   Gossypium raimondii
gb|KJB10969.1|  hypothetical protein B456_001G234100                    159   1e-41   Gossypium raimondii
ref|XP_004242402.1|  PREDICTED: transcriptional corepressor LEUNI...    159   1e-41   
ref|XP_010245980.1|  PREDICTED: transcriptional corepressor LEUNI...    159   1e-41   Nelumbo nucifera [Indian lotus]
gb|KJB10963.1|  hypothetical protein B456_001G234100                    159   2e-41   Gossypium raimondii
ref|XP_010245979.1|  PREDICTED: transcriptional corepressor LEUNI...    159   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_009760188.1|  PREDICTED: transcriptional corepressor LEUNIG      159   2e-41   Nicotiana sylvestris
ref|XP_008789440.1|  PREDICTED: transcriptional corepressor LEUNIG      159   2e-41   Phoenix dactylifera
gb|KJB10965.1|  hypothetical protein B456_001G234100                    159   2e-41   Gossypium raimondii
ref|XP_010245978.1|  PREDICTED: transcriptional corepressor LEUNI...    159   2e-41   Nelumbo nucifera [Indian lotus]
emb|CAF18246.1|  STY-L protein                                          159   2e-41   Antirrhinum majus [garden snapdragon]
ref|XP_009611891.1|  PREDICTED: transcriptional corepressor LEUNI...    159   2e-41   Nicotiana tomentosiformis
ref|XP_007013297.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    159   2e-41   
dbj|BAK08332.1|  predicted protein                                      160   3e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004247088.1|  PREDICTED: transcriptional corepressor LEUNI...    159   3e-41   Solanum lycopersicum
ref|XP_006356768.1|  PREDICTED: transcriptional corepressor LEUNI...    159   3e-41   Solanum tuberosum [potatoes]
ref|XP_006857440.1|  hypothetical protein AMTR_s00067p00167320          159   3e-41   
ref|XP_009382685.1|  PREDICTED: transcriptional corepressor LEUNI...    159   4e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382681.1|  PREDICTED: transcriptional corepressor LEUNI...    159   4e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008785188.1|  PREDICTED: transcriptional corepressor LEUNI...    159   4e-41   
ref|XP_009389935.1|  PREDICTED: transcriptional corepressor LEUNI...    158   4e-41   
ref|XP_008785186.1|  PREDICTED: transcriptional corepressor LEUNI...    159   4e-41   
ref|XP_008785183.1|  PREDICTED: transcriptional corepressor LEUNI...    159   4e-41   
ref|XP_011083129.1|  PREDICTED: transcriptional corepressor LEUNI...    158   4e-41   Sesamum indicum [beniseed]
ref|XP_010940736.1|  PREDICTED: transcriptional corepressor LEUNI...    158   5e-41   Elaeis guineensis
ref|XP_010232007.1|  PREDICTED: transcriptional corepressor LEUNI...    159   5e-41   Brachypodium distachyon [annual false brome]
ref|XP_006652501.1|  PREDICTED: transcriptional corepressor LEUNI...    158   5e-41   
ref|XP_010940735.1|  PREDICTED: transcriptional corepressor LEUNI...    158   5e-41   
gb|EEC70037.1|  hypothetical protein OsI_00622                          159   5e-41   
ref|XP_011080189.1|  PREDICTED: transcriptional corepressor LEUNI...    158   5e-41   
ref|XP_010940734.1|  PREDICTED: transcriptional corepressor LEUNI...    158   5e-41   
ref|XP_010940733.1|  PREDICTED: transcriptional corepressor LEUNI...    158   5e-41   
ref|XP_009374058.1|  PREDICTED: transcriptional corepressor LEUNI...    159   5e-41   
ref|XP_010940732.1|  PREDICTED: transcriptional corepressor LEUNI...    158   5e-41   
ref|XP_007049791.1|  WD-repeat protein isoform 2                        158   6e-41   
ref|XP_007049790.1|  WD-repeat protein isoform 1                        158   6e-41   
emb|CDP03866.1|  unnamed protein product                                158   6e-41   
ref|XP_008337349.1|  PREDICTED: transcriptional corepressor LEUNI...    158   6e-41   
ref|XP_008337351.1|  PREDICTED: transcriptional corepressor LEUNI...    158   6e-41   
ref|XP_008337347.1|  PREDICTED: transcriptional corepressor LEUNI...    158   7e-41   
ref|XP_008337350.1|  PREDICTED: transcriptional corepressor LEUNI...    158   7e-41   
gb|EPS70716.1|  hypothetical protein M569_04039                         157   8e-41   
ref|XP_009620776.1|  PREDICTED: transcriptional corepressor LEUNI...    157   8e-41   
ref|XP_010526192.1|  PREDICTED: transcriptional corepressor LEUNI...    158   1e-40   
gb|KHG11579.1|  Transcriptional corepressor LEUNIG -like protein        157   1e-40   
ref|XP_008235489.1|  PREDICTED: transcriptional corepressor LEUNI...    157   2e-40   
emb|CAE03368.2|  OSJNBb0065L13.11                                       157   2e-40   
ref|XP_007201209.1|  hypothetical protein PRUPE_ppa001687mg             156   2e-40   
ref|NP_001048487.1|  Os02g0813800                                       157   2e-40   
gb|EEC74226.1|  hypothetical protein OsI_09411                          157   2e-40   
ref|XP_004954332.1|  PREDICTED: transcriptional corepressor LEUNI...    156   2e-40   
gb|KDP26395.1|  hypothetical protein JCGZ_17553                         156   2e-40   
dbj|BAD67819.1|  putative transcriptional corepressor LEUNIG            157   3e-40   
ref|XP_003570372.1|  PREDICTED: transcriptional corepressor LEUNIG      156   3e-40   
ref|XP_002454764.1|  hypothetical protein SORBIDRAFT_04g036910          156   3e-40   
ref|XP_004954333.1|  PREDICTED: transcriptional corepressor LEUNI...    156   3e-40   
ref|XP_009334933.1|  PREDICTED: transcriptional corepressor LEUNI...    156   3e-40   
gb|EEC77619.1|  hypothetical protein OsI_16603                          156   3e-40   
gb|KHG03492.1|  Transcriptional corepressor LEUNIG -like protein        155   4e-40   
emb|CDY23795.1|  BnaC04g43270D                                          144   4e-40   
ref|XP_002521103.1|  WD-repeat protein, putative                        155   4e-40   
gb|KJB42455.1|  hypothetical protein B456_007G154000                    155   4e-40   
gb|KJB42458.1|  hypothetical protein B456_007G154000                    155   4e-40   
ref|XP_004290216.1|  PREDICTED: transcriptional corepressor LEUNI...    155   4e-40   
ref|XP_009371604.1|  PREDICTED: transcriptional corepressor LEUNI...    155   4e-40   
gb|KJB42457.1|  hypothetical protein B456_007G154000                    155   5e-40   
gb|KJB42456.1|  hypothetical protein B456_007G154000                    155   5e-40   
ref|XP_008796439.1|  PREDICTED: transcriptional corepressor LEUNI...    154   5e-40   
ref|XP_006479291.1|  PREDICTED: transcriptional corepressor LEUNI...    155   5e-40   
gb|KJB30150.1|  hypothetical protein B456_005G131200                    152   5e-40   
ref|XP_010936006.1|  PREDICTED: transcriptional corepressor LEUNI...    154   5e-40   
gb|KDO65918.1|  hypothetical protein CISIN_1g047260mg                   155   5e-40   
ref|XP_006443612.1|  hypothetical protein CICLE_v10023309mg             155   5e-40   
ref|XP_006479288.1|  PREDICTED: transcriptional corepressor LEUNI...    155   6e-40   
ref|XP_003622929.1|  Transcriptional corepressor LEUNIG                 155   6e-40   
ref|XP_006479286.1|  PREDICTED: transcriptional corepressor LEUNI...    155   6e-40   
gb|EEE53974.1|  hypothetical protein OsJ_00592                          155   6e-40   
ref|XP_006479287.1|  PREDICTED: transcriptional corepressor LEUNI...    155   6e-40   
ref|XP_010936004.1|  PREDICTED: transcriptional corepressor LEUNI...    154   7e-40   
emb|CAN76829.1|  hypothetical protein VITISV_002025                     156   7e-40   
ref|XP_011024692.1|  PREDICTED: transcriptional corepressor LEUNI...    154   1e-39   
ref|XP_011024691.1|  PREDICTED: transcriptional corepressor LEUNI...    154   1e-39   
ref|XP_011024689.1|  PREDICTED: transcriptional corepressor LEUNI...    154   1e-39   
ref|XP_003622927.1|  WD-40 repeat-containing protein                    154   1e-39   
ref|XP_008643802.1|  PREDICTED: LOC100285175 isoform X1                 154   1e-39   
ref|NP_001151541.1|  LOC100285175                                       154   1e-39   
ref|XP_010936003.1|  PREDICTED: transcriptional corepressor LEUNI...    154   1e-39   
ref|XP_010936002.1|  PREDICTED: transcriptional corepressor LEUNI...    154   1e-39   
gb|KJB30149.1|  hypothetical protein B456_005G131200                    152   1e-39   
ref|XP_010936000.1|  PREDICTED: transcriptional corepressor LEUNI...    154   2e-39   
ref|XP_007034394.1|  LEUNIG_homolog isoform 4                           152   2e-39   
ref|XP_002301780.1|  WD-40 repeat family protein                        154   2e-39   
emb|CAN73936.1|  hypothetical protein VITISV_026282                     154   2e-39   
gb|KCW81476.1|  hypothetical protein EUGRSUZ_C028381                    154   2e-39   
gb|KCW81471.1|  hypothetical protein EUGRSUZ_C028381                    154   3e-39   
ref|XP_006643822.1|  PREDICTED: transcriptional corepressor LEUNI...    154   3e-39   
gb|KCW81469.1|  hypothetical protein EUGRSUZ_C028381                    154   3e-39   
gb|EYU46334.1|  hypothetical protein MIMGU_mgv1a001624mg                153   3e-39   
gb|KCW81467.1|  hypothetical protein EUGRSUZ_C028381                    154   3e-39   
gb|KCW81465.1|  hypothetical protein EUGRSUZ_C028381                    154   4e-39   
ref|XP_009385699.1|  PREDICTED: transcriptional corepressor LEUNI...    153   4e-39   
gb|KDP39380.1|  hypothetical protein JCGZ_01137                         153   5e-39   
ref|XP_006586253.1|  PREDICTED: transcriptional corepressor LEUNI...    152   5e-39   
ref|XP_006586254.1|  PREDICTED: transcriptional corepressor LEUNI...    152   5e-39   
ref|XP_010109725.1|  Transcriptional corepressor LEUNIG                 152   6e-39   
ref|XP_007221910.1|  hypothetical protein PRUPE_ppa001706mg             151   1e-38   
ref|XP_008224605.1|  PREDICTED: transcriptional corepressor LEUNIG      151   1e-38   
ref|XP_007034393.1|  LEUNIG_homolog isoform 3                           150   2e-38   
ref|XP_003552134.1|  PREDICTED: transcriptional corepressor LEUNI...    151   2e-38   
ref|XP_006602529.1|  PREDICTED: transcriptional corepressor LEUNI...    151   2e-38   
ref|XP_006602530.1|  PREDICTED: transcriptional corepressor LEUNI...    150   2e-38   
dbj|BAK05188.1|  predicted protein                                      151   2e-38   
ref|XP_006575161.1|  PREDICTED: transcriptional corepressor LEUNI...    150   2e-38   
ref|XP_002518113.1|  WD-repeat protein, putative                        150   2e-38   
ref|XP_008380581.1|  PREDICTED: transcriptional corepressor LEUNI...    150   3e-38   
gb|EMT21967.1|  hypothetical protein F775_27935                         150   3e-38   
ref|XP_010107758.1|  Transcriptional corepressor LEUNIG                 150   3e-38   
ref|XP_007145511.1|  hypothetical protein PHAVU_007G244700g             150   3e-38   
ref|XP_009334934.1|  PREDICTED: transcriptional corepressor LEUNI...    150   3e-38   
ref|XP_007140593.1|  hypothetical protein PHAVU_008G125400g             150   4e-38   
ref|XP_003518997.1|  PREDICTED: transcriptional corepressor LEUNI...    150   4e-38   
ref|XP_006588996.1|  PREDICTED: transcriptional corepressor LEUNI...    150   4e-38   
ref|XP_006588998.1|  PREDICTED: transcriptional corepressor LEUNI...    150   4e-38   
ref|XP_006575159.1|  PREDICTED: transcriptional corepressor LEUNI...    150   4e-38   
ref|XP_006588997.1|  PREDICTED: transcriptional corepressor LEUNI...    150   4e-38   
ref|XP_006588999.1|  PREDICTED: transcriptional corepressor LEUNI...    150   4e-38   
ref|XP_006575158.1|  PREDICTED: transcriptional corepressor LEUNI...    150   4e-38   
ref|XP_006575160.1|  PREDICTED: transcriptional corepressor LEUNI...    150   4e-38   
ref|XP_007034391.1|  LEUNIG_homolog isoform 1                           150   4e-38   
ref|XP_008382635.1|  PREDICTED: transcriptional corepressor LEUNI...    150   4e-38   
emb|CDM81840.1|  unnamed protein product                                150   5e-38   
ref|XP_004171264.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    149   5e-38   
gb|KJB72103.1|  hypothetical protein B456_011G159400                    150   6e-38   
gb|KJB30142.1|  hypothetical protein B456_005G131200                    148   6e-38   
ref|XP_003590232.1|  Transcriptional corepressor LEUNIG                 150   6e-38   
ref|XP_003607636.1|  Transcriptional corepressor LEUNIG                 150   6e-38   
ref|XP_008438370.1|  PREDICTED: transcriptional corepressor LEUNI...    149   6e-38   
ref|XP_003607635.1|  Transcriptional corepressor LEUNIG                 150   6e-38   
gb|KJB72102.1|  hypothetical protein B456_011G159400                    149   6e-38   
gb|EMS61864.1|  Transcriptional corepressor LEUNIG                      150   6e-38   
ref|XP_008438369.1|  PREDICTED: transcriptional corepressor LEUNI...    149   6e-38   
emb|CDY12183.1|  BnaC04g12130D                                          148   6e-38   
ref|XP_004134000.1|  PREDICTED: transcriptional corepressor LEUNI...    149   6e-38   
ref|XP_006838727.1|  hypothetical protein AMTR_s00002p00252820          150   6e-38   
ref|XP_010920380.1|  PREDICTED: transcriptional corepressor LEUNI...    148   7e-38   
ref|XP_006385922.1|  hypothetical protein POPTR_0003s17700g             149   8e-38   
gb|KJB30143.1|  hypothetical protein B456_005G131200                    149   8e-38   
ref|XP_009374610.1|  PREDICTED: transcriptional corepressor LEUNI...    149   9e-38   
ref|XP_004517073.1|  PREDICTED: transcriptional corepressor LEUNI...    149   9e-38   
ref|XP_009374609.1|  PREDICTED: transcriptional corepressor LEUNI...    149   9e-38   
ref|XP_004517071.1|  PREDICTED: transcriptional corepressor LEUNI...    149   9e-38   
ref|XP_004517070.1|  PREDICTED: transcriptional corepressor LEUNI...    149   9e-38   
ref|XP_004517072.1|  PREDICTED: transcriptional corepressor LEUNI...    149   9e-38   
ref|XP_004517069.1|  PREDICTED: transcriptional corepressor LEUNI...    149   9e-38   
gb|KJB72108.1|  hypothetical protein B456_011G159400                    149   1e-37   
ref|XP_004517067.1|  PREDICTED: transcriptional corepressor LEUNI...    149   1e-37   
emb|CDY69439.1|  BnaA05g35120D                                          149   1e-37   
ref|XP_002299273.1|  hypothetical protein POPTR_0001s14560g             149   1e-37   
ref|NP_001042184.1|  Os01g0177100                                       149   1e-37   
ref|XP_006368907.1|  hypothetical protein POPTR_0001s14560g             149   1e-37   
ref|XP_009143945.1|  PREDICTED: transcriptional corepressor LEUNI...    149   1e-37   
ref|XP_009143947.1|  PREDICTED: transcriptional corepressor LEUNI...    149   1e-37   
ref|NP_565749.1|  WD40 repeat protein MUCILAGE-MODIFIED 1               149   2e-37   
ref|NP_001031466.2|  WD40 repeat protein MUCILAGE-MODIFIED 1            148   2e-37   
ref|XP_010526193.1|  PREDICTED: transcriptional corepressor LEUNI...    149   2e-37   
ref|NP_001189659.1|  WD40 repeat protein MUCILAGE-MODIFIED 1            148   2e-37   
gb|KJB30139.1|  hypothetical protein B456_005G131200                    148   2e-37   
ref|XP_010522421.1|  PREDICTED: transcriptional corepressor LEUNI...    148   2e-37   
ref|XP_010522422.1|  PREDICTED: transcriptional corepressor LEUNI...    148   2e-37   
gb|KJB30141.1|  hypothetical protein B456_005G131200                    148   2e-37   
gb|KJB30138.1|  hypothetical protein B456_005G131200                    148   2e-37   
gb|KHG05392.1|  Transcriptional corepressor LEUNIG -like protein        148   2e-37   
gb|KHG01358.1|  Transcriptional corepressor LEUNIG -like protein        147   2e-37   
ref|XP_004296628.1|  PREDICTED: transcriptional corepressor LEUNIG      147   4e-37   
ref|XP_006410398.1|  hypothetical protein EUTSA_v10016303mg             147   4e-37   
emb|CDX79469.1|  BnaC03g18050D                                          148   5e-37   
ref|XP_011020662.1|  PREDICTED: transcriptional corepressor LEUNI...    147   7e-37   
ref|XP_010254244.1|  PREDICTED: transcriptional corepressor LEUNI...    147   7e-37   
ref|XP_006295571.1|  hypothetical protein CARUB_v10024675mg             147   7e-37   
ref|XP_010254242.1|  PREDICTED: transcriptional corepressor LEUNI...    147   8e-37   
ref|XP_010469558.1|  PREDICTED: transcriptional corepressor LEUNI...    146   9e-37   
ref|XP_010469560.1|  PREDICTED: transcriptional corepressor LEUNI...    146   9e-37   
ref|XP_010469555.1|  PREDICTED: transcriptional corepressor LEUNI...    146   9e-37   
ref|XP_010254243.1|  PREDICTED: transcriptional corepressor LEUNI...    147   9e-37   
ref|XP_010469559.1|  PREDICTED: transcriptional corepressor LEUNI...    146   9e-37   
ref|XP_009132864.1|  PREDICTED: transcriptional corepressor LEUNI...    146   1e-36   
ref|XP_009132865.1|  PREDICTED: transcriptional corepressor LEUNI...    146   1e-36   
ref|XP_010509986.1|  PREDICTED: transcriptional corepressor LEUNI...    146   1e-36   
ref|XP_010509985.1|  PREDICTED: transcriptional corepressor LEUNI...    146   1e-36   
ref|XP_010509984.1|  PREDICTED: transcriptional corepressor LEUNI...    146   1e-36   
ref|XP_010509979.1|  PREDICTED: transcriptional corepressor LEUNI...    146   1e-36   
ref|XP_010069048.1|  PREDICTED: transcriptional corepressor LEUNIG      146   1e-36   
ref|XP_002879407.1|  WD-40 repeat family protein                        145   2e-36   
emb|CDX84727.1|  BnaA03g15030D                                          147   2e-36   
gb|KHN15508.1|  Transcriptional corepressor LEUNIG                      146   2e-36   
ref|XP_009387170.1|  PREDICTED: transcriptional corepressor LEUNI...    146   2e-36   
ref|XP_008380580.1|  PREDICTED: transcriptional corepressor LEUNI...    145   2e-36   
ref|XP_008380582.1|  PREDICTED: transcriptional corepressor LEUNI...    145   2e-36   
ref|XP_004492304.1|  PREDICTED: transcriptional corepressor LEUNI...    144   7e-36   
ref|XP_004492306.1|  PREDICTED: transcriptional corepressor LEUNI...    144   8e-36   
ref|XP_004492305.1|  PREDICTED: transcriptional corepressor LEUNI...    144   8e-36   
ref|XP_006493704.1|  PREDICTED: transcriptional corepressor LEUNI...    143   1e-35   
ref|XP_006493701.1|  PREDICTED: transcriptional corepressor LEUNI...    143   1e-35   
ref|XP_006420877.1|  hypothetical protein CICLE_v10004358mg             143   1e-35   
ref|XP_006420876.1|  hypothetical protein CICLE_v10004358mg             143   1e-35   
ref|XP_010230532.1|  PREDICTED: transcriptional corepressor LEUNI...    143   1e-35   
gb|KJB64849.1|  hypothetical protein B456_010G067800                    142   3e-35   
gb|EMS54829.1|  Transcriptional corepressor LEUNIG                      142   4e-35   
gb|KJB64847.1|  hypothetical protein B456_010G067800                    141   7e-35   
gb|ACZ98534.1|  LisH-SSDP-WD40                                          141   8e-35   
gb|KJB64848.1|  hypothetical protein B456_010G067800                    141   8e-35   
gb|EMT14678.1|  Transcriptional corepressor LEUNIG                      141   1e-34   
ref|XP_006855982.1|  hypothetical protein AMTR_s00037p00238300          134   1e-34   
ref|XP_004968403.1|  PREDICTED: transcriptional corepressor LEUNI...    141   1e-34   
ref|XP_007154937.1|  hypothetical protein PHAVU_003G159500g             137   8e-34   
ref|XP_007154936.1|  hypothetical protein PHAVU_003G159500g             137   2e-33   
gb|KHN07186.1|  Transcriptional corepressor LEUNIG                      136   4e-33   
gb|KHN27387.1|  Transcriptional corepressor LEUNIG                      135   7e-33   
ref|XP_003525653.1|  PREDICTED: transcriptional corepressor LEUNI...    135   7e-33   
ref|XP_010098951.1|  Transcriptional corepressor LEUNIG                 135   8e-33   
gb|KHN09543.1|  Transcriptional corepressor LEUNIG                      135   1e-32   
ref|XP_008655678.1|  PREDICTED: transcriptional corepressor LEUNI...    135   1e-32   
ref|XP_002457248.1|  hypothetical protein SORBIDRAFT_03g004050          126   2e-32   
ref|XP_006600770.1|  PREDICTED: transcriptional corepressor LEUNI...    132   1e-31   
ref|XP_006600769.1|  PREDICTED: transcriptional corepressor LEUNI...    132   2e-31   
gb|EEC76587.1|  hypothetical protein OsI_14435                          123   1e-30   
ref|NP_001172457.1|  Os01g0607600                                       129   1e-30   
gb|EEE54962.1|  hypothetical protein OsJ_02551                          129   1e-30   
ref|XP_006600771.1|  PREDICTED: transcriptional corepressor LEUNI...    129   2e-30   
ref|XP_010228693.1|  PREDICTED: transcriptional corepressor LEUNI...    129   2e-30   
ref|XP_010228669.1|  PREDICTED: transcriptional corepressor LEUNI...    129   2e-30   
gb|EYU17986.1|  hypothetical protein MIMGU_mgv1a001888mg                128   2e-30   
ref|XP_008655679.1|  PREDICTED: transcriptional corepressor LEUNI...    128   2e-30   
ref|XP_008655677.1|  PREDICTED: transcriptional corepressor LEUNI...    128   3e-30   
gb|KCW82772.1|  hypothetical protein EUGRSUZ_C04148                     125   8e-30   
ref|NP_001051976.1|  Os03g0860900                                       125   2e-29   
gb|AAP44756.1|  putative WD repeat protein                              125   2e-29   
gb|KJB10966.1|  hypothetical protein B456_001G234100                    125   2e-29   
gb|EEC76589.1|  hypothetical protein OsI_14437                          125   2e-29   
ref|XP_010049942.1|  PREDICTED: transcriptional corepressor LEUNI...    124   3e-29   
ref|XP_004980954.1|  PREDICTED: transcriptional corepressor LEUNI...    124   4e-29   
ref|XP_009132867.1|  PREDICTED: transcriptional corepressor LEUNI...    122   4e-29   
ref|XP_009132866.1|  PREDICTED: transcriptional corepressor LEUNI...    122   4e-29   
gb|EMT26206.1|  hypothetical protein F775_06650                         123   1e-28   
ref|NP_001151595.1|  LOC100285229                                       123   1e-28   
gb|EMS55059.1|  Transcriptional corepressor LEUNIG                      123   1e-28   
gb|KJB64850.1|  hypothetical protein B456_010G067800                    123   2e-28   



