BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS037H12

Length=621
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009784886.1|  PREDICTED: probable leucine-rich repeat rece...    219   9e-64   Nicotiana sylvestris
ref|XP_009605195.1|  PREDICTED: probable leucine-rich repeat rece...    222   1e-63   Nicotiana tomentosiformis
ref|XP_002303227.1|  hypothetical protein POPTR_0003s03700g             207   2e-61   
ref|XP_009605193.1|  PREDICTED: probable leucine-rich repeat rece...    214   1e-60   Nicotiana tomentosiformis
ref|XP_004230391.1|  PREDICTED: probable leucine-rich repeat rece...    213   2e-60   Solanum lycopersicum
gb|EYU33236.1|  hypothetical protein MIMGU_mgv1a021943mg                213   2e-60   Erythranthe guttata [common monkey flower]
ref|XP_006358482.1|  PREDICTED: probable leucine-rich repeat rece...    209   6e-59   Solanum tuberosum [potatoes]
gb|EYU33238.1|  hypothetical protein MIMGU_mgv1a025286mg                209   6e-59   Erythranthe guttata [common monkey flower]
ref|XP_009803111.1|  PREDICTED: probable leucine-rich repeat rece...    207   2e-58   Nicotiana sylvestris
emb|CDO97682.1|  unnamed protein product                                204   2e-57   Coffea canephora [robusta coffee]
ref|XP_009784887.1|  PREDICTED: probable leucine-rich repeat rece...    201   6e-57   Nicotiana sylvestris
ref|XP_006358481.1|  PREDICTED: probable leucine-rich repeat rece...    203   6e-57   Solanum tuberosum [potatoes]
gb|EYU33237.1|  hypothetical protein MIMGU_mgv1a000884mg                203   7e-57   Erythranthe guttata [common monkey flower]
ref|XP_004230392.1|  PREDICTED: probable leucine-rich repeat rece...    202   1e-56   Solanum lycopersicum
ref|XP_010682082.1|  PREDICTED: probable leucine-rich repeat rece...    200   1e-55   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS63997.1|  hypothetical protein M569_10784                         192   2e-55   Genlisea aurea
gb|KHG19770.1|  hypothetical protein F383_03980                         198   3e-55   Gossypium arboreum [tree cotton]
ref|XP_007023745.1|  Leucine-rich repeat protein kinase family pr...    197   3e-55   
ref|XP_007023744.1|  Leucine-rich repeat protein kinase family pr...    198   3e-55   
ref|XP_007023743.1|  Leucine-rich repeat protein kinase family pr...    198   5e-55   
ref|XP_011092239.1|  PREDICTED: probable leucine-rich repeat rece...    197   8e-55   Sesamum indicum [beniseed]
gb|AES64685.2|  LRR receptor-like kinase                                197   1e-54   Medicago truncatula
ref|XP_003594434.1|  Somatic embryogenesis receptor-like kinase         197   1e-54   
ref|XP_002519381.1|  Serine/threonine-protein kinase PBS1, putative     197   1e-54   Ricinus communis
ref|XP_006385116.1|  leucine-rich repeat family protein                 197   1e-54   Populus trichocarpa [western balsam poplar]
ref|XP_011028448.1|  PREDICTED: probable leucine-rich repeat rece...    196   2e-54   Populus euphratica
gb|KJB68015.1|  hypothetical protein B456_010G221900                    195   2e-54   Gossypium raimondii
gb|KJB68018.1|  hypothetical protein B456_010G221900                    195   2e-54   Gossypium raimondii
ref|XP_011028446.1|  PREDICTED: probable leucine-rich repeat rece...    196   3e-54   Populus euphratica
gb|KJB68014.1|  hypothetical protein B456_010G221900                    195   5e-54   Gossypium raimondii
ref|XP_010657900.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    195   1e-53   
ref|XP_006358480.1|  PREDICTED: probable leucine-rich repeat rece...    194   1e-53   
gb|KDO40686.1|  hypothetical protein CISIN_1g002189mg                   194   1e-53   Citrus sinensis [apfelsine]
ref|XP_006431373.1|  hypothetical protein CICLE_v10000176mg             194   2e-53   Citrus clementina [clementine]
ref|XP_010065204.1|  PREDICTED: probable leucine-rich repeat rece...    194   2e-53   Eucalyptus grandis [rose gum]
gb|KCW62551.1|  hypothetical protein EUGRSUZ_G00043                     194   2e-53   Eucalyptus grandis [rose gum]
gb|KCW62549.1|  hypothetical protein EUGRSUZ_G00041                     193   3e-53   Eucalyptus grandis [rose gum]
ref|XP_006470792.1|  PREDICTED: probable leucine-rich repeat rece...    193   3e-53   Citrus sinensis [apfelsine]
ref|XP_010682075.1|  PREDICTED: probable leucine-rich repeat rece...    193   3e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010067941.1|  PREDICTED: probable leucine-rich repeat rece...    193   4e-53   
gb|KCW62550.1|  hypothetical protein EUGRSUZ_G00041                     192   4e-53   Eucalyptus grandis [rose gum]
ref|XP_006385112.1|  hypothetical protein POPTR_0004s24030g             193   4e-53   Populus trichocarpa [western balsam poplar]
emb|CBI29612.3|  unnamed protein product                                194   6e-53   Vitis vinifera
ref|XP_010252241.1|  PREDICTED: probable leucine-rich repeat rece...    192   7e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010065206.1|  PREDICTED: probable leucine-rich repeat rece...    191   2e-52   
gb|KJB68016.1|  hypothetical protein B456_010G221900                    191   2e-52   Gossypium raimondii
ref|XP_004486417.1|  PREDICTED: probable leucine-rich repeat rece...    190   4e-52   Cicer arietinum [garbanzo]
gb|KCW62545.1|  hypothetical protein EUGRSUZ_G00037                     190   4e-52   Eucalyptus grandis [rose gum]
ref|XP_010065205.1|  PREDICTED: probable leucine-rich repeat rece...    190   6e-52   
ref|XP_007156284.1|  hypothetical protein PHAVU_003G273700g             190   6e-52   Phaseolus vulgaris [French bean]
ref|XP_011092237.1|  PREDICTED: probable leucine-rich repeat rece...    189   8e-52   Sesamum indicum [beniseed]
ref|XP_010682077.1|  PREDICTED: probable leucine-rich repeat rece...    189   1e-51   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH37006.1|  LRR receptor-like kinase                                189   1e-51   Medicago truncatula