>ref|XP_006382069.1| hypothetical protein POPTR_0006s26420g [Populus trichocarpa]
 gb|ERP59866.1| hypothetical protein POPTR_0006s26420g [Populus trichocarpa]
Length=603

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLLKAR  87


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNG  NG+VGND L+RQN   A A++ K Y E+LKL
Sbjct  151  RRDGAHLLNGAANGLVGNDPLMRQNTATANAMATKMYEEKLKL  193



>emb|CDX72363.1| BnaC07g43850D [Brassica napus]
Length=159

 Score =   172 bits (437),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ++K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMIKAR  87



>ref|XP_006382068.1| hypothetical protein POPTR_0006s26420g [Populus trichocarpa]
 gb|ERP59865.1| hypothetical protein POPTR_0006s26420g [Populus trichocarpa]
Length=612

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLLKAR  87


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNG  NG+VGND L+RQN   A A++ K Y E+LKL
Sbjct  151  RRDGAHLLNGAANGLVGNDPLMRQNTATANAMATKMYEEKLKL  193



>gb|KJB83316.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=645

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG  NG+VGNDSLIRQ  G A A++ K Y ERLKL
Sbjct  189  RRDGSHLLNGNTNGLVGNDSLIRQPAGTANAMATKMYEERLKL  231



>gb|KJB83317.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=654

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG  NG+VGNDSLIRQ  G A A++ K Y ERLKL
Sbjct  189  RRDGSHLLNGNTNGLVGNDSLIRQPAGTANAMATKMYEERLKL  231



>ref|XP_010322742.1| PREDICTED: transcriptional corepressor LEUNIG isoform X4 [Solanum 
lycopersicum]
Length=896

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQIMKAR  87


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERL  619
            RRDG++LLNGT NG+ G+DSL+RQN G A AL+ K Y ERL
Sbjct  157  RRDGNHLLNGTTNGIGGSDSLLRQNTGTANALATKMYEERL  197



>ref|XP_010322743.1| PREDICTED: transcriptional corepressor LEUNIG isoform X5 [Solanum 
lycopersicum]
Length=894

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQIMKAR  87


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERL  619
            RRDG++LLNGT NG+ G+DSL+RQN G A AL+ K Y ERL
Sbjct  157  RRDGNHLLNGTTNGIGGSDSLLRQNTGTANALATKMYEERL  197



>gb|KGN62903.1| hypothetical protein Csa_2G379340 [Cucumis sativus]
Length=838

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPGA-XALSAKAYXERLKL  625
            RRDG+ LLNG+ NG VGND L+RQNPG+  AL+ K Y +RLKL
Sbjct  151  RRDGAQLLNGSSNGFVGNDPLMRQNPGSVNALATKMYEDRLKL  193