emb|CDX83185.1|  BnaA03g23210D                                          177   2e-51   
ref|XP_010088710.1|  putative leucine-rich repeat receptor-like p...    189   2e-51   
ref|XP_010533231.1|  PREDICTED: probable leucine-rich repeat rece...    187   4e-51   Tarenaya hassleriana [spider flower]
ref|XP_010521415.1|  PREDICTED: probable leucine-rich repeat rece...    187   7e-51   Tarenaya hassleriana [spider flower]
ref|XP_007019716.1|  Leucine-rich repeat protein kinase family pr...    187   8e-51   
ref|XP_010065203.1|  PREDICTED: probable leucine-rich repeat rece...    186   1e-50   
gb|KCW62548.1|  hypothetical protein EUGRSUZ_G00040                     186   2e-50   Eucalyptus grandis [rose gum]
ref|XP_011464972.1|  PREDICTED: probable leucine-rich repeat rece...    186   2e-50   Fragaria vesca subsp. vesca
ref|XP_006836951.1|  hypothetical protein AMTR_s00099p00159710          184   5e-50   
ref|XP_010682076.1|  PREDICTED: probable leucine-rich repeat rece...    184   6e-50   
ref|XP_008366930.1|  PREDICTED: probable leucine-rich repeat rece...    172   1e-49   
ref|XP_011088111.1|  PREDICTED: probable leucine-rich repeat rece...    183   1e-49   
gb|EPS73565.1|  hypothetical protein M569_01189                         183   1e-49   Genlisea aurea
gb|KJB29748.1|  hypothetical protein B456_005G116800                    181   2e-49   Gossypium raimondii
ref|XP_006481666.1|  PREDICTED: probable leucine-rich repeat rece...    182   3e-49   Citrus sinensis [apfelsine]
emb|CDY68959.1|  BnaCnng61190D                                          175   3e-49   Brassica napus [oilseed rape]
gb|KDO70764.1|  hypothetical protein CISIN_1g002121mg                   182   3e-49   Citrus sinensis [apfelsine]
gb|KHN40734.1|  Putative leucine-rich repeat receptor-like protei...    181   6e-49   Glycine soja [wild soybean]
gb|KJB29747.1|  hypothetical protein B456_005G116800                    181   7e-49   Gossypium raimondii
ref|XP_003530535.1|  PREDICTED: probable leucine-rich repeat rece...    181   7e-49   Glycine max [soybeans]
ref|XP_011464973.1|  PREDICTED: probable leucine-rich repeat rece...    181   1e-48   Fragaria vesca subsp. vesca
ref|XP_010252232.1|  PREDICTED: probable leucine-rich repeat rece...    181   1e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010252252.1|  PREDICTED: probable leucine-rich repeat rece...    181   1e-48   Nelumbo nucifera [Indian lotus]
emb|CDY21455.1|  BnaC03g27420D                                          179   3e-48   Brassica napus [oilseed rape]
ref|XP_003547844.1|  PREDICTED: probable leucine-rich repeat rece...    179   4e-48   Glycine max [soybeans]
gb|KEH20269.1|  LRR receptor-like kinase                                179   6e-48   Medicago truncatula
ref|XP_007023753.1|  Leucine-rich repeat protein kinase family pr...    179   6e-48   
gb|KFK27543.1|  hypothetical protein AALP_AA8G397000                    173   6e-48   Arabis alpina [alpine rockcress]
ref|XP_009593371.1|  PREDICTED: probable leucine-rich repeat rece...    179   6e-48   Nicotiana tomentosiformis
ref|XP_008782739.1|  PREDICTED: probable leucine-rich repeat rece...    178   7e-48   Phoenix dactylifera
ref|XP_010065202.1|  PREDICTED: probable leucine-rich repeat rece...    179   7e-48   Eucalyptus grandis [rose gum]
ref|XP_011092240.1|  PREDICTED: probable leucine-rich repeat rece...    178   9e-48   
emb|CDX83184.1|  BnaA03g23220D                                          178   1e-47   
gb|AAF68126.1|AC010793_21  F20B17.5                                     178   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011092238.1|  PREDICTED: probable leucine-rich repeat rece...    178   1e-47   Sesamum indicum [beniseed]
ref|NP_178080.2|  putative serine/threonine kinase                      178   1e-47   Arabidopsis thaliana [mouse-ear cress]
gb|KHN40742.1|  Putative leucine-rich repeat receptor-like protei...    177   1e-47   Glycine soja [wild soybean]
ref|XP_002889259.1|  hypothetical protein ARALYDRAFT_477135             177   2e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_009377697.1|  PREDICTED: probable leucine-rich repeat rece...    171   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_004137665.1|  PREDICTED: probable leucine-rich repeat rece...    177   2e-47   Cucumis sativus [cucumbers]
ref|XP_006389866.1|  hypothetical protein EUTSA_v10018176mg             175   3e-47   
ref|XP_010441081.1|  PREDICTED: probable leucine-rich repeat rece...    176   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_009134023.1|  PREDICTED: probable leucine-rich repeat rece...    176   3e-47   Brassica rapa
gb|KFK42372.1|  hypothetical protein AALP_AA2G247300                    177   3e-47   Arabis alpina [alpine rockcress]
ref|XP_006402242.1|  hypothetical protein EUTSA_v10012589mg             176   4e-47   Eutrema salsugineum [saltwater cress]
emb|CDY61244.1|  BnaCnng37500D                                          176   4e-47   Brassica napus [oilseed rape]
gb|KGN59773.1|  hypothetical protein Csa_3G844910                       175   4e-47   Cucumis sativus [cucumbers]
ref|XP_006852584.1|  hypothetical protein AMTR_s00021p00213800          176   7e-47   Amborella trichopoda
ref|XP_010442445.1|  PREDICTED: probable leucine-rich repeat rece...    176   7e-47   
emb|CDP08081.1|  unnamed protein product                                176   7e-47   Coffea canephora [robusta coffee]
ref|XP_009128375.1|  PREDICTED: probable leucine-rich repeat rece...    176   8e-47   Brassica rapa
ref|XP_008442305.1|  PREDICTED: probable leucine-rich repeat rece...    175   9e-47   Cucumis melo [Oriental melon]
ref|XP_009118911.1|  PREDICTED: probable leucine-rich repeat rece...    175   1e-46   Brassica rapa
ref|XP_010275979.1|  PREDICTED: probable leucine-rich repeat rece...    175   1e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010671953.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    174   2e-46   
emb|CDX83183.1|  BnaA03g23230D                                          173   2e-46   
ref|XP_010417632.1|  PREDICTED: probable leucine-rich repeat rece...    174   2e-46   Camelina sativa [gold-of-pleasure]
emb|CDY49740.1|  BnaA02g19320D                                          176   2e-46   Brassica napus [oilseed rape]
ref|XP_007154094.1|  hypothetical protein PHAVU_003G0900000g            173   2e-46   Phaseolus vulgaris [French bean]
ref|XP_010930348.1|  PREDICTED: probable leucine-rich repeat rece...    174   2e-46   
emb|CDY22287.1|  BnaC02g25910D                                          176   3e-46   Brassica napus [oilseed rape]
ref|XP_009134024.1|  PREDICTED: probable leucine-rich repeat rece...    173   3e-46   Brassica rapa
ref|XP_007154093.1|  hypothetical protein PHAVU_003G0900000g            173   4e-46   Phaseolus vulgaris [French bean]
ref|XP_006358564.1|  PREDICTED: probable leucine-rich repeat rece...    174   4e-46   Solanum tuberosum [potatoes]
ref|XP_010113026.1|  putative leucine-rich repeat receptor-like p...    174   4e-46   Morus notabilis
ref|XP_010314121.1|  PREDICTED: probable leucine-rich repeat rece...    173   4e-46   Solanum lycopersicum
ref|XP_006300598.1|  hypothetical protein CARUB_v10019721mg             173   6e-46   
ref|XP_011028445.1|  PREDICTED: probable leucine-rich repeat rece...    172   9e-46   Populus euphratica
gb|KFK26616.1|  hypothetical protein AALP_AA8G271800                    172   9e-46   Arabis alpina [alpine rockcress]
ref|XP_010441110.1|  PREDICTED: probable leucine-rich repeat rece...    163   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_004249557.1|  PREDICTED: probable leucine-rich repeat rece...    172   1e-45   Solanum lycopersicum
gb|KHN40213.1|  Putative leucine-rich repeat receptor-like protei...    172   1e-45   Glycine soja [wild soybean]
ref|XP_010038738.1|  PREDICTED: probable leucine-rich repeat rece...    172   1e-45   Eucalyptus grandis [rose gum]
ref|XP_008465342.1|  PREDICTED: probable leucine-rich repeat rece...    172   1e-45   Cucumis melo [Oriental melon]
gb|KCW47574.1|  hypothetical protein EUGRSUZ_K01321                     172   1e-45   Eucalyptus grandis [rose gum]
ref|XP_007147540.1|  hypothetical protein PHAVU_006G133200g             172   1e-45   Phaseolus vulgaris [French bean]
ref|XP_010938089.1|  PREDICTED: probable leucine-rich repeat rece...    172   1e-45   Elaeis guineensis
ref|XP_011012973.1|  PREDICTED: probable leucine-rich repeat rece...    172   1e-45   Populus euphratica
ref|XP_002323702.2|  leucine-rich repeat transmembrane protein ki...    172   2e-45   Populus trichocarpa [western balsam poplar]
ref|XP_006584124.1|  PREDICTED: probable leucine-rich repeat rece...    172   2e-45   Glycine max [soybeans]
ref|XP_010482269.1|  PREDICTED: probable leucine-rich repeat rece...    171   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010921260.1|  PREDICTED: probable leucine-rich repeat rece...    169   2e-45   
ref|XP_006338928.1|  PREDICTED: probable leucine-rich repeat rece...    171   2e-45   Solanum tuberosum [potatoes]
ref|XP_006584125.1|  PREDICTED: probable leucine-rich repeat rece...    171   2e-45   Glycine max [soybeans]
ref|XP_009387132.1|  PREDICTED: probable leucine-rich repeat rece...    171   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001066400.1|  Os12g0210400                                       171   3e-45   
gb|EEE52938.1|  hypothetical protein OsJ_35570                          171   3e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009337850.1|  PREDICTED: probable leucine-rich repeat rece...    171   3e-45   Pyrus x bretschneideri [bai li]
gb|KJB57523.1|  hypothetical protein B456_009G167900                    171   4e-45   Gossypium raimondii
ref|XP_010044506.1|  PREDICTED: probable leucine-rich repeat rece...    171   5e-45   Eucalyptus grandis [rose gum]
ref|XP_002467924.1|  hypothetical protein SORBIDRAFT_01g036470          171   5e-45   
ref|XP_010537840.1|  PREDICTED: probable leucine-rich repeat rece...    171   5e-45   Tarenaya hassleriana [spider flower]
ref|XP_010252249.1|  PREDICTED: probable leucine-rich repeat rece...    170   6e-45   Nelumbo nucifera [Indian lotus]
ref|XP_009761326.1|  PREDICTED: probable leucine-rich repeat rece...    170   6e-45   Nicotiana sylvestris
ref|XP_010252248.1|  PREDICTED: probable leucine-rich repeat rece...    170   7e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010429861.1|  PREDICTED: probable leucine-rich repeat rece...    170   7e-45   Camelina sativa [gold-of-pleasure]
ref|XP_009416032.1|  PREDICTED: probable leucine-rich repeat rece...    170   7e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002864013.1|  leucine-rich repeat family protein                 165   9e-45   
ref|XP_008802221.1|  PREDICTED: probable leucine-rich repeat rece...    170   1e-44   
ref|XP_010482274.1|  PREDICTED: probable leucine-rich repeat rece...    168   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009600216.1|  PREDICTED: probable leucine-rich repeat rece...    169   1e-44   Nicotiana tomentosiformis
gb|KHN40741.1|  Putative leucine-rich repeat receptor-like protei...    169   1e-44   Glycine soja [wild soybean]
ref|XP_009391654.1|  PREDICTED: probable leucine-rich repeat rece...    169   1e-44   
ref|XP_002864014.1|  leucine-rich repeat family protein                 169   1e-44   
ref|XP_006402241.1|  hypothetical protein EUTSA_v10012584mg             169   2e-44   
ref|XP_009417853.1|  PREDICTED: probable leucine-rich repeat rece...    168   2e-44   
ref|XP_010688349.1|  PREDICTED: probable leucine-rich repeat rece...    169   2e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010482273.1|  PREDICTED: probable leucine-rich repeat rece...    168   2e-44   Camelina sativa [gold-of-pleasure]