>ref|XP_006353653.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Solanum tuberosum]
Length=898

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQIMKAR  87



>ref|XP_009624260.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Nicotiana 
tomentosiformis]
Length=896

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQIMKAR  87


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERL  619
            RRDG++LLNGT NG+VGNDSL+RQNPG A AL+ K Y ERL
Sbjct  164  RRDGNHLLNGTTNGIVGNDSLLRQNPGTANALATKMYEERL  204



>ref|XP_006353652.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Solanum tuberosum]
Length=900

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQIMKAR  87



>ref|XP_009787198.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Nicotiana 
sylvestris]
Length=892

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQIMKAR  87


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +2

Query  503  RDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERL  619
            RDG++LLNGT NG+VGNDSL+RQNPG A AL+ K Y ERL
Sbjct  157  RDGNHLLNGTTNGIVGNDSLLRQNPGTANALATKMYEERL  196



>ref|XP_002515594.1| hypothetical protein RCOM_0927510 [Ricinus communis]
 gb|EEF47043.1| hypothetical protein RCOM_0927510 [Ricinus communis]
Length=112

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVRG  304
            DIFIARTN+KHS+VAASYIE  ++   G
Sbjct  61   DIFIARTNEKHSEVAASYIEALIVHDEG  88



>ref|XP_004241804.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Solanum 
lycopersicum]
Length=902

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQIMKAR  87


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERL  619
            RRDG++LLNGT NG+ G+DSL+RQN G A AL+ K Y ERL
Sbjct  157  RRDGNHLLNGTTNGIGGSDSLLRQNTGTANALATKMYEERL  197



>ref|XP_010322741.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Solanum 
lycopersicum]
Length=899

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQIMKAR  87


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERL  619
            RRDG++LLNGT NG+ G+DSL+RQN G A AL+ K Y ERL
Sbjct  157  RRDGNHLLNGTTNGIGGSDSLLRQNTGTANALATKMYEERL  197



>ref|XP_010322740.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Solanum 
lycopersicum]
Length=904

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQIMKAR  87


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERL  619
            RRDG++LLNGT NG+ G+DSL+RQN G A AL+ K Y ERL
Sbjct  157  RRDGNHLLNGTTNGIGGSDSLLRQNTGTANALATKMYEERL  197



>ref|XP_009624257.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Nicotiana 
tomentosiformis]
Length=904

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQIMKAR  87


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERL  619
            RRDG++LLNGT NG+VGNDSL+RQNPG A AL+ K Y ERL
Sbjct  164  RRDGNHLLNGTTNGIVGNDSLLRQNPGTANALATKMYEERL  204



>gb|EPS65391.1| hypothetical protein M569_09387, partial [Genlisea aurea]
Length=542

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAF +E KVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFLSEAKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQLMK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLMKTR  87



>ref|XP_006353651.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Solanum tuberosum]
Length=906

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQIMKAR  87



>ref|XP_009624258.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Nicotiana 
tomentosiformis]
Length=899

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQIMKAR  87


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERL  619
            RRDG++LLNGT NG+VGNDSL+RQNPG A AL+ K Y ERL
Sbjct  164  RRDGNHLLNGTTNGIVGNDSLLRQNPGTANALATKMYEERL  204



>ref|XP_006353650.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Solanum tuberosum]
Length=908

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQIMKAR  87



>ref|XP_009787196.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Nicotiana 
sylvestris]
Length=900

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQIMKAR  87


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +2

Query  503  RDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERL  619
            RDG++LLNGT NG+VGNDSL+RQNPG A AL+ K Y ERL
Sbjct  157  RDGNHLLNGTTNGIVGNDSLLRQNPGTANALATKMYEERL  196



>ref|XP_009787197.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Nicotiana 
sylvestris]
Length=895

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQIMKAR  87


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +2

Query  503  RDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERL  619
            RDG++LLNGT NG+VGNDSL+RQNPG A AL+ K Y ERL
Sbjct  157  RDGNHLLNGTTNGIVGNDSLLRQNPGTANALATKMYEERL  196



>ref|XP_004138746.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform 2 
[Cucumis sativus]
Length=891

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPGA-XALSAKAYXERLKL  625
            RRDG+ LLNG+ NG VGND L+RQNPG+  AL+ K Y +RLKL
Sbjct  151  RRDGAQLLNGSSNGFVGNDPLMRQNPGSVNALATKMYEDRLKL  193



>ref|XP_011081899.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
 ref|XP_011081901.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
 ref|XP_011081902.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
 ref|XP_011081903.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
 ref|XP_011081904.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
Length=912

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQLMK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLMKAR  87


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RR+G +L+NGT NG+VGND L+RQNPG A AL+ K Y E LKL
Sbjct  168  RREGGHLMNGTANGIVGNDPLMRQNPGTASALATKMYEENLKL  210



>ref|XP_011019744.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Populus 
euphratica]
Length=849

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT NG+VGND L+RQN   A A++ K Y E+LKL
Sbjct  116  RRDGAHLLNGTANGLVGNDPLMRQNTATANAMATKMYEEKLKL  158



>gb|EYU21923.1| hypothetical protein MIMGU_mgv1a000972mg [Erythranthe guttata]
Length=926

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQLMK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLMKAR  87


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLK  622
            RR+G +LLNG+ NG+VGND L+RQNPG A AL+ K Y E LK
Sbjct  183  RREGGHLLNGSSNGIVGNDPLMRQNPGTANALATKMYEENLK  224



>ref|XP_009372956.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X6 
[Pyrus x bretschneideri]
Length=814

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++L NG  NG+VGND L+RQNPG A A++ K Y ERLKL
Sbjct  164  RRDGAHLHNGPTNGLVGNDPLMRQNPGTANAMATKMYEERLKL  206



>ref|XP_010526194.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Tarenaya hassleriana]
Length=911

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMMKAR  87


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 35/44 (80%), Gaps = 2/44 (5%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGN-DSLIRQNPG-AXALSAKAYXERLKL  625
            RR+G++L+NGT NG+VGN D + RQ+PG   +L++K Y ER+K+
Sbjct  167  RREGTHLMNGTTNGLVGNSDPITRQHPGPTSSLASKVYEERVKM  210



>ref|XP_007013777.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
 ref|XP_007013779.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
 gb|EOY31396.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
 gb|EOY31398.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
Length=910

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG +LLNG+ NG+VGNDSL+RQ  G A A++ K Y ERLKL
Sbjct  166  RRDGPHLLNGSTNGLVGNDSLMRQPAGTANAIATKMYEERLKL  208



>ref|XP_007013780.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 4 [Theobroma cacao]
 gb|EOY31399.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 4 [Theobroma cacao]
Length=911

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG +LLNG+ NG+VGNDSL+RQ  G A A++ K Y ERLKL
Sbjct  166  RRDGPHLLNGSTNGLVGNDSLMRQPAGTANAIATKMYEERLKL  208



>ref|XP_004168288.1| PREDICTED: transcriptional corepressor LEUNIG-like [Cucumis sativus]
Length=900

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPGA-XALSAKAYXERLKL  625
            RRDG+ LLNG+ NG VGND L+RQNPG+  AL+ K Y +RLKL
Sbjct  151  RRDGAQLLNGSSNGFVGNDPLMRQNPGSVNALATKMYEDRLKL  193



>ref|XP_003544623.1| PREDICTED: transcriptional corepressor LEUNIG-like isoformX2 
[Glycine max]
Length=893

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>emb|CDP04840.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS++AASYIETQ++K R
Sbjct  61   DIFIARTNEKHSEIAASYIETQIIKAR  87


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG +LLNG+ NG+ GND L+RQNPG A AL+ K Y E+LKL
Sbjct  173  RRDGGHLLNGSANGIAGNDPLMRQNPGTANALATKMYEEKLKL  215



>ref|XP_003550163.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform 1 
[Glycine max]
Length=903

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>ref|XP_004138745.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform 1 
[Cucumis sativus]
Length=900

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPGA-XALSAKAYXERLKL  625
            RRDG+ LLNG+ NG VGND L+RQNPG+  AL+ K Y +RLKL
Sbjct  151  RRDGAQLLNGSSNGFVGNDPLMRQNPGSVNALATKMYEDRLKL  193



>ref|XP_009372954.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Pyrus x bretschneideri]
Length=903

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++L NG  NG+VGND L+RQNPG A A++ K Y ERLKL
Sbjct  164  RRDGAHLHNGPTNGLVGNDPLMRQNPGTANAMATKMYEERLKL  206



>ref|XP_002309593.2| LEUNIG family protein [Populus trichocarpa]
 gb|EEE93116.2| LEUNIG family protein [Populus trichocarpa]
Length=900

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLLKAR  87


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNG  NG+VGND L+RQN   A A++ K Y E+LKL
Sbjct  151  RRDGAHLLNGAANGLVGNDPLMRQNTATANAMATKMYEEKLKL  193



>ref|XP_008445143.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional corepressor LEUNIG 
[Cucumis melo]
Length=899

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPGA-XALSAKAYXERLKL  625
            RRDG+ LLNG  NG VGND L+RQNPG+  AL+ K Y +RLKL
Sbjct  151  RRDGAQLLNGNANGFVGNDPLMRQNPGSVNALATKMYEDRLKL  193



>ref|XP_007225320.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
 gb|EMJ26519.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
Length=890

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAK  601
            RRDG + LNGT NG+VGND L+RQNPG A A++ K
Sbjct  176  RRDGVHFLNGTTNGLVGNDPLMRQNPGTANAMATK  210



>gb|KHG28610.1| Transcriptional corepressor LEUNIG -like protein [Gossypium arboreum]
Length=870

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS LLNG  NG+VGND+LIRQ  G A A++ K Y ERLKL
Sbjct  192  RRDGSQLLNGNTNGLVGNDTLIRQPAGTANAMATKMYEERLKL  234



>emb|CBI20986.3| unnamed protein product [Vitis vinifera]
Length=234

 Score =   171 bits (434),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLM  292
            DIFIARTN+KHS+VAASYIE +++
Sbjct  61   DIFIARTNEKHSEVAASYIEIEMI  84



>gb|KJB83313.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=905

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG  NG+VGNDSLIRQ  G A A++ K Y ERLKL
Sbjct  189  RRDGSHLLNGNTNGLVGNDSLIRQPAGTANAMATKMYEERLKL  231



>ref|XP_008359610.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Malus domestica]
Length=902

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++L NG  NG+VGND L+RQNPG A A+++K Y ERLKL
Sbjct  165  RRDGAHLHNGPTNGLVGNDLLMRQNPGTANAMASKMYEERLKL  207



>ref|XP_008359611.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Malus domestica]
Length=901

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++L NG  NG+VGND L+RQNPG A A+++K Y ERLKL
Sbjct  165  RRDGAHLHNGPTNGLVGNDLLMRQNPGTANAMASKMYEERLKL  207



>ref|XP_007225321.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
 gb|EMJ26520.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
Length=893

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAK  601
            RRDG + LNGT NG+VGND L+RQNPG A A++ K
Sbjct  176  RRDGVHFLNGTTNGLVGNDPLMRQNPGTANAMATK  210



>gb|KJB83315.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=928

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG  NG+VGNDSLIRQ  G A A++ K Y ERLKL
Sbjct  189  RRDGSHLLNGNTNGLVGNDSLIRQPAGTANAMATKMYEERLKL  231



>ref|XP_004498639.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Cicer arietinum]
Length=900

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>ref|XP_009372955.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X5 
[Pyrus x bretschneideri]
Length=897

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>gb|KJB64522.1| hypothetical protein B456_010G053000 [Gossypium raimondii]
Length=933

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG+ NG+VGNDSL+RQ  G A A++ K Y ERLKL
Sbjct  197  RRDGSHLLNGSTNGLVGNDSLMRQPAGTANAMATKMYEERLKL  239



>ref|XP_011019743.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Populus 
euphratica]
Length=857

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT NG+VGND L+RQN   A A++ K Y E+LKL
Sbjct  115  RRDGAHLLNGTANGLVGNDPLMRQNTATANAMATKMYEEKLKL  157



>gb|KHN16498.1| Transcriptional corepressor LEUNIG [Glycine soja]
Length=886

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>ref|XP_011019742.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Populus 
euphratica]
Length=858

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT NG+VGND L+RQN   A A++ K Y E+LKL
Sbjct  116  RRDGAHLLNGTANGLVGNDPLMRQNTATANAMATKMYEEKLKL  158



>ref|XP_003522634.1| PREDICTED: transcriptional corepressor LEUNIG-like isoformX2 
[Glycine max]
Length=903

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>ref|XP_007013778.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 2 [Theobroma cacao]
 gb|EOY31397.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 2 [Theobroma cacao]
Length=919

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG +LLNG+ NG+VGNDSL+RQ  G A A++ K Y ERLKL
Sbjct  166  RRDGPHLLNGSTNGLVGNDSLMRQPAGTANAIATKMYEERLKL  208



>ref|XP_008359612.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X5 
[Malus domestica]
Length=895

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>ref|XP_003526430.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Glycine max]
Length=892

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>gb|AES73711.2| transcriptional corepressor leunig-like protein [Medicago truncatula]
Length=897

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>gb|KHN10378.1| Transcriptional corepressor LEUNIG [Glycine soja]
Length=116

 Score =   167 bits (423),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIE  280
            DIFIARTN+KHS+VAASYIE
Sbjct  61   DIFIARTNEKHSEVAASYIE  80



>ref|XP_003544622.1| PREDICTED: transcriptional corepressor LEUNIG-like isoformX1 
[Glycine max]
Length=902

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>gb|KHN08101.1| Transcriptional corepressor LEUNIG [Glycine soja]
Length=901

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>gb|KDO79598.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=915

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNG  NG++GNDSL+RQNPG A A++ + Y E+LKL
Sbjct  171  RRDGAHLLNGNTNGLLGNDSLMRQNPGTANAMATRMYEEKLKL  213



>gb|KJB64524.1| hypothetical protein B456_010G053000 [Gossypium raimondii]
Length=902

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG+ NG+VGNDSL+RQ  G A A++ K Y ERLKL
Sbjct  197  RRDGSHLLNGSTNGLVGNDSLMRQPAGTANAMATKMYEERLKL  239



>ref|XP_003550164.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform 2 
[Glycine max]
Length=912

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>ref|XP_003588695.1| Transcriptional corepressor LEUNIG [Medicago truncatula]
 gb|AES58946.1| transcriptional corepressor leunig-like protein [Medicago truncatula]
Length=893

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>ref|XP_006450543.1| hypothetical protein CICLE_v10007390mg [Citrus clementina]
 gb|ESR63783.1| hypothetical protein CICLE_v10007390mg [Citrus clementina]
Length=917

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNG  NG++GNDSL+RQNPG A A++ + Y E+LKL
Sbjct  173  RRDGAHLLNGNTNGLLGNDSLMRQNPGTANAMATRMYEEKLKL  215



>gb|KDO79599.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=847

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNG  NG++GNDSL+RQNPG A A++ + Y E+LKL
Sbjct  171  RRDGAHLLNGNTNGLLGNDSLMRQNPGTANAMATRMYEEKLKL  213



>ref|XP_008219869.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Prunus 
mume]
Length=914

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG + LNGT NG+VGND L+RQNPG A A++ K Y E+LKL
Sbjct  178  RRDGVHFLNGTTNGLVGNDPLMRQNPGTANAMATKMYEEKLKL  220



>gb|KJB83312.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=935

 Score =   182 bits (461),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG  NG+VGNDSLIRQ  G A A++ K Y ERLKL
Sbjct  189  RRDGSHLLNGNTNGLVGNDSLIRQPAGTANAMATKMYEERLKL  231



>ref|XP_006596119.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Glycine max]
Length=897

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>ref|XP_009372951.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Pyrus x bretschneideri]
Length=912

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++L NG  NG+VGND L+RQNPG A A++ K Y ERLKL
Sbjct  164  RRDGAHLHNGPTNGLVGNDPLMRQNPGTANAMATKMYEERLKL  206



>gb|KDO79596.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=913

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNG  NG++GNDSL+RQNPG A A++ + Y E+LKL
Sbjct  171  RRDGAHLLNGNTNGLLGNDSLMRQNPGTANAMATRMYEEKLKL  213



>gb|KJB83301.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83308.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=937

 Score =   182 bits (461),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG  NG+VGNDSLIRQ  G A A++ K Y ERLKL
Sbjct  189  RRDGSHLLNGNTNGLVGNDSLIRQPAGTANAMATKMYEERLKL  231



>gb|KJB83300.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83310.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=936

 Score =   182 bits (461),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG  NG+VGNDSLIRQ  G A A++ K Y ERLKL
Sbjct  189  RRDGSHLLNGNTNGLVGNDSLIRQPAGTANAMATKMYEERLKL  231



>ref|XP_006476206.1| PREDICTED: transcriptional corepressor LEUNIG-like [Citrus sinensis]
 gb|KDO79595.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=918

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNG  NG++GNDSL+RQNPG A A++ + Y E+LKL
Sbjct  171  RRDGAHLLNGNTNGLLGNDSLMRQNPGTANAMATRMYEEKLKL  213



>ref|XP_006581383.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Glycine max]
Length=887

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>ref|XP_009372950.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Pyrus x bretschneideri]
Length=913

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++L NG  NG+VGND L+RQNPG A A++ K Y ERLKL
Sbjct  164  RRDGAHLHNGPTNGLVGNDPLMRQNPGTANAMATKMYEERLKL  206



>ref|XP_006450544.1| hypothetical protein CICLE_v10007390mg [Citrus clementina]
 gb|ESR63784.1| hypothetical protein CICLE_v10007390mg [Citrus clementina]
Length=920

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNG  NG++GNDSL+RQNPG A A++ + Y E+LKL
Sbjct  173  RRDGAHLLNGNTNGLLGNDSLMRQNPGTANAMATRMYEEKLKL  215



>ref|XP_008359609.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Malus domestica]
Length=910

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++L NG  NG+VGND L+RQNPG A A+++K Y ERLKL
Sbjct  165  RRDGAHLHNGPTNGLVGNDLLMRQNPGTANAMASKMYEERLKL  207



>ref|XP_007225322.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
 gb|EMJ26521.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
Length=899

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAK  601
            RRDG + LNGT NG+VGND L+RQNPG A A++ K
Sbjct  176  RRDGVHFLNGTTNGLVGNDPLMRQNPGTANAMATK  210



>ref|XP_010648611.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Vitis 
vinifera]
Length=901

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT NG+VGND L+R NP  A AL+ K Y ERLKL
Sbjct  156  RRDGAHLLNGTTNGLVGNDPLMRTNPATANALATKMYEERLKL  198



>ref|XP_004501292.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Cicer arietinum]
Length=888

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQ+EGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQSEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLLKAR  87



>ref|XP_008359608.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Malus domestica]
Length=911

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++L NG  NG+VGND L+RQNPG A A+++K Y ERLKL
Sbjct  165  RRDGAHLHNGPTNGLVGNDLLMRQNPGTANAMASKMYEERLKL  207



>gb|KDO79597.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=903

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNG  NG++GNDSL+RQNPG A A++ + Y E+LKL
Sbjct  171  RRDGAHLLNGNTNGLLGNDSLMRQNPGTANAMATRMYEEKLKL  213



>ref|XP_004498638.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Cicer arietinum]
Length=909

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>gb|KJB64523.1| hypothetical protein B456_010G053000 [Gossypium raimondii]
Length=942

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG+ NG+VGNDSL+RQ  G A A++ K Y ERLKL
Sbjct  197  RRDGSHLLNGSTNGLVGNDSLMRQPAGTANAMATKMYEERLKL  239



>ref|XP_003522633.1| PREDICTED: transcriptional corepressor LEUNIG-like isoformX1 
[Glycine max]
Length=912

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>gb|KJB64525.1| hypothetical protein B456_010G053000 [Gossypium raimondii]
Length=943

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG+ NG+VGNDSL+RQ  G A A++ K Y ERLKL
Sbjct  197  RRDGSHLLNGSTNGLVGNDSLMRQPAGTANAMATKMYEERLKL  239



>gb|KJB83302.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83307.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=941

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG  NG+VGNDSLIRQ  G A A++ K Y ERLKL
Sbjct  189  RRDGSHLLNGNTNGLVGNDSLIRQPAGTANAMATKMYEERLKL  231



>gb|KJB83303.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83311.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=942

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG  NG+VGNDSLIRQ  G A A++ K Y ERLKL
Sbjct  189  RRDGSHLLNGNTNGLVGNDSLIRQPAGTANAMATKMYEERLKL  231



>gb|KEH35932.1| transcriptional corepressor leunig-like protein [Medicago truncatula]
Length=904

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>ref|XP_007161251.1| hypothetical protein PHAVU_001G054700g [Phaseolus vulgaris]
 gb|ESW33245.1| hypothetical protein PHAVU_001G054700g [Phaseolus vulgaris]
Length=895

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFI+RTN+KHS+VAASYIETQ MK R
Sbjct  61   DIFISRTNEKHSEVAASYIETQFMKAR  87



>ref|XP_006578171.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Glycine max]
Length=907

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>gb|KEH39820.1| transcriptional corepressor leunig-like protein [Medicago truncatula]
Length=902

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>ref|XP_011026513.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Populus euphratica]
Length=945

 Score =   181 bits (460),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>ref|XP_009372953.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Pyrus x bretschneideri]
Length=904

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++L NG  NG+VGND L+RQNPG A A++ K Y ERLKL
Sbjct  164  RRDGAHLHNGPTNGLVGNDPLMRQNPGTANAMATKMYEERLKL  206



>ref|XP_008219867.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Prunus 
mume]
Length=924

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG + LNGT NG+VGND L+RQNPG A A++ K Y E+LKL
Sbjct  178  RRDGVHFLNGTTNGLVGNDPLMRQNPGTANAMATKMYEEKLKL  220



>ref|XP_008219868.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Prunus 
mume]
Length=923

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG + LNGT NG+VGND L+RQNPG A A++ K Y E+LKL
Sbjct  178  RRDGVHFLNGTTNGLVGNDPLMRQNPGTANAMATKMYEEKLKL  220



>gb|KJB83304.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83309.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=950

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG  NG+VGNDSLIRQ  G A A++ K Y ERLKL
Sbjct  189  RRDGSHLLNGNTNGLVGNDSLIRQPAGTANAMATKMYEERLKL  231



>gb|KJB83305.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83306.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=951

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG  NG+VGNDSLIRQ  G A A++ K Y ERLKL
Sbjct  189  RRDGSHLLNGNTNGLVGNDSLIRQPAGTANAMATKMYEERLKL  231



>gb|EPS68633.1| hypothetical protein M569_06134 [Genlisea aurea]
Length=833

 Score =   180 bits (457),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIE+QLMK R
Sbjct  61   DIFIARTNEKHSEVAASYIESQLMKTR  87



>ref|XP_006371728.1| LEUNIG family protein [Populus trichocarpa]
 gb|ERP49525.1| LEUNIG family protein [Populus trichocarpa]
Length=953

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>ref|XP_002284900.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Vitis 
vinifera]
 ref|XP_010648609.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Vitis 
vinifera]
 ref|XP_010648610.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Vitis 
vinifera]
Length=910

 Score =   181 bits (459),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT NG+VGND L+R NP  A AL+ K Y ERLKL
Sbjct  156  RRDGAHLLNGTTNGLVGNDPLMRTNPATANALATKMYEERLKL  198



>gb|KJB83314.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=945

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG  NG+VGNDSLIRQ  G A A++ K Y ERLKL
Sbjct  189  RRDGSHLLNGNTNGLVGNDSLIRQPAGTANAMATKMYEERLKL  231



>ref|XP_004501291.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Cicer arietinum]
Length=897

 Score =   181 bits (458),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQ+EGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQSEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLLKAR  87



>ref|XP_003603460.1| NAD(P)H-quinone oxidoreductase subunit [Medicago truncatula]
Length=941

 Score =   181 bits (459),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>ref|XP_004501290.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Cicer arietinum]
Length=904

 Score =   181 bits (458),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQ+EGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQSEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLLKAR  87



>ref|XP_011026511.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Populus euphratica]
Length=954

 Score =   181 bits (459),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>ref|XP_011026514.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Populus euphratica]
Length=937

 Score =   181 bits (459),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>ref|XP_011026512.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Populus euphratica]
Length=949

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>ref|XP_006412457.1| hypothetical protein EUTSA_v10024343mg [Eutrema salsugineum]
 gb|ESQ53910.1| hypothetical protein EUTSA_v10024343mg [Eutrema salsugineum]
Length=917

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ++K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMIKAR  87


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 37/45 (82%), Gaps = 3/45 (7%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDS--LIRQNPGA-XALSAKAYXERLKL  625
            RRDGS+L NG+ NG+VGN+S  ++RQNPG+  AL+ KAY ER+K+
Sbjct  176  RRDGSHLANGSANGLVGNNSDPVMRQNPGSGSALANKAYEERVKM  220



>gb|AAG32022.1|AF277458_1 LEUNIG [Arabidopsis thaliana]
Length=931

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ++K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMIKAR  87


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 38/45 (84%), Gaps = 3/45 (7%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDS--LIRQNPGA-XALSAKAYXERLKL  625
            RRDGS+L NG+ NG+VGN+S  ++RQNPG+  +L++KAY ER+K+
Sbjct  185  RRDGSHLANGSANGLVGNNSEPVMRQNPGSGSSLASKAYEERVKM  229



>ref|XP_007225319.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
 gb|EMJ26518.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
Length=862

 Score =   180 bits (456),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAK  601
            RRDG + LNGT NG+VGND L+RQNPG A A++ K
Sbjct  176  RRDGVHFLNGTTNGLVGNDPLMRQNPGTANAMATK  210



>ref|XP_010447372.1| PREDICTED: transcriptional corepressor LEUNIG [Camelina sativa]
Length=925

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ++K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMIKAR  87


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 37/45 (82%), Gaps = 3/45 (7%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDS--LIRQNPGA-XALSAKAYXERLKL  625
            RRDGS+L NG+ NG+ GN+S  ++RQNPG+  +L++KAY ER+K+
Sbjct  177  RRDGSHLANGSANGLAGNNSDPVMRQNPGSGSSLASKAYEERVKM  221



>gb|KFK29865.1| hypothetical protein AALP_AA7G189100 [Arabis alpina]
Length=926

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ++K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMIKAR  87


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 37/45 (82%), Gaps = 3/45 (7%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGN--DSLIRQNPGA-XALSAKAYXERLKL  625
            RRDGS+L NG+ NG+VGN  DS++RQNPG+  ALS+K Y ER+K+
Sbjct  180  RRDGSHLANGSANGLVGNNSDSVMRQNPGSGNALSSKTYEERVKM  224



>ref|NP_567896.1| transcriptional corepressor LEUNIG [Arabidopsis thaliana]
 sp|Q9FUY2.2|LEUNG_ARATH RecName: Full=Transcriptional corepressor LEUNIG [Arabidopsis 
thaliana]
 gb|AEE86076.1| transcriptional corepressor LEUNIG [Arabidopsis thaliana]
Length=931

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ++K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMIKAR  87