ref|NP_199787.2|  leucine-rich repeat protein kinase-like protein       168   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009370844.1|  PREDICTED: probable leucine-rich repeat rece...    168   3e-44   Pyrus x bretschneideri [bai li]
ref|XP_010482271.1|  PREDICTED: probable leucine-rich repeat rece...    168   3e-44   
dbj|BAA98164.1|  receptor protein kinase-like                           168   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482272.1|  PREDICTED: probable leucine-rich repeat rece...    168   3e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009417852.1|  PREDICTED: probable leucine-rich repeat rece...    168   3e-44   
ref|XP_009417851.1|  PREDICTED: probable leucine-rich repeat rece...    168   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007206754.1|  hypothetical protein PRUPE_ppa025198mg             163   3e-44   
ref|XP_006651341.1|  PREDICTED: probable leucine-rich repeat rece...    168   3e-44   
ref|XP_009417849.1|  PREDICTED: probable leucine-rich repeat rece...    168   4e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG12756.1|  hypothetical protein F383_03913                         168   4e-44   Gossypium arboreum [tree cotton]
ref|XP_009365989.1|  PREDICTED: probable leucine-rich repeat rece...    167   5e-44   
ref|XP_004960772.1|  PREDICTED: probable leucine-rich repeat rece...    167   5e-44   Setaria italica
ref|XP_003535032.1|  PREDICTED: probable leucine-rich repeat rece...    167   6e-44   Glycine max [soybeans]
ref|XP_009365988.1|  PREDICTED: probable leucine-rich repeat rece...    167   1e-43   Pyrus x bretschneideri [bai li]
ref|XP_010930467.1|  PREDICTED: probable leucine-rich repeat rece...    167   1e-43   
emb|CDP16125.1|  unnamed protein product                                164   1e-43   Coffea canephora [robusta coffee]
ref|XP_007208371.1|  hypothetical protein PRUPE_ppa000921mg             166   2e-43   Prunus persica
ref|XP_011012972.1|  PREDICTED: probable leucine-rich repeat rece...    166   2e-43   Populus euphratica
ref|XP_011012970.1|  PREDICTED: probable leucine-rich repeat rece...    166   2e-43   Populus euphratica
ref|XP_007208107.1|  hypothetical protein PRUPE_ppa000924mg             166   2e-43   Prunus persica
gb|EYU39493.1|  hypothetical protein MIMGU_mgv1a025586mg                166   2e-43   Erythranthe guttata [common monkey flower]
ref|XP_003593681.1|  Somatic embryogenesis receptor-like kinase         166   2e-43   Medicago truncatula
ref|XP_004485853.1|  PREDICTED: probable leucine-rich repeat rece...    166   2e-43   Cicer arietinum [garbanzo]
ref|XP_002269419.1|  PREDICTED: probable leucine-rich repeat rece...    166   3e-43   Vitis vinifera
ref|XP_010484994.1|  PREDICTED: probable leucine-rich repeat rece...    164   3e-43   
emb|CDM81501.1|  unnamed protein product                                165   4e-43   Triticum aestivum [Canadian hard winter wheat]
emb|CDM81495.1|  unnamed protein product                                165   4e-43   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009387702.1|  PREDICTED: probable leucine-rich repeat rece...    165   4e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN40214.1|  Putative leucine-rich repeat receptor-like protei...    164   5e-43   Glycine soja [wild soybean]
emb|CDY21452.1|  BnaC03g27450D                                          165   5e-43   Brassica napus [oilseed rape]
ref|XP_008782792.1|  PREDICTED: probable leucine-rich repeat rece...    164   6e-43   
ref|NP_001242669.1|  probable leucine-rich repeat receptor-like p...    163   6e-43   Glycine max [soybeans]
dbj|BAJ89467.1|  predicted protein                                      164   7e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94480.1|  predicted protein                                      164   8e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_199786.2|  Leucine-rich repeat (LRR) family protein              160   1e-42   Arabidopsis thaliana [mouse-ear cress]
gb|EYU33251.1|  hypothetical protein MIMGU_mgv1a021972mg                164   1e-42   Erythranthe guttata [common monkey flower]
ref|XP_009761610.1|  PREDICTED: probable leucine-rich repeat rece...    164   1e-42   Nicotiana sylvestris
ref|XP_009365992.1|  PREDICTED: probable leucine-rich repeat rece...    164   1e-42   
ref|XP_010441071.1|  PREDICTED: probable leucine-rich repeat rece...    164   1e-42   Camelina sativa [gold-of-pleasure]
emb|CDY12940.1|  BnaA09g13340D                                          163   1e-42   Brassica napus [oilseed rape]
ref|XP_008643850.1|  PREDICTED: uncharacterized protein LOC100382...    163   2e-42   Zea mays [maize]
ref|XP_008804684.1|  PREDICTED: probable leucine-rich repeat rece...    160   2e-42   
ref|XP_008643846.1|  PREDICTED: uncharacterized protein LOC100382...    163   2e-42   
gb|KHN48167.1|  Putative leucine-rich repeat receptor-like protei...    163   2e-42   Glycine soja [wild soybean]
ref|XP_010442444.1|  PREDICTED: probable leucine-rich repeat rece...    163   2e-42   Camelina sativa [gold-of-pleasure]
gb|EEC75182.1|  hypothetical protein OsI_11410                          162   3e-42   Oryza sativa Indica Group [Indian rice]
gb|ABF95747.1|  Protein kinase domain containing protein, expressed     162   3e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006588460.1|  PREDICTED: probable leucine-rich repeat rece...    162   3e-42   Glycine max [soybeans]
ref|XP_008804670.1|  PREDICTED: probable leucine-rich repeat rece...    162   3e-42   
ref|XP_010922852.1|  PREDICTED: probable leucine-rich repeat rece...    162   3e-42   Elaeis guineensis
ref|XP_006279556.1|  hypothetical protein CARUB_v10025735mg             163   5e-42   
emb|CAQ58615.1|  ATP binding / kinase/ protein serine / threonine...    162   5e-42   Vitis vinifera
ref|XP_010653092.1|  PREDICTED: probable leucine-rich repeat rece...    162   5e-42   Vitis vinifera
ref|XP_003561670.2|  PREDICTED: probable leucine-rich repeat rece...    162   6e-42   Brachypodium distachyon [annual false brome]
gb|EMT31021.1|  Putative LRR receptor-like serine/threonine-prote...    162   6e-42   
ref|XP_002311479.2|  hypothetical protein POPTR_0008s12450g             157   7e-42   
ref|XP_002519985.1|  receptor protein kinase, putative                  162   7e-42   Ricinus communis
ref|XP_011077100.1|  PREDICTED: probable leucine-rich repeat rece...    161   7e-42   Sesamum indicum [beniseed]
ref|XP_011018905.1|  PREDICTED: probable leucine-rich repeat rece...    161   9e-42   Populus euphratica
ref|XP_009391655.1|  PREDICTED: probable leucine-rich repeat rece...    161   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO97683.1|  unnamed protein product                                160   1e-41   Coffea canephora [robusta coffee]
ref|XP_006664421.1|  PREDICTED: probable leucine-rich repeat rece...    160   1e-41   
ref|XP_006279961.1|  hypothetical protein CARUB_v10025827mg             160   1e-41   Capsella rubella
ref|XP_002308292.2|  leucine-rich repeat transmembrane protein ki...    160   2e-41   Populus trichocarpa [western balsam poplar]
ref|XP_011028449.1|  PREDICTED: probable leucine-rich repeat rece...    159   2e-41   Populus euphratica
ref|XP_003541454.1|  PREDICTED: probable leucine-rich repeat rece...    160   3e-41   Glycine max [soybeans]
ref|XP_008345657.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    160   3e-41   
ref|XP_004972229.1|  PREDICTED: probable leucine-rich repeat rece...    159   3e-41   
ref|NP_001176022.1|  Os10g0145700                                       152   3e-41   
emb|CDY19539.1|  BnaC09g13640D                                          159   4e-41   Brassica napus [oilseed rape]
gb|EMT14100.1|  Putative LRR receptor-like serine/threonine-prote...    159   4e-41   
ref|XP_003593677.1|  Receptor-like protein kinase                       156   4e-41   Medicago truncatula
ref|NP_199788.1|  putative leucine-rich repeat receptor-like prot...    159   4e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KJB57522.1|  hypothetical protein B456_009G167900                    159   5e-41   Gossypium raimondii
ref|XP_009113087.1|  PREDICTED: probable leucine-rich repeat rece...    159   5e-41   
ref|XP_006385115.1|  hypothetical protein POPTR_0004s24060g             152   5e-41   
ref|XP_009364675.1|  PREDICTED: probable leucine-rich repeat rece...    159   7e-41   
emb|CDY12939.1|  BnaA09g13350D                                          159   8e-41   Brassica napus [oilseed rape]
ref|XP_007208219.1|  hypothetical protein PRUPE_ppa018586mg             158   1e-40   
ref|XP_002864015.1|  hypothetical protein ARALYDRAFT_495037             158   1e-40   
ref|XP_010682227.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-40   
ref|XP_011461103.1|  PREDICTED: probable leucine-rich repeat rece...    157   2e-40   Fragaria vesca subsp. vesca
ref|XP_007148093.1|  hypothetical protein PHAVU_006G180200g             156   4e-40   Phaseolus vulgaris [French bean]
ref|XP_003593682.1|  Somatic embryogenesis receptor-like kinase         156   5e-40   
ref|XP_011088110.1|  PREDICTED: probable leucine-rich repeat rece...    156   7e-40   Sesamum indicum [beniseed]
ref|XP_008359275.1|  PREDICTED: probable leucine-rich repeat rece...    147   2e-39   
ref|XP_006371696.1|  hypothetical protein POPTR_0018s002601g            145   2e-39   
ref|XP_006429975.1|  hypothetical protein CICLE_v100110352mg            143   4e-39   
ref|XP_008227086.1|  PREDICTED: probable leucine-rich repeat rece...    153   6e-39   Prunus mume [ume]
ref|XP_004295860.1|  PREDICTED: probable leucine-rich repeat rece...    153   7e-39   Fragaria vesca subsp. vesca
ref|XP_011084699.1|  PREDICTED: probable leucine-rich repeat rece...    153   7e-39   Sesamum indicum [beniseed]
ref|XP_011461107.1|  PREDICTED: probable leucine-rich repeat rece...    152   7e-39   Fragaria vesca subsp. vesca
ref|XP_011461106.1|  PREDICTED: probable leucine-rich repeat rece...    152   9e-39   Fragaria vesca subsp. vesca
ref|XP_009417854.1|  PREDICTED: probable leucine-rich repeat rece...    152   9e-39   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI31129.3|  unnamed protein product                                152   9e-39   Vitis vinifera
ref|XP_002441283.1|  hypothetical protein SORBIDRAFT_09g023790          150   1e-38   
ref|XP_010482266.1|  PREDICTED: probable leucine-rich repeat rece...    152   1e-38   
ref|XP_010067427.1|  PREDICTED: probable leucine-rich repeat rece...    152   2e-38   
ref|XP_010044526.1|  PREDICTED: probable leucine-rich repeat rece...    151   4e-38   Eucalyptus grandis [rose gum]
ref|XP_010044534.1|  PREDICTED: probable leucine-rich repeat rece...    151   4e-38   Eucalyptus grandis [rose gum]
gb|KFK31438.1|  hypothetical protein AALP_AA6G111800                    150   4e-38   Arabis alpina [alpine rockcress]
ref|XP_007212514.1|  hypothetical protein PRUPE_ppa017853mg             150   5e-38   
ref|XP_009406445.1|  PREDICTED: probable leucine-rich repeat rece...    150   6e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406444.1|  PREDICTED: probable leucine-rich repeat rece...    150   6e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU39755.1|  hypothetical protein MIMGU_mgv1a000835mg                150   8e-38   Erythranthe guttata [common monkey flower]
ref|XP_002864016.1|  predicted protein                                  150   8e-38   
gb|EMT13742.1|  Putative LRR receptor-like serine/threonine-prote...    150   9e-38   
ref|XP_003578779.1|  PREDICTED: probable leucine-rich repeat rece...    149   1e-37   Brachypodium distachyon [annual false brome]