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 38/45 (84%), Gaps = 3/45 (7%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDS--LIRQNPGA-XALSAKAYXERLKL  625
            RRDGS+L NG+ NG+VGN+S  ++RQNPG+  +L++KAY ER+K+
Sbjct  185  RRDGSHLANGSANGLVGNNSEPVMRQNPGSGSSLASKAYEERVKM  229



>ref|XP_010432701.1| PREDICTED: transcriptional corepressor LEUNIG-like [Camelina 
sativa]
Length=941

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ++K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMIKAR  87


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 37/45 (82%), Gaps = 3/45 (7%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDS--LIRQNPGA-XALSAKAYXERLKL  625
            RRDGS+L NG+ NG+ GN+S  ++RQNPG+  +L++KAY ER+K+
Sbjct  193  RRDGSHLANGSANGLAGNNSDPVMRQNPGSGSSLASKAYEERVKM  237



>ref|XP_009377500.1| PREDICTED: transcriptional corepressor LEUNIG isoform X6 [Pyrus 
x bretschneideri]
Length=816

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MS TNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSHTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT NG+VGND L+RQNPG A A++ K Y ERLKL
Sbjct  163  RRDGAHLLNGTTNGLVGNDPLMRQNPGTANAMATKMYEERLKL  205



>ref|XP_010112086.1| Transcriptional corepressor LEUNIG [Morus notabilis]
 gb|EXC32583.1| Transcriptional corepressor LEUNIG [Morus notabilis]
Length=924

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT NG+VGND L+RQNPG A AL+ K Y ERLKL
Sbjct  164  RRDGAHLLNGTTNGLVGNDPLMRQNPGTANALATKMYEERLKL  206



>ref|XP_009377497.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Pyrus 
x bretschneideri]
Length=906

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MS TNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSHTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT NG+VGND L+RQNPG A A++ K Y ERLKL
Sbjct  163  RRDGAHLLNGTTNGLVGNDPLMRQNPGTANAMATKMYEERLKL  205



>ref|XP_009377498.1| PREDICTED: transcriptional corepressor LEUNIG isoform X4 [Pyrus 
x bretschneideri]
Length=899

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MS TNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSHTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAK  601
            RRDG++LLNGT NG+VGND L+RQNPG A A++ K
Sbjct  163  RRDGAHLLNGTTNGLVGNDPLMRQNPGTANAMATK  197



>ref|NP_001190891.1| transcriptional corepressor LEUNIG [Arabidopsis thaliana]
 gb|AEE86077.1| transcriptional corepressor LEUNIG [Arabidopsis thaliana]
Length=969

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ++K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMIKAR  87


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 38/45 (84%), Gaps = 3/45 (7%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDS--LIRQNPGA-XALSAKAYXERLKL  625
            RRDGS+L NG+ NG+VGN+S  ++RQNPG+  +L++KAY ER+K+
Sbjct  185  RRDGSHLANGSANGLVGNNSEPVMRQNPGSGSSLASKAYEERVKM  229



>ref|XP_006581384.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Glycine max]
Length=883

 Score =   180 bits (456),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87



>ref|XP_007137062.1| hypothetical protein PHAVU_009G096600g [Phaseolus vulgaris]
 gb|ESW09056.1| hypothetical protein PHAVU_009G096600g [Phaseolus vulgaris]
Length=982

 Score =   180 bits (457),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  91   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  150

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  151  DIFIARTNEKHSEVAASYIETQLIKAR  177



>ref|XP_008394022.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional corepressor LEUNIG 
[Malus domestica]
Length=897

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MS TNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSHTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT NG+VGND L+RQNPG A A++ K Y ERLKL
Sbjct  162  RRDGAHLLNGTTNGLVGNDPLMRQNPGTANAMATKMYEERLKL  204



>ref|XP_011459234.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Fragaria 
vesca subsp. vesca]
Length=892

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ +K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQFIKAR  87


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNG  NG+VGND L+RQNPG A A++ K Y ERLKL
Sbjct  163  RRDGAHLLNGNTNGLVGNDPLMRQNPGTANAMATKMYEERLKL  205



>ref|XP_009377499.1| PREDICTED: transcriptional corepressor LEUNIG isoform X5 [Pyrus 
x bretschneideri]
Length=897

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MS TNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSHTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT NG+VGND L+RQNPG A A++ K Y ERLKL
Sbjct  163  RRDGAHLLNGTTNGLVGNDPLMRQNPGTANAMATKMYEERLKL  205



>ref|XP_009377494.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Pyrus 
x bretschneideri]
Length=915

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MS TNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSHTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT NG+VGND L+RQNPG A A++ K Y ERLKL
Sbjct  163  RRDGAHLLNGTTNGLVGNDPLMRQNPGTANAMATKMYEERLKL  205



>gb|KDP32298.1| hypothetical protein JCGZ_13223 [Jatropha curcas]
Length=935

 Score =   180 bits (456),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 84/87 (97%), Positives = 87/87 (100%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+KVR
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKVR  87


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNG  NG+VGND L+RQNPG A AL+ K Y ERLKL
Sbjct  173  RRDGAHLLNGNTNGLVGNDPLLRQNPGTANALATKMYEERLKL  215



>emb|CAF18245.1| STYLOSA protein [Antirrhinum majus]
Length=915

 Score =   180 bits (456),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 84/87 (97%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQLMK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLMKAR  87


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 3/43 (7%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RR+G  LLNGT NG+VGND L+RQNPG A AL+ K Y E+LKL
Sbjct  173  RREG--LLNGTANGIVGNDPLMRQNPGTANALATKMYEEKLKL  213



>ref|XP_009377496.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Pyrus 
x bretschneideri]
Length=906

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MS TNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSHTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT NG+VGND L+RQNPG A A++ K Y ERLKL
Sbjct  163  RRDGAHLLNGTTNGLVGNDPLMRQNPGTANAMATKMYEERLKL  205



>ref|XP_010670737.1| PREDICTED: transcriptional corepressor LEUNIG [Beta vulgaris 
subsp. vulgaris]
Length=930

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAA+YIETQL++ R
Sbjct  61   DIFIARTNEKHSEVAATYIETQLLRTR  87


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT N V GN  L RQN G A A++ K Y ERLKL
Sbjct  183  RRDGAHLLNGTANEVAGNGPLARQNSGTANAMATKMYEERLKL  225



>ref|XP_004291496.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011459233.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Fragaria 
vesca subsp. vesca]
Length=901

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ +K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQFIKAR  87


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNG  NG+VGND L+RQNPG A A++ K Y ERLKL
Sbjct  163  RRDGAHLLNGNTNGLVGNDPLMRQNPGTANAMATKMYEERLKL  205



>ref|XP_010049005.1| PREDICTED: transcriptional corepressor LEUNIG [Eucalyptus grandis]
 ref|XP_010049006.1| PREDICTED: transcriptional corepressor LEUNIG [Eucalyptus grandis]
Length=910

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAF AEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFLAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQLMK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLMKAR  87


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPGAXALSAKAYXERLKL  625
            RRDG++LLNG  NG+ GND L+RQ+PGA AL+ K Y ERLKL
Sbjct  173  RRDGAHLLNGNANGLAGNDPLMRQSPGANALATKMYEERLKL  214



>ref|XP_007137063.1| hypothetical protein PHAVU_009G096600g [Phaseolus vulgaris]
 gb|ESW09057.1| hypothetical protein PHAVU_009G096600g [Phaseolus vulgaris]
Length=991

 Score =   180 bits (456),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  91   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  150

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  151  DIFIARTNEKHSEVAASYIETQLIKAR  177



>emb|CDX68860.1| BnaC01g05930D [Brassica napus]
Length=908

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGK+S DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKISLDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMMKAR  87



>ref|XP_002869264.1| hypothetical protein ARALYDRAFT_491464 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45523.1| hypothetical protein ARALYDRAFT_491464 [Arabidopsis lyrata subsp. 
lyrata]
Length=920

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVS DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSPDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ++K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMIKAR  87


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 38/45 (84%), Gaps = 3/45 (7%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDS--LIRQNPGA-XALSAKAYXERLKL  625
            RRDGS+L NG+ NG+VGN+S  ++RQNPG+  +L++KAY ER+K+
Sbjct  174  RRDGSHLANGSANGLVGNNSEPVMRQNPGSGSSLASKAYEERVKM  218



>ref|XP_009125844.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Brassica 
rapa]
Length=933

 Score =   179 bits (453),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGK+S DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKISLDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMMKAR  87


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 4/46 (9%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDS--LIRQNPGAXALSA--KAYXERLKL  625
            RRDGS+L NG+ NG+VGN+S  ++RQNPG  +  A  KAY ER+K+
Sbjct  186  RRDGSHLANGSANGLVGNNSDPVMRQNPGPGSALANNKAYEERIKM  231



>ref|XP_009125860.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Brassica 
rapa]
Length=925

 Score =   179 bits (453),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGK+S DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKISLDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMMKAR  87


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 4/46 (9%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDS--LIRQNPGAXALSA--KAYXERLKL  625
            RRDGS+L NG+ NG+VGN+S  ++RQNPG  +  A  KAY ER+K+
Sbjct  186  RRDGSHLANGSANGLVGNNSDPVMRQNPGPGSALANNKAYEERIKM  231



>ref|XP_009125852.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Brassica 
rapa]
Length=926

 Score =   179 bits (453),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGK+S DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKISLDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMMKAR  87


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 4/46 (9%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDS--LIRQNPGAXALSA--KAYXERLKL  625
            RRDGS+L NG+ NG+VGN+S  ++RQNPG  +  A  KAY ER+K+
Sbjct  186  RRDGSHLANGSANGLVGNNSDPVMRQNPGPGSALANNKAYEERIKM  231



>emb|CDX75254.1| BnaA01g04480D [Brassica napus]
Length=1117

 Score =   179 bits (455),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGK+S DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKISLDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMMKAR  87


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 4/46 (9%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDS--LIRQNPGAXALSA--KAYXERLKL  625
            RRDGS+L NG+ NG+VGN+S  ++RQNPG  +  A  KAY ER+K+
Sbjct  370  RRDGSHLANGSANGLVGNNSDPVMRQNPGPGSALANNKAYEERIKM  415



>ref|XP_010548472.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Tarenaya hassleriana]
Length=894

 Score =   178 bits (451),  Expect = 7e-48, Method: Composition-based stats.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            D+FIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   DMFIARTNEKHSEVAASYIETQMMKAR  87



>ref|XP_009138136.1| PREDICTED: transcriptional corepressor LEUNIG-like [Brassica 
rapa]
Length=902

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ++K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMIKAR  87



>ref|XP_006829639.1| hypothetical protein AMTR_s00122p00094620 [Amborella trichopoda]
 gb|ERM97055.1| hypothetical protein AMTR_s00122p00094620 [Amborella trichopoda]
Length=856

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYLVKR+L+ASA+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLVKRNLQASAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG +LLNG  NG+ GNDSL+RQN G A AL+ K Y ERLK+
Sbjct  142  RRDGQHLLNGPTNGLGGNDSLMRQNQGTANALATKMYEERLKV  184



>ref|NP_001183236.1| uncharacterized protein LOC100501624 [Zea mays]
 gb|ACR36144.1| unknown [Zea mays]
Length=95

 Score =   160 bits (405),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY +KR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFMKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIE  +   R
Sbjct  61   DIFIARTNEKHSDVAASYIEVSMCAFR  87



>ref|XP_009108869.1| PREDICTED: transcriptional corepressor LEUNIG [Brassica rapa]
Length=908

 Score =   174 bits (442),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 80/87 (92%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ++K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMIKAR  87



>emb|CAN74631.1| hypothetical protein VITISV_024165 [Vitis vinifera]
Length=690

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLM  292
            DIFIARTN+KHS+VAASYIE +++
Sbjct  61   DIFIARTNEKHSEVAASYIEIEMI  84


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT NG+VGND L+R NP  A AL+ K Y ERLKL
Sbjct  197  RRDGAHLLNGTTNGLVGNDPLMRTNPATANALATKMYEERLKL  239



>emb|CDY23331.1| BnaA08g12150D [Brassica napus]
Length=912

 Score =   174 bits (442),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 80/87 (92%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ++K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMIKAR  87



>emb|CDY51674.1| BnaC03g67130D [Brassica napus]
Length=884

 Score =   174 bits (441),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 80/87 (92%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ++K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQMIKAR  87



>ref|XP_004969116.1| PREDICTED: transcriptional corepressor LEUNIG-like [Setaria italica]
Length=897

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY +KR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFMKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQLMK R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLMKAR  87


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG+ NG+ GN+ L+RQN   A  ++ K Y ERLK+
Sbjct  160  RRDGSHLLNGSANGISGNNPLMRQNQSTANVMATKMYEERLKV  202



>ref|XP_008654518.1| PREDICTED: uncharacterized protein LOC100217300 isoform X1 [Zea 
mays]
Length=898

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY +KR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFMKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQLMK R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLMKAR  87


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG+ NG+ GN+ L+RQN   A  ++ K Y ERLK+
Sbjct  162  RRDGSHLLNGSANGISGNNPLMRQNQSTANVMATKMYEERLKV  204



>ref|XP_002458129.1| hypothetical protein SORBIDRAFT_03g027380 [Sorghum bicolor]
 gb|EES03249.1| hypothetical protein SORBIDRAFT_03g027380 [Sorghum bicolor]
Length=890

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY +KR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFMKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQLMK R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLMKAR  87


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNG+ NG+ GN+ L+RQN   A  ++ K Y ERLK+
Sbjct  156  RRDGSHLLNGSANGISGNNPLMRQNQSTANVMATKMYEERLKV  198



>tpg|DAA58910.1| TPA: hypothetical protein ZEAMMB73_487398 [Zea mays]
Length=825

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY VKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87