emb|CDP15606.1|  unnamed protein product                                149   2e-37   Coffea canephora [robusta coffee]
ref|XP_011466378.1|  PREDICTED: probable leucine-rich repeat rece...    149   2e-37   Fragaria vesca subsp. vesca
ref|XP_006655431.1|  PREDICTED: probable leucine-rich repeat rece...    149   2e-37   Oryza brachyantha
ref|XP_008649802.1|  PREDICTED: probable leucine-rich repeat rece...    148   4e-37   Zea mays [maize]
ref|XP_002440790.1|  hypothetical protein SORBIDRAFT_09g006630          147   5e-37   
ref|XP_010252243.1|  PREDICTED: probable leucine-rich repeat rece...    147   5e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010252245.1|  PREDICTED: probable leucine-rich repeat rece...    147   5e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010252247.1|  PREDICTED: probable leucine-rich repeat rece...    147   5e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010252244.1|  PREDICTED: probable leucine-rich repeat rece...    147   6e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010690261.1|  PREDICTED: probable leucine-rich repeat rece...    147   6e-37   
ref|XP_010690267.1|  PREDICTED: probable leucine-rich repeat rece...    147   6e-37   
ref|XP_010690246.1|  PREDICTED: probable leucine-rich repeat rece...    147   7e-37   
ref|XP_010690238.1|  PREDICTED: probable leucine-rich repeat rece...    147   7e-37   
ref|XP_010044564.1|  PREDICTED: probable leucine-rich repeat rece...    147   8e-37   
dbj|BAA98166.1|  receptor protein kinase-like                           147   9e-37   
ref|XP_003566120.1|  PREDICTED: probable leucine-rich repeat rece...    147   1e-36   
ref|XP_010690203.1|  PREDICTED: probable leucine-rich repeat rece...    146   1e-36   
ref|XP_008366451.1|  PREDICTED: probable leucine-rich repeat rece...    146   2e-36   
dbj|BAK05595.1|  predicted protein                                      146   2e-36   
ref|XP_009335437.1|  PREDICTED: probable leucine-rich repeat rece...    146   2e-36   
dbj|BAJ96239.1|  predicted protein                                      145   2e-36   
ref|XP_010690253.1|  PREDICTED: probable leucine-rich repeat rece...    145   5e-36   
ref|XP_010233532.1|  PREDICTED: probable leucine-rich repeat rece...    144   6e-36   
ref|XP_010044552.1|  PREDICTED: probable leucine-rich repeat rece...    144   8e-36   
ref|XP_011461097.1|  PREDICTED: probable leucine-rich repeat rece...    144   9e-36   
ref|XP_003566601.1|  PREDICTED: probable leucine-rich repeat rece...    144   1e-35   
gb|EEC79425.1|  hypothetical protein OsI_20397                          143   2e-35   
ref|NP_001055877.1|  Os05g0486100                                       143   2e-35   
ref|XP_010252250.1|  PREDICTED: probable leucine-rich repeat rece...    143   2e-35   
gb|EMT33703.1|  Putative LRR receptor-like serine/threonine-prote...    143   2e-35   
ref|XP_010252233.1|  PREDICTED: probable leucine-rich repeat rece...    143   2e-35   
ref|XP_010044547.1|  PREDICTED: probable leucine-rich repeat rece...    142   3e-35   
gb|KCW88501.1|  hypothetical protein EUGRSUZ_A00887                     142   5e-35   
ref|XP_006655181.1|  PREDICTED: probable leucine-rich repeat rece...    142   5e-35   
ref|XP_006282275.1|  hypothetical protein CARUB_v10028556mg             142   5e-35   
ref|XP_006644901.1|  PREDICTED: probable leucine-rich repeat rece...    142   5e-35   
ref|XP_004962484.1|  PREDICTED: probable leucine-rich repeat rece...    141   8e-35   
ref|XP_011466377.1|  PREDICTED: probable leucine-rich repeat rece...    137   1e-34   
ref|XP_011466379.1|  PREDICTED: probable leucine-rich repeat rece...    130   2e-34   
ref|XP_011028453.1|  PREDICTED: probable leucine-rich repeat rece...    139   3e-34   
ref|XP_011028451.1|  PREDICTED: probable leucine-rich repeat rece...    140   3e-34   
ref|XP_011028450.1|  PREDICTED: probable leucine-rich repeat rece...    139   3e-34   
ref|XP_011028452.1|  PREDICTED: probable leucine-rich repeat rece...    139   4e-34   
ref|XP_006655430.1|  PREDICTED: probable leucine-rich repeat rece...    139   4e-34   
ref|XP_008674899.1|  PREDICTED: probable leucine-rich repeat rece...    139   4e-34   
ref|XP_007147542.1|  hypothetical protein PHAVU_006G133400g             139   5e-34   
gb|EAZ13939.1|  hypothetical protein OsJ_03866                          139   5e-34   
dbj|BAD82283.1|  putative receptor-like protein kinase 2                139   6e-34   
gb|EAY76270.1|  hypothetical protein OsI_04206                          139   6e-34   
ref|XP_011461108.1|  PREDICTED: probable leucine-rich repeat rece...    138   1e-33   
ref|XP_006385109.1|  hypothetical protein POPTR_0004s240001g            137   2e-33   
dbj|BAJ91189.1|  predicted protein                                      137   3e-33   
ref|XP_010252434.1|  PREDICTED: probable leucine-rich repeat rece...    135   3e-33   
ref|XP_008227090.1|  PREDICTED: probable leucine-rich repeat rece...    137   4e-33   
gb|KCW88500.1|  hypothetical protein EUGRSUZ_A00886                     136   5e-33   
ref|NP_001131018.1|  uncharacterized LOC100192366 precursor             135   8e-33   
gb|EEE63180.1|  hypothetical protein OsJ_17989                          135   8e-33   
gb|EEC78946.1|  hypothetical protein OsI_19395                          134   2e-32   
ref|XP_004970368.1|  PREDICTED: probable leucine-rich repeat rece...    134   4e-32   
ref|XP_002441998.1|  hypothetical protein SORBIDRAFT_08g006710          132   1e-31   
emb|CDM84721.1|  unnamed protein product                                132   1e-31   
ref|XP_006385110.1|  hypothetical protein POPTR_0004s24010g             131   3e-31   
ref|XP_006281792.1|  hypothetical protein CARUB_v10027977mg             131   4e-31   
ref|XP_006385111.1|  hypothetical protein POPTR_0004s24020g             130   6e-31   
ref|XP_007213558.1|  hypothetical protein PRUPE_ppa017796mg             130   6e-31   