>gb|EMT04689.1| Transcriptional corepressor LEUNIG [Aegilops tauschii]
Length=835

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY +KR+L+A+A+AFQ+EGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFMKRNLQATAKAFQSEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQLMK R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLMKAR  87



>ref|XP_008673192.1| PREDICTED: hypothetical protein isoform X5 [Zea mays]
Length=851

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY VKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +2

Query  506  DGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            DGS LLNGT +G  GND LIRQNP  A +++AK Y ERLKL
Sbjct  125  DGS-LLNGTASGFSGNDPLIRQNPANANSMAAKMYEERLKL  164



>ref|XP_008673193.1| PREDICTED: hypothetical protein isoform X6 [Zea mays]
Length=850

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY VKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +2

Query  506  DGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            DGS LLNGT +G  GND LIRQNP  A +++AK Y ERLKL
Sbjct  125  DGS-LLNGTASGFSGNDPLIRQNPANANSMAAKMYEERLKL  164



>ref|XP_008673196.1| PREDICTED: hypothetical protein isoform X9 [Zea mays]
Length=849

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY VKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +2

Query  506  DGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            DGS LLNGT +G  GND LIRQNP  A +++AK Y ERLKL
Sbjct  125  DGS-LLNGTASGFSGNDPLIRQNPANANSMAAKMYEERLKL  164



>ref|NP_001169538.1| hypothetical protein [Zea mays]
 gb|ACN34055.1| unknown [Zea mays]
 tpg|DAA58911.1| TPA: hypothetical protein ZEAMMB73_487398 [Zea mays]
Length=836

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY VKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87



>ref|XP_010910871.1| PREDICTED: transcriptional corepressor LEUNIG-like, partial [Elaeis 
guineensis]
Length=533

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DY VKR+L ASA+AFQAE KVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYFVKRNLHASAKAFQAEAKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +2

Query  506  DGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            DG++LLNGT NG+V  + L+RQNP  A AL+ K Y ERLKL
Sbjct  156  DGAHLLNGTPNGLVAGEPLMRQNPATANALATKMYEERLKL  196



>ref|XP_008673194.1| PREDICTED: hypothetical protein isoform X7 [Zea mays]
Length=838

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY VKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87



>ref|XP_008673188.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=862

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY VKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +2

Query  506  DGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            DGS LLNGT +G  GND LIRQNP  A +++AK Y ERLKL
Sbjct  125  DGS-LLNGTASGFSGNDPLIRQNPANANSMAAKMYEERLKL  164



>ref|XP_008673190.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
Length=861

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY VKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +2

Query  506  DGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            DGS LLNGT +G  GND LIRQNP  A +++AK Y ERLKL
Sbjct  125  DGS-LLNGTASGFSGNDPLIRQNPANANSMAAKMYEERLKL  164



>ref|XP_008673189.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=861

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY VKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +2

Query  506  DGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            DGS LLNGT +G  GND LIRQNP  A +++AK Y ERLKL
Sbjct  125  DGS-LLNGTASGFSGNDPLIRQNPANANSMAAKMYEERLKL  164



>ref|XP_008673191.1| PREDICTED: hypothetical protein isoform X4 [Zea mays]
Length=860

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY VKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +2

Query  506  DGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            DGS LLNGT +G  GND LIRQNP  A +++AK Y ERLKL
Sbjct  125  DGS-LLNGTASGFSGNDPLIRQNPANANSMAAKMYEERLKL  164



>emb|CDM83001.1| unnamed protein product [Triticum aestivum]
Length=887

 Score =   172 bits (437),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY +KR+L+A+A+AFQ+EGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFMKRNLQATAKAFQSEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQLMK R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLMKAR  87



>ref|XP_010249918.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional corepressor LEUNIG 
[Nelumbo nucifera]
Length=897

 Score =   172 bits (437),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYLVKR+L+ASA+AFQAEGKV+SDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLVKRNLQASAKAFQAEGKVASDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RR+G++LLNGT NG+V ND+L+RQNPG A AL+ K Y ERLKL
Sbjct  154  RREGAHLLNGTANGLVANDTLMRQNPGTANALATKMYEERLKL  196



>ref|XP_006283115.1| hypothetical protein CARUB_v10004137mg [Capsella rubella]
 gb|EOA16013.1| hypothetical protein CARUB_v10004137mg [Capsella rubella]
Length=824

 Score =   172 bits (435),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 86/95 (91%), Gaps = 8/95 (8%)
 Frame = +2

Query  41   MSQTNWEADKML--------DVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFL  196
            MSQTNWEADK+L        DVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFL
Sbjct  1    MSQTNWEADKILKVVECNRLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFL  60

Query  197  FEWWSVFWDIFIARTNDKHSDVAASYIETQLMKVR  301
            FEWWSVFWDIFIARTN+KHS+VAASYIETQ++K R
Sbjct  61   FEWWSVFWDIFIARTNEKHSEVAASYIETQMIKAR  95



>emb|CAB43692.1| putative protein [Arabidopsis thaliana]
 emb|CAB79972.1| putative protein [Arabidopsis thaliana]
Length=930

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 86/94 (91%), Gaps = 7/94 (7%)
 Frame = +2

Query  41   MSQTNWEADKM-------LDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLF  199
            MSQTNWEADK+       LDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLF
Sbjct  1    MSQTNWEADKIQIFECNRLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLF  60

Query  200  EWWSVFWDIFIARTNDKHSDVAASYIETQLMKVR  301
            EWWSVFWDIFIARTN+KHS+VAASYIETQ++K R
Sbjct  61   EWWSVFWDIFIARTNEKHSEVAASYIETQMIKAR  94


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 38/45 (84%), Gaps = 3/45 (7%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDS--LIRQNPGA-XALSAKAYXERLKL  625
            RRDGS+L NG+ NG+VGN+S  ++RQNPG+  +L++KAY ER+K+
Sbjct  192  RRDGSHLANGSANGLVGNNSEPVMRQNPGSGSSLASKAYEERVKM  236



>ref|XP_010254246.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X5 
[Nelumbo nucifera]
Length=902

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYLVKR+L+A+A+AFQ EGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLVKRNLQATAKAFQGEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RR+G +LLNGT NG+V +D+L+RQNPG A AL+ K Y ERLKL
Sbjct  159  RREGPHLLNGTSNGLVASDTLMRQNPGTANALATKMYEERLKL  201



>ref|XP_010254245.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Nelumbo nucifera]
Length=911

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYLVKR+L+A+A+AFQ EGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLVKRNLQATAKAFQGEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQLIKAR  87


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RR+G +LLNGT NG+V +D+L+RQNPG A AL+ K Y ERLKL
Sbjct  159  RREGPHLLNGTSNGLVASDTLMRQNPGTANALATKMYEERLKL  201



>ref|XP_006644351.1| PREDICTED: transcriptional corepressor LEUNIG-like [Oryza brachyantha]
Length=873

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY +KR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFMKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQ MK R
Sbjct  61   DIFIARTNEKHSDVAASYIETQHMKAR  87


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT +G+ GN+ LIRQN   A  ++ K Y ERLKL
Sbjct  147  RRDGTHLLNGTASGLPGNNPLIRQNQSTANVMATKMYEERLKL  189



>gb|EMS46090.1| Transcriptional corepressor LEUNIG [Triticum urartu]
Length=991

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY +KR+L+A+A+AFQ+EGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFMKRNLQATAKAFQSEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQLMK R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLMKAR  87



>ref|NP_001043531.2| Os01g0607400 [Oryza sativa Japonica Group]
 dbj|BAD52823.1| putative LEUNIG [Oryza sativa Japonica Group]
 dbj|BAD53054.1| putative LEUNIG [Oryza sativa Japonica Group]
 dbj|BAF05445.2| Os01g0607400 [Oryza sativa Japonica Group]
Length=876

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY +KR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFMKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQ MK R
Sbjct  61   DIFIARTNEKHSDVAASYIETQHMKAR  87


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT +G+ GN+ L+RQN   A  ++ K Y ERLKL
Sbjct  147  RRDGTHLLNGTASGLPGNNPLMRQNQSTANVMATKMYEERLKL  189



>dbj|BAM17634.1| HWC1 [Oryza sativa Japonica Group]
Length=876

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY +KR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFMKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQ MK R
Sbjct  61   DIFIARTNEKHSDVAASYIETQHMKAR  87


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT +G+ GN+ L+RQN   A  ++ K Y ERLKL
Sbjct  147  RRDGTHLLNGTASGLPGNNPLMRQNQSTANVMATKMYEERLKL  189



>dbj|BAK06260.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=847

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY +KR+L+A+A+AFQ+EGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFMKRNLQATAKAFQSEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQ MK R
Sbjct  61   DIFIARTNEKHSDVAASYIETQQMKAR  87



>ref|XP_003569328.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Brachypodium distachyon]
Length=876

 Score =   170 bits (430),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY +KR+L+A+A+AFQAEG VSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFMKRNLQATAKAFQAEGNVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLVKAR  87


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNGT +G+ GN+ L+RQN   A  ++ K Y ERLKL
Sbjct  138  RRDGSHLLNGTSSGLSGNNPLMRQNQSTANVMATKMYEERLKL  180



>ref|XP_010232006.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Brachypodium distachyon]
Length=877

 Score =   170 bits (430),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY +KR+L+A+A+AFQAEG VSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFMKRNLQATAKAFQAEGNVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLVKAR  87


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNGT +G+ GN+ L+RQN   A  ++ K Y ERLKL
Sbjct  138  RRDGSHLLNGTSSGLSGNNPLMRQNQSTANVMATKMYEERLKL  180



>ref|XP_010232005.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Brachypodium distachyon]
Length=878

 Score =   170 bits (430),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY +KR+L+A+A+AFQAEG VSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFMKRNLQATAKAFQAEGNVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLVKAR  87


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDGS+LLNGT +G+ GN+ L+RQN   A  ++ K Y ERLKL
Sbjct  138  RRDGSHLLNGTSSGLSGNNPLMRQNQSTANVMATKMYEERLKL  180



>ref|XP_009407638.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=889

 Score =   170 bits (430),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DYL+KR+L ASA+ FQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYLMKRNLHASAKTFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +2

Query  506  DGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            DG++LLNG  NG+V  D L+RQNPG A AL+ K Y ERLKL
Sbjct  153  DGAHLLNGAANGLVTGDPLMRQNPGTANALATKMYEERLKL  193



>ref|XP_009407639.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=888

 Score =   170 bits (430),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DYL+KR+L ASA+ FQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYLMKRNLHASAKTFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQL+K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQLIKAR  87


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +2

Query  506  DGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            DG++LLNG  NG+V  D L+RQNPG A AL+ K Y ERLKL
Sbjct  153  DGAHLLNGAANGLVTGDPLMRQNPGTANALATKMYEERLKL  193



>ref|XP_010915804.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Elaeis 
guineensis]
Length=895

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DYLVKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYLVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQ  K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQHAKAR  87


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  506  DGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            +G++LLNGT NG+VG+DSLIRQ+PG A AL+ K Y ERLKL
Sbjct  151  EGAHLLNGTANGLVGSDSLIRQSPGTANALATKMYEERLKL  191



>ref|XP_010915881.1| PREDICTED: transcriptional corepressor LEUNIG isoform X4 [Elaeis 
guineensis]
Length=891

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DYLVKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYLVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQ  K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQHAKAR  87


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  506  DGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            +G++LLNGT NG+VG+DSLIRQ+PG A AL+ K Y ERLKL
Sbjct  151  EGAHLLNGTANGLVGSDSLIRQSPGTANALATKMYEERLKL  191



>ref|XP_010915729.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Elaeis 
guineensis]
Length=901

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DYLVKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYLVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQ  K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQHAKAR  87


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  506  DGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            +G++LLNGT NG+VG+DSLIRQ+PG A AL+ K Y ERLKL
Sbjct  151  EGAHLLNGTANGLVGSDSLIRQSPGTANALATKMYEERLKL  191



>ref|XP_010915657.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Elaeis 
guineensis]
Length=904

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DYLVKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYLVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQ  K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQHAKAR  87


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  506  DGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            +G++LLNGT NG+VG+DSLIRQ+PG A AL+ K Y ERLKL
Sbjct  151  EGAHLLNGTANGLVGSDSLIRQSPGTANALATKMYEERLKL  191



>ref|XP_008811606.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional corepressor LEUNIG 
[Phoenix dactylifera]
Length=911

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DYLVKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYLVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSDVAASYIETQ  K R
Sbjct  61   DIFIARTNEKHSDVAASYIETQHAKPR  87


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RR+G++LLNGT NG+VG+DSLIRQ+PG A AL+AK Y ERLKL
Sbjct  170  RREGAHLLNGTANGLVGSDSLIRQSPGTANALAAKMYEERLKL  212



>ref|XP_010527324.1| PREDICTED: transcriptional corepressor LEUNIG-like, partial [Tarenaya 
hassleriana]
Length=91

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDYL+KR L ASA AFQAEGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYLIKRKLHASANAFQAEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQ  286
            DIFIARTN+KHS+ AA+Y+E +
Sbjct  61   DIFIARTNEKHSEAAAAYLEVR  82



>ref|XP_010688121.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=809

 Score =   167 bits (424),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 76/87 (87%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDY VKR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYFVKRKLHASAKAFQQEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSD AASYIETQ+ K R
Sbjct  61   DIFIARTNEKHSDAAASYIETQISKAR  87



>ref|XP_010548471.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Tarenaya hassleriana]
Length=899

 Score =   168 bits (425),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 80/97 (82%), Positives = 86/97 (89%), Gaps = 10/97 (10%)
 Frame = +2