ref|XP_006662853.1|  PREDICTED: probable leucine-rich repeat rece...    127   5e-30   
ref|XP_010682078.1|  PREDICTED: probable leucine-rich repeat rece...    127   7e-30   
ref|XP_009386322.1|  PREDICTED: probable leucine-rich repeat rece...    120   1e-29   
gb|EEE51910.1|  hypothetical protein OsJ_33512                          125   3e-29   
gb|EEC67947.1|  hypothetical protein OsI_35675                          125   3e-29   
gb|AAX92929.1|  At5g49760                                               125   3e-29   
emb|CDM84720.1|  unnamed protein product                                125   4e-29   
ref|XP_008793425.1|  PREDICTED: probable leucine-rich repeat rece...    124   5e-29   
ref|XP_007207226.1|  hypothetical protein PRUPE_ppa000992mg             124   8e-29   
ref|XP_001777494.1|  predicted protein                                  123   2e-28   
ref|XP_010252242.1|  PREDICTED: probable leucine-rich repeat rece...    122   3e-28   
ref|XP_010233531.1|  PREDICTED: probable leucine-rich repeat rece...    121   6e-28   
ref|XP_002315909.2|  hypothetical protein POPTR_0010s12810g             112   3e-27   
ref|XP_001760085.1|  predicted protein                                  120   4e-27   
emb|CDP12546.1|  unnamed protein product                                114   3e-26   
gb|KDO40687.1|  hypothetical protein CISIN_1g002189mg                   116   5e-26   
ref|XP_004961711.1|  PREDICTED: probable leucine-rich repeat rece...    116   6e-26   
ref|XP_004961712.1|  PREDICTED: probable leucine-rich repeat rece...    116   7e-26   
gb|EMT20931.1|  Putative LRR receptor-like serine/threonine-prote...    112   1e-24   
gb|AAT01330.1|  putative receptor protein kinase                        111   3e-24   
gb|KEH20270.1|  leucine-rich receptor-like kinase family protein        106   3e-24   
dbj|BAF79948.1|  receptor-like kinase                                   111   4e-24   
ref|XP_002456530.1|  hypothetical protein SORBIDRAFT_03g037960          110   7e-24   
ref|XP_008246057.1|  PREDICTED: probable leucine-rich repeat rece...    107   8e-24   
emb|CAN68980.1|  hypothetical protein VITISV_004150                     109   1e-23   
ref|XP_008465343.1|  PREDICTED: probable leucine-rich repeat rece...    108   2e-23   
dbj|BAA98163.1|  unnamed protein product                                105   2e-23   
ref|XP_001774376.1|  predicted protein                                  109   2e-23   
ref|XP_002962984.1|  hypothetical protein SELMODRAFT_438262             108   2e-23   
ref|XP_002993954.1|  hypothetical protein SELMODRAFT_431914             108   3e-23   
ref|XP_008245573.1|  PREDICTED: probable leucine-rich repeat rece...    107   6e-23   
ref|XP_010088707.1|  putative leucine-rich repeat receptor-like p...    105   3e-22   
ref|XP_010482267.1|  PREDICTED: probable leucine-rich repeat rece...    103   9e-22   
gb|KFK23621.1|  hypothetical protein AALP_AAs71127U000200             98.6    1e-21   
gb|AAG51067.1|AC069472_7  unknown protein; 756-145                    98.2    2e-21   
ref|XP_010486908.1|  PREDICTED: polygalacturonase inhibitor 1-like    99.8    2e-21   
gb|KDP21807.1|  hypothetical protein JCGZ_00594                       98.6    3e-21   
ref|XP_010464968.1|  PREDICTED: polygalacturonase inhibitor 1-like    99.4    3e-21   
ref|XP_006385117.1|  hypothetical protein POPTR_0004s24080g             101   5e-21   
gb|EEC79423.1|  hypothetical protein OsI_20395                          101   6e-21   
gb|AAL15279.1|  At3g12148/T23B7.11                                    98.2    8e-21   
ref|NP_974291.4|  leucine-rich repeat protein FLOR1                   98.2    8e-21   
gb|KCW88498.1|  hypothetical protein EUGRSUZ_A00884                     100   1e-20   
ref|XP_006298126.1|  hypothetical protein CARUB_v10014170mg           97.4    1e-20   
emb|CDY52623.1|  BnaCnng23020D                                        97.4    1e-20   
gb|AAF65195.1|AF136588_1  leucine-rich repeat protein FLR1            97.1    2e-20   
gb|KCW88497.1|  hypothetical protein EUGRSUZ_A00884                     100   2e-20   
gb|ACX42230.1|  polygalacturonase inhibitory protein                  96.7    2e-20   
ref|XP_009120892.1|  PREDICTED: polygalacturonase inhibitor 1-like    96.7    2e-20   
ref|XP_010534350.1|  PREDICTED: polygalacturonase inhibitor           96.7    3e-20   
ref|XP_010498562.1|  PREDICTED: polygalacturonase inhibitor 1-lik...  96.3    4e-20   
ref|XP_002884889.1|  leucine-rich repeat protein FLR1                 96.3    4e-20   
emb|CAN68981.1|  hypothetical protein VITISV_004151                   98.6    6e-20   
ref|XP_006282247.1|  hypothetical protein CARUB_v10028521mg           97.4    6e-20   
ref|XP_006407361.1|  hypothetical protein EUTSA_v10021132mg           94.7    1e-19   
ref|XP_009419865.1|  PREDICTED: probable leucine-rich repeat rece...  96.3    4e-19   
ref|WP_028289581.1|  MULTISPECIES: hypothetical protein               92.4    6e-19   
gb|KFK38578.1|  hypothetical protein AALP_AA3G131900                  92.0    1e-18   
ref|XP_010043840.1|  PREDICTED: probable LRR receptor-like serine...  94.4    2e-18   
ref|XP_010940921.1|  PREDICTED: LRR receptor-like serine/threonin...  94.7    2e-18   
ref|XP_010043831.1|  PREDICTED: probable LRR receptor-like serine...  94.4    2e-18   
ref|XP_008802212.1|  PREDICTED: probable leucine-rich repeat rece...  94.4    2e-18   
ref|XP_006282197.1|  hypothetical protein CARUB_v10028463mg           93.6    3e-18   
gb|EEC79424.1|  hypothetical protein OsI_20396                        89.7    3e-18   
gb|EMT02279.1|  Putative LRR receptor-like serine/threonine-prote...  94.0    3e-18   
ref|XP_010442449.1|  PREDICTED: probable leucine-rich repeat rece...  93.6    3e-18   
gb|AFW86032.1|  putative leucine-rich repeat receptor-like protei...  92.4    3e-18   
gb|AFW86031.1|  putative leucine-rich repeat receptor-like protei...  93.2    4e-18   
ref|XP_008658489.1|  PREDICTED: uncharacterized protein LOC100279...  93.2    4e-18   
gb|AFW86033.1|  putative leucine-rich repeat receptor-like protei...  92.4    4e-18   
gb|AFW86034.1|  putative leucine-rich repeat receptor-like protei...  93.2    4e-18   
ref|XP_002322457.1|  Leucine-rich repeat receptor protein kinase ...  93.2    5e-18   
ref|XP_010276048.1|  PREDICTED: LRR receptor-like serine/threonin...  93.2    5e-18   
ref|XP_006654549.1|  PREDICTED: probable LRR receptor-like serine...  92.4    7e-18   
ref|XP_008810290.1|  PREDICTED: LRR receptor-like serine/threonin...  92.4    8e-18   
emb|CDY08451.1|  BnaA05g26870D                                        89.4    9e-18   
emb|CDP12544.1|  unnamed protein product                              85.5    9e-18   
emb|CDY42127.1|  BnaC05g40920D                                        89.4    9e-18   
ref|XP_008810292.1|  PREDICTED: LRR receptor-like serine/threonin...  92.0    9e-18   
ref|XP_008810291.1|  PREDICTED: LRR receptor-like serine/threonin...  92.0    1e-17   
ref|XP_009146639.1|  PREDICTED: polygalacturonase inhibitor 1-like    89.4    1e-17   
gb|KFK23620.1|  hypothetical protein AALP_AAs71127U000100             91.3    1e-17   
gb|KDO65362.1|  hypothetical protein CISIN_1g002278mg                 92.0    1e-17   
ref|XP_004964421.1|  PREDICTED: LRR receptor-like serine/threonin...  92.0    1e-17   
ref|XP_011048672.1|  PREDICTED: leucine-rich repeat receptor prot...  92.0    1e-17   
ref|XP_006490262.1|  PREDICTED: LRR receptor-like serine/threonin...  92.0    1e-17   
ref|XP_002436407.1|  hypothetical protein SORBIDRAFT_10g001970        91.7    1e-17   
ref|XP_007143329.1|  hypothetical protein PHAVU_007G063200g           91.3    2e-17   
ref|NP_001060863.1|  Os08g0117700                                     90.9    2e-17   
ref|XP_007217616.1|  hypothetical protein PRUPE_ppa016276mg           91.3    2e-17   
ref|XP_008376456.1|  PREDICTED: somatic embryogenesis receptor ki...  90.9    2e-17   
ref|XP_010277441.1|  PREDICTED: LRR receptor-like serine/threonin...  90.9    2e-17   
ref|XP_006421768.1|  hypothetical protein CICLE_v10004259mg           90.9    2e-17   
ref|XP_002323096.2|  hypothetical protein POPTR_0016s14700g           87.8    3e-17   
ref|XP_009629750.1|  PREDICTED: receptor-like protein 12 isoform X2   89.0    3e-17   
ref|XP_010277439.1|  PREDICTED: LRR receptor-like serine/threonin...  90.9    3e-17   
ref|XP_010486743.1|  PREDICTED: receptor-like protein 12              89.7    3e-17   
ref|XP_010043852.1|  PREDICTED: probable LRR receptor-like serine...  90.5    4e-17   
ref|XP_010043866.1|  PREDICTED: probable LRR receptor-like serine...  90.5    4e-17   
ref|XP_011001642.1|  PREDICTED: probable LRR receptor-like serine...  90.1    4e-17   
dbj|BAP55140.1|  receptor protein kinase-like protein                 87.8    4e-17   
ref|XP_010653120.1|  PREDICTED: probable LRR receptor-like serine...  90.5    4e-17   
ref|XP_002266206.1|  PREDICTED: probable LRR receptor-like serine...  90.1    4e-17   
ref|XP_011001640.1|  PREDICTED: probable LRR receptor-like serine...  90.1    4e-17   
ref|XP_010653122.1|  PREDICTED: probable LRR receptor-like serine...  90.1    4e-17   
ref|XP_011001639.1|  PREDICTED: probable LRR receptor-like serine...  90.1    4e-17   
ref|XP_006656595.1|  PREDICTED: LRR receptor-like serine/threonin...  90.1    4e-17   
ref|XP_011001641.1|  PREDICTED: probable LRR receptor-like serine...  90.1    4e-17   
gb|KDP43149.1|  hypothetical protein JCGZ_26682                       86.7    5e-17   
ref|WP_028283510.1|  hypothetical protein                             86.7    5e-17   
ref|XP_010101735.1|  Leucine-rich repeat receptor protein kinase EXS  89.4    5e-17   
ref|WP_040586508.1|  hypothetical protein                             86.3    6e-17   
ref|XP_009125666.1|  PREDICTED: polygalacturonase inhibitor 1-lik...  86.7    6e-17   
ref|XP_002873299.1|  hypothetical protein ARALYDRAFT_908657           89.7    6e-17   
ref|XP_009629749.1|  PREDICTED: LRR receptor-like serine/threonin...  88.6    7e-17   
ref|XP_009125665.1|  PREDICTED: polygalacturonase inhibitor 1-lik...  86.7    7e-17   
ref|XP_010276057.1|  PREDICTED: LRR receptor-like serine/threonin...  89.4    8e-17   
gb|EPS66497.1|  hypothetical protein M569_08274                       89.4    9e-17   
ref|XP_004961725.1|  PREDICTED: probable LRR receptor-like serine...  89.4    9e-17   
ref|NP_001237639.1|  ERECTA-like kinase                               89.4    9e-17   
ref|XP_009374517.1|  PREDICTED: probable LRR receptor-like serine...  89.0    9e-17   
ref|XP_011029995.1|  PREDICTED: LRR receptor-like serine/threonin...  89.4    9e-17   
gb|KDP22393.1|  hypothetical protein JCGZ_26224                       89.0    9e-17   
ref|XP_006481242.1|  PREDICTED: probable LRR receptor-like serine...  89.4    1e-16   
ref|XP_009370496.1|  PREDICTED: somatic embryogenesis receptor ki...  88.6    1e-16   
emb|CDY05006.1|  BnaAnng01880D                                        86.3    1e-16   
gb|EPS72502.1|  hypothetical protein M569_02256                       85.5    1e-16   
ref|XP_006481243.1|  PREDICTED: probable LRR receptor-like serine...  89.0    1e-16   
ref|XP_006588388.1|  PREDICTED: ERECTA-like kinase isoform X2         89.0    1e-16   
ref|XP_002961907.1|  hypothetical protein SELMODRAFT_77292            86.7    1e-16   
ref|XP_006588387.1|  PREDICTED: ERECTA-like kinase isoform X1         88.6    1e-16   
gb|AGT17158.1|  ERECTA-like 2                                         88.6    1e-16   
ref|XP_008370579.1|  PREDICTED: probable leucine-rich repeat rece...  88.6    1e-16   
ref|XP_004233963.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  84.3    1e-16   
ref|XP