Query  41   MSQTNWEADKM----------LDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGG  190
            MSQTNWEADK+          LDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGG
Sbjct  1    MSQTNWEADKIYYLRWKKSYRLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGG  60

Query  191  FLFEWWSVFWDIFIARTNDKHSDVAASYIETQLMKVR  301
            FLFEWWSVFWD+FIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   FLFEWWSVFWDMFIARTNEKHSEVAASYIETQMMKAR  97



>ref|XP_010688120.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=849

 Score =   167 bits (424),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 76/87 (87%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDY VKR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYFVKRKLHASAKAFQQEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSD AASYIETQ+ K R
Sbjct  61   DIFIARTNEKHSDAAASYIETQISKAR  87



>ref|XP_010548470.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Tarenaya hassleriana]
Length=904

 Score =   168 bits (425),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 80/97 (82%), Positives = 86/97 (89%), Gaps = 10/97 (10%)
 Frame = +2

Query  41   MSQTNWEADKM----------LDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGG  190
            MSQTNWEADK+          LDVYIHDYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGG
Sbjct  1    MSQTNWEADKIYYLRWKKSYRLDVYIHDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGG  60

Query  191  FLFEWWSVFWDIFIARTNDKHSDVAASYIETQLMKVR  301
            FLFEWWSVFWD+FIARTN+KHS+VAASYIETQ+MK R
Sbjct  61   FLFEWWSVFWDMFIARTNEKHSEVAASYIETQMMKAR  97



>ref|XP_009403020.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=858

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYL+KRDL+A+A++FQAE KVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLMKRDLQATAKSFQAEAKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSD AASYIETQ +K R
Sbjct  61   DIFIARTNEKHSDAAASYIETQHLKAR  87


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  503  RDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            R+GS +LNG  +G+V  D L+RQNPG A AL+ K Y ERLKL
Sbjct  129  REGSQVLNGNASGLVSADPLMRQNPGTANALATKMYEERLKL  170



>ref|XP_009403018.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009403019.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=863

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYL+KRDL+A+A++FQAE KVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLMKRDLQATAKSFQAEAKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSD AASYIETQ +K R
Sbjct  61   DIFIARTNEKHSDAAASYIETQHLKAR  87


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  503  RDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            R+GS +LNG  +G+V  D L+RQNPG A AL+ K Y ERLKL
Sbjct  129  REGSQVLNGNASGLVSADPLMRQNPGTANALATKMYEERLKL  170



>ref|XP_004969117.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Setaria italica]
Length=864

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  50   TNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFWDIF  229
            TNWEADKMLDVYI+DY VKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFWDIF
Sbjct  18   TNWEADKMLDVYIYDYFVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFWDIF  77

Query  230  IARTNDKHSDVAASYIETQLMKVR  301
            IARTN+KHSDVAASYIETQL+K R
Sbjct  78   IARTNEKHSDVAASYIETQLIKAR  101



>ref|XP_002962710.1| hypothetical protein SELMODRAFT_79275 [Selaginella moellendorffii]
 gb|EFJ36173.1| hypothetical protein SELMODRAFT_79275 [Selaginella moellendorffii]
Length=908

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYIHDYLVK++L+ASA+AFQ EGKVS DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIHDYLVKKNLQASAKAFQTEGKVSGDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ +K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQQLKAR  87



>ref|XP_002980381.1| hypothetical protein SELMODRAFT_112245 [Selaginella moellendorffii]
 gb|EFJ18641.1| hypothetical protein SELMODRAFT_112245 [Selaginella moellendorffii]
Length=913

 Score =   167 bits (423),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYIHDYLVK++L+ASA+AFQ EGKVS DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIHDYLVKKNLQASAKAFQTEGKVSGDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAASYIETQ +K R
Sbjct  61   DIFIARTNEKHSEVAASYIETQQLKAR  87



>gb|KJB64845.1| hypothetical protein B456_010G067800 [Gossypium raimondii]
Length=846

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYL+KR L A+A+AFQAEGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLMKRKLNATAKAFQAEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AASYIETQ++K R
Sbjct  61   DIFIARTNEKHSEAAASYIETQMVKAR  87



>gb|KJB64846.1| hypothetical protein B456_010G067800 [Gossypium raimondii]
Length=867

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYL+KR L A+A+AFQAEGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLMKRKLNATAKAFQAEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AASYIETQ++K R
Sbjct  61   DIFIARTNEKHSEAAASYIETQMVKAR  87



>ref|XP_010925121.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Elaeis guineensis]
Length=868

 Score =   167 bits (422),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYLVKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS VA+SYIETQ  K R
Sbjct  61   DIFIARTNEKHSVVASSYIETQHAKAR  87


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  503  RDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            R+G++L+NGT+NG+VG+DSL+RQ  G A AL+ K Y ERLKL
Sbjct  128  REGAHLVNGTMNGLVGSDSLMRQGSGIANALATKMYEERLKL  169



>emb|CDY13494.1| BnaA03g52120D [Brassica napus]
Length=887

 Score =   166 bits (421),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 76/80 (95%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYLVKRDLKA+AQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLVKRDLKATAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIE  280
            DIFIARTN+KHS+VAASYIE
Sbjct  61   DIFIARTNEKHSEVAASYIE  80



>ref|XP_010925120.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Elaeis guineensis]
Length=877

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYLVKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS VA+SYIETQ  K R
Sbjct  61   DIFIARTNEKHSVVASSYIETQHAKAR  87


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  503  RDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            R+G++L+NGT+NG+VG+DSL+RQ  G A AL+ K Y ERLKL
Sbjct  128  REGAHLVNGTMNGLVGSDSLMRQGSGIANALATKMYEERLKL  169



>ref|XP_009784360.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Nicotiana sylvestris]
Length=345

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYIHDYL+KR L  SA+AF  EGKV++DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIHDYLLKRKLHNSAKAFMTEGKVATDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AA+YIETQ MK R
Sbjct  61   DIFIARTNEKHSEAAAAYIETQQMKAR  87



>ref|XP_009405103.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=859

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYL+KR L+A+A+AFQAE KVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLMKRKLQATAKAFQAEAKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSD AASYIETQ +K R
Sbjct  61   DIFIARTNEKHSDAAASYIETQHLKAR  87


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RR+ + LLNG  +G+VG D L+RQNPG A AL+ K Y ERLKL
Sbjct  126  RREVAQLLNGNASGLVGTDPLMRQNPGTANALATKMYEERLKL  168



>ref|XP_009405109.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=858

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYL+KR L+A+A+AFQAE KVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLMKRKLQATAKAFQAEAKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSD AASYIETQ +K R
Sbjct  61   DIFIARTNEKHSDAAASYIETQHLKAR  87


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RR+ + LLNG  +G+VG D L+RQNPG A AL+ K Y ERLKL
Sbjct  126  RREVAQLLNGNASGLVGTDPLMRQNPGTANALATKMYEERLKL  168



>ref|XP_009405115.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=846

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYL+KR L+A+A+AFQAE KVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLMKRKLQATAKAFQAEAKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSD AASYIETQ +K R
Sbjct  61   DIFIARTNEKHSDAAASYIETQHLKAR  87


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RR+ + LLNG  +G+VG D L+RQNPG A AL+ K Y ERLKL
Sbjct  126  RREVAQLLNGNASGLVGTDPLMRQNPGTANALATKMYEERLKL  168



>ref|XP_009784357.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009784358.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009784359.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Nicotiana sylvestris]
Length=366

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYIHDYL+KR L  SA+AF  EGKV++DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIHDYLLKRKLHNSAKAFMTEGKVATDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AA+YIETQ MK R
Sbjct  61   DIFIARTNEKHSEAAAAYIETQQMKAR  87



>ref|XP_010656383.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Vitis vinifera]
Length=870

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDY +KR L ASA+AFQAE KVS++PVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYFLKRKLHASAKAFQAEAKVSTEPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEAAASYIETQLIKAR  87


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +2

Query  506  DGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            DG+ +LNG+ NG+V ND+L+RQNP  A  L+ K Y ERLKL
Sbjct  143  DGTQILNGSGNGLVSNDALMRQNPATANTLATKMYEERLKL  183



>ref|XP_010656382.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Vitis vinifera]
 emb|CBI28132.3| unnamed protein product [Vitis vinifera]
Length=871

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYIHDY +KR L ASA+AFQAE KVS++PVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIHDYFLKRKLHASAKAFQAEAKVSTEPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AASYIETQL+K R
Sbjct  61   DIFIARTNEKHSEAAASYIETQLIKAR  87


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +2

Query  506  DGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            DG+ +LNG+ NG+V ND+L+RQNP  A  L+ K Y ERLKL
Sbjct  143  DGTQILNGSGNGLVSNDALMRQNPATANTLATKMYEERLKL  183



>gb|KDO80402.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=509

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DYL+KR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYLLKRKLHASAKAFQTEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AASYIE+Q++K R
Sbjct  61   DIFIARTNEKHSESAASYIESQVIKAR  87



>ref|XP_002458130.1| hypothetical protein SORBIDRAFT_03g027390 [Sorghum bicolor]
 gb|EES03250.1| hypothetical protein SORBIDRAFT_03g027390 [Sorghum bicolor]
Length=716

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY VKR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFVKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVRG  304
            DIFIARTN+KHSDVAASYIE    K  G
Sbjct  61   DIFIARTNEKHSDVAASYIERTFFKPCG  88



>ref|XP_009371420.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Pyrus x bretschneideri]
Length=851

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  44   SQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFWD  223
            SQTNWEADKMLDVYI+DYL+KR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFWD
Sbjct  4    SQTNWEADKMLDVYIYDYLMKRKLHASAKAFQDEGKVSTDPVAIDAPGGFLFEWWSVFWD  63

Query  224  IFIARTNDKHSDVAASYIETQLMKVR  301
            IFIARTN+KHS+ AASYIETQ++KVR
Sbjct  64   IFIARTNEKHSEAAASYIETQVIKVR  89



>ref|XP_009371419.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Pyrus x bretschneideri]
Length=853

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  44   SQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFWD  223
            SQTNWEADKMLDVYI+DYL+KR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFWD
Sbjct  4    SQTNWEADKMLDVYIYDYLMKRKLHASAKAFQDEGKVSTDPVAIDAPGGFLFEWWSVFWD  63

Query  224  IFIARTNDKHSDVAASYIETQLMKVR  301
            IFIARTN+KHS+ AASYIETQ++KVR
Sbjct  64   IFIARTNEKHSEAAASYIETQVIKVR  89



>gb|EEE54961.1| hypothetical protein OsJ_02550 [Oryza sativa Japonica Group]
Length=881

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 84/92 (91%), Gaps = 5/92 (5%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY +KR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFMKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIE-----TQLMKVR  301
            DIFIARTN+KHSDVAASYIE     TQ MK R
Sbjct  61   DIFIARTNEKHSDVAASYIEIHHKQTQHMKAR  92


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT +G+ GN+ L+RQN   A  ++ K Y ERLKL
Sbjct  152  RRDGTHLLNGTASGLPGNNPLMRQNQSTANVMATKMYEERLKL  194



>ref|XP_010533194.1| PREDICTED: transcriptional corepressor LEUNIG-like [Tarenaya 
hassleriana]
Length=855

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DYLVKR L ASA+AFQAEGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYLVKRKLHASAKAFQAEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ A++Y+E+Q++K R
Sbjct  61   DIFIARTNEKHSEAASAYLESQMLKAR  87



>gb|EEC71055.1| hypothetical protein OsI_02792 [Oryza sativa Indica Group]
Length=882

 Score =   164 bits (416),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 84/92 (91%), Gaps = 5/92 (5%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY +KR+L+A+A+AFQAEGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYFMKRNLQATAKAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIE-----TQLMKVR  301
            DIFIARTN+KHSDVAASYIE     TQ MK R
Sbjct  61   DIFIARTNEKHSDVAASYIEIHHKQTQHMKAR  92


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  500  RRDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RRDG++LLNGT +G+ GN+ L+RQN   A  ++ K Y ERLKL
Sbjct  153  RRDGTHLLNGTASGLPGNNPLMRQNQSTANVMATKMYEERLKL  195



>ref|XP_008242693.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Prunus mume]
Length=869

 Score =   164 bits (416),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +2

Query  44   SQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFWD  223
            SQTNWEADKMLDVYI+DYL+KR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFWD
Sbjct  4    SQTNWEADKMLDVYIYDYLMKRKLHASAKAFQDEGKVSTDPVAIDAPGGFLFEWWSVFWD  63

Query  224  IFIARTNDKHSDVAASYIETQLMKVR  301
            IFIARTN+KHS+ AASYIETQ+MK R
Sbjct  64   IFIARTNEKHSEAAASYIETQVMKAR  89


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  503  RDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RDG+ LLNGT NG+VGND L+RQNP  A +++ K Y ERLKL
Sbjct  151  RDGTQLLNGTANGLVGNDPLLRQNPATANSMATKMYEERLKL  192



>ref|XP_008242692.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Prunus mume]
Length=874

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +2

Query  44   SQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFWD  223
            SQTNWEADKMLDVYI+DYL+KR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFWD
Sbjct  4    SQTNWEADKMLDVYIYDYLMKRKLHASAKAFQDEGKVSTDPVAIDAPGGFLFEWWSVFWD  63

Query  224  IFIARTNDKHSDVAASYIETQLMKVR  301
            IFIARTN+KHS+ AASYIETQ+MK R
Sbjct  64   IFIARTNEKHSEAAASYIETQVMKAR  89


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  503  RDGSNLLNGTVNGVVGNDSLIRQNPG-AXALSAKAYXERLKL  625
            RDG+ LLNGT NG+VGND L+RQNP  A +++ K Y ERLKL
Sbjct  151  RDGTQLLNGTANGLVGNDPLLRQNPATANSMATKMYEERLKL  192



>gb|KDP32334.1| hypothetical protein JCGZ_13259 [Jatropha curcas]
Length=852

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +2

Query  47   QTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFWDI  226
            QTNWEADKMLDVYI+DYL+KR L ASA+AFQAEGKVS+DPVAIDAPGGFLFEWWSVFWDI
Sbjct  5    QTNWEADKMLDVYIYDYLLKRKLNASAKAFQAEGKVSTDPVAIDAPGGFLFEWWSVFWDI  64

Query  227  FIARTNDKHSDVAASYIETQLMKVR  301
            FIARTN+KHS+ AASYIETQ++K R
Sbjct  65   FIARTNEKHSEAAASYIETQMVKAR  89



>gb|KDO80401.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=655

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DYL+KR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYLLKRKLHASAKAFQTEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AASYIE+Q++K R
Sbjct  61   DIFIARTNEKHSESAASYIESQVIKAR  87



>gb|KDO80397.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=725

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DYL+KR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYLLKRKLHASAKAFQTEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AASYIE+Q++K R
Sbjct  61   DIFIARTNEKHSESAASYIESQVIKAR  87



>gb|KDO80400.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=695

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DYL+KR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYLLKRKLHASAKAFQTEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AASYIE+Q++K R
Sbjct  61   DIFIARTNEKHSESAASYIESQVIKAR  87



>ref|XP_002969651.1| hypothetical protein SELMODRAFT_410492 [Selaginella moellendorffii]
 gb|EFJ29739.1| hypothetical protein SELMODRAFT_410492 [Selaginella moellendorffii]
Length=835

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYIHDYL KR+L+ SA+AF  EGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIHDYLTKRNLQNSAKAFFTEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAA+YIETQ +K R
Sbjct  61   DIFIARTNEKHSEVAAAYIETQKLKAR  87



>ref|XP_008386062.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Malus domestica]
Length=855

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +2

Query  44   SQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFWD  223
            SQTNWEADKMLDVYI+DYL+KR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFWD
Sbjct  4    SQTNWEADKMLDVYIYDYLMKRKLHASAKAFQDEGKVSTDPVAIDAPGGFLFEWWSVFWD  63

Query  224  IFIARTNDKHSDVAASYIETQLMKVR  301
            IFIARTN+KHS+ AASYIETQ++K R
Sbjct  64   IFIARTNEKHSEAAASYIETQVIKAR  89



>gb|KDO80394.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=768

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DYL+KR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYLLKRKLHASAKAFQTEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AASYIE+Q++K R
Sbjct  61   DIFIARTNEKHSESAASYIESQVIKAR  87



>ref|XP_009400486.1| PREDICTED: transcriptional corepressor LEUNIG-like [Musa acuminata 
subsp. malaccensis]
Length=784

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYIHDYL+KR+L+A+A+AF+ EGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIHDYLLKRNLQATAKAFKEEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVRGE  307
            DIFIARTN+KHS VAA+YIETQ  K + E
Sbjct  61   DIFIARTNEKHSQVAAAYIETQRTKAKEE  89



>ref|XP_008386053.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Malus domestica]
Length=856

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +2

Query  44   SQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFWD  223
            SQTNWEADKMLDVYI+DYL+KR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFWD
Sbjct  4    SQTNWEADKMLDVYIYDYLMKRKLHASAKAFQDEGKVSTDPVAIDAPGGFLFEWWSVFWD  63

Query  224  IFIARTNDKHSDVAASYIETQLMKVR  301
            IFIARTN+KHS+ AASYIETQ++K R
Sbjct  64   IFIARTNEKHSEAAASYIETQVIKAR  89



>ref|XP_008386048.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Malus domestica]
Length=860

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +2

Query  44   SQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFWD  223
            SQTNWEADKMLDVYI+DYL+KR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFWD
Sbjct  4    SQTNWEADKMLDVYIYDYLMKRKLHASAKAFQDEGKVSTDPVAIDAPGGFLFEWWSVFWD  63

Query  224  IFIARTNDKHSDVAASYIETQLMKVR  301
            IFIARTN+KHS+ AASYIETQ++K R
Sbjct  64   IFIARTNEKHSEAAASYIETQVIKAR  89



>ref|NP_001053284.1| Os04g0510200 [Oryza sativa Japonica Group]
 dbj|BAF15198.1| Os04g0510200, partial [Oryza sativa Japonica Group]
Length=383

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYI+DYL+KR+L+A+A++F AEGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIYDYLLKRNLQATAKSFMAEGKVSADPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS++AA+Y+E Q  K R
Sbjct  61   DIFIARTNEKHSEIAAAYLEAQQTKAR  87



>gb|KDO80398.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
 gb|KDO80399.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=743

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DYL+KR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYLLKRKLHASAKAFQTEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AASYIE+Q++K R
Sbjct  61   DIFIARTNEKHSESAASYIESQVIKAR  87



>ref|XP_011458499.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=872

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +2

Query  44   SQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFWD  223
            SQ NWEADKMLDVYI+DYL+KR+L ASA+AFQAEGKVS+DPVAIDAPGGFLFEWWSVFWD
Sbjct  3    SQANWEADKMLDVYIYDYLLKRNLHASAKAFQAEGKVSTDPVAIDAPGGFLFEWWSVFWD  62

Query  224  IFIARTNDKHSDVAASYIETQLMKVR  301
            IFIARTN+KHS+ AASYIETQ+ K R
Sbjct  63   IFIARTNEKHSEAAASYIETQVNKAR  88



>ref|XP_004287384.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=874

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +2

Query  44   SQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFWD  223
            SQ NWEADKMLDVYI+DYL+KR+L ASA+AFQAEGKVS+DPVAIDAPGGFLFEWWSVFWD
Sbjct  3    SQANWEADKMLDVYIYDYLLKRNLHASAKAFQAEGKVSTDPVAIDAPGGFLFEWWSVFWD  62

Query  224  IFIARTNDKHSDVAASYIETQLMKVR  301
            IFIARTN+KHS+ AASYIETQ+ K R
Sbjct  63   IFIARTNEKHSEAAASYIETQVNKAR  88



>ref|XP_007013298.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 3, partial [Theobroma cacao]
 gb|EOY30917.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 3, partial [Theobroma cacao]
Length=712

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY++KR + A+A+A QAEGKVS+DPVAID PGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYMIKRKMHATAKALQAEGKVSTDPVAIDVPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AASYIE+Q++K R
Sbjct  61   DIFIARTNEKHSEAAASYIESQMVKAR  87



>ref|XP_002970913.1| hypothetical protein SELMODRAFT_94317 [Selaginella moellendorffii]
 gb|EFJ28239.1| hypothetical protein SELMODRAFT_94317 [Selaginella moellendorffii]
Length=860

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYIHDYL KR+L+ SA+AF  EGKVSSDPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIHDYLTKRNLQNSAKAFFTEGKVSSDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAA+YIETQ +K R
Sbjct  61   DIFIARTNEKHSEVAAAYIETQKLKAR  87



>ref|XP_002266172.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Vitis 
vinifera]
 ref|XP_010652503.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Vitis 
vinifera]
 ref|XP_010652504.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Vitis 
vinifera]
 ref|XP_010652505.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Vitis 
vinifera]
 emb|CBI37316.3| unnamed protein product [Vitis vinifera]
Length=779

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYIHDYL+KR L ASA+AF  EGKV++DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIHDYLLKRKLHASAKAFMTEGKVATDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTNDKHS+ AA+YIE Q MK R
Sbjct  61   DIFIARTNDKHSEAAAAYIEAQQMKAR  87



>ref|XP_010652506.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Vitis 
vinifera]
Length=772

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYIHDYL+KR L ASA+AF  EGKV++DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIHDYLLKRKLHASAKAFMTEGKVATDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTNDKHS+ AA+YIE Q MK R
Sbjct  61   DIFIARTNDKHSEAAAAYIEAQQMKAR  87



>ref|XP_006475763.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Citrus sinensis]
 gb|KDO80393.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=837

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DYL+KR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYLLKRKLHASAKAFQTEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AASYIE+Q++K R
Sbjct  61   DIFIARTNEKHSESAASYIESQVIKAR  87



>gb|KDO80395.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=835

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DYL+KR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYLLKRKLHASAKAFQTEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AASYIE+Q++K R
Sbjct  61   DIFIARTNEKHSESAASYIESQVIKAR  87



>ref|XP_006451037.1| hypothetical protein CICLE_v10007449mg [Citrus clementina]
 gb|ESR64277.1| hypothetical protein CICLE_v10007449mg [Citrus clementina]
Length=837

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DYL+KR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYLLKRKLHASAKAFQTEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AASYIE+Q++K R
Sbjct  61   DIFIARTNEKHSESAASYIESQVIKAR  87



>gb|KDO80396.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=834

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DYL+KR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYLLKRKLHASAKAFQTEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AASYIE+Q++K R
Sbjct  61   DIFIARTNEKHSESAASYIESQVIKAR  87



>ref|XP_006475762.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Citrus sinensis]
 gb|KDO80392.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=842

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQ NWEADKMLDVYI+DYL+KR L ASA+AFQ EGKVS+DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MSQNNWEADKMLDVYIYDYLLKRKLHASAKAFQTEGKVSTDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AASYIE+Q++K R
Sbjct  61   DIFIARTNEKHSESAASYIESQVIKAR  87



>ref|XP_010264093.1| PREDICTED: transcriptional corepressor LEUNIG-like [Nelumbo nucifera]
Length=799

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYI+DYL+KR+L ASA+AF AEGKV++DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIYDYLLKRNLHASAKAFMAEGKVAADPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAA+YIE Q MK R
Sbjct  61   DIFIARTNEKHSEVAAAYIEAQQMKAR  87



>gb|KJB10968.1| hypothetical protein B456_001G234100 [Gossypium raimondii]
Length=704

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYIHDYL+KR L ASA+AF  EGKV++DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIHDYLLKRKLHASAKAFMTEGKVATDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AA+YIE+Q +K R
Sbjct  61   DIFIARTNEKHSEAAAAYIESQQLKAR  87



>gb|KJB10964.1| hypothetical protein B456_001G234100 [Gossypium raimondii]
Length=716

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYIHDYL+KR L ASA+AF  EGKV++DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIHDYLLKRKLHASAKAFMTEGKVATDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AA+YIE+Q +K R
Sbjct  61   DIFIARTNEKHSEAAAAYIESQQLKAR  87



>ref|XP_010684998.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional corepressor LEUNIG 
[Beta vulgaris subsp. vulgaris]
Length=777

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYIHDYL+KR L  SA+AF AEGKV++DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIHDYLLKRKLLNSAKAFMAEGKVATDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AA+YIETQ MK R
Sbjct  61   DIFIARTNEKHSEAAAAYIETQQMKTR  87



>ref|XP_010532885.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010532886.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Tarenaya hassleriana]
Length=754

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYIHDYL+KR L  SA+AF AEGKV+ DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIHDYLLKRKLHNSAKAFMAEGKVADDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSD AA+YIE Q MK R
Sbjct  61   DIFIARTNEKHSDAAAAYIEAQQMKTR  87



>gb|KHG14548.1| Transcriptional corepressor LEUNIG -like protein [Gossypium arboreum]
Length=726

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYIHDYL+KR L ASA+AF  EGKV++DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIHDYLLKRKLHASAKAFMTEGKVATDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AA+YIE+Q +K R
Sbjct  61   DIFIARTNEKHSEAAAAYIESQQLKAR  87



>ref|XP_010532887.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Tarenaya hassleriana]
Length=751

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYIHDYL+KR L  SA+AF AEGKV+ DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIHDYLLKRKLHNSAKAFMAEGKVADDPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHSD AA+YIE Q MK R
Sbjct  61   DIFIARTNEKHSDAAAAYIEAQQMKTR  87



>ref|XP_010245981.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Nelumbo nucifera]
Length=758

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYI+DYL+KR+L ASA+AF +EGKV++DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIYDYLLKRNLHASAKAFMSEGKVAADPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAA+YIE Q MK R
Sbjct  61   DIFIARTNEKHSEVAAAYIEAQQMKAR  87



>ref|XP_010934267.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Elaeis guineensis]
Length=799

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYI+DYLVKR+L+ +A+AF AEGKV++DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIYDYLVKRNLQTTAKAFMAEGKVAADPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAA+YIE Q MK R
Sbjct  61   DIFIARTNEKHSEVAAAYIEAQQMKAR  87



>ref|XP_007013296.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
 gb|EOY30915.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
Length=863

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            MSQTNWEADKMLDVYI+DY++KR + A+A+A QAEGKVS+DPVAID PGGFLFEWWSVFW
Sbjct  1    MSQTNWEADKMLDVYIYDYMIKRKMHATAKALQAEGKVSTDPVAIDVPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+ AASYIE+Q++K R
Sbjct  61   DIFIARTNEKHSEAAASYIESQMVKAR  87



>ref|XP_010934265.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Elaeis guineensis]
 ref|XP_010934266.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Elaeis guineensis]
Length=801

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  41   MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKVSSDPVAIDAPGGFLFEWWSVFW  220
            M+Q+NWEADKMLDVYI+DYLVKR+L+ +A+AF AEGKV++DPVAIDAPGGFLFEWWSVFW
Sbjct  1    MAQSNWEADKMLDVYIYDYLVKRNLQTTAKAFMAEGKVAADPVAIDAPGGFLFEWWSVFW  60

Query  221  DIFIARTNDKHSDVAASYIETQLMKVR  301
            DIFIARTN+KHS+VAA+YIE Q MK R
Sbjct  61   DIFIARTNEKHSEVAAAYIEAQQMKAR  87



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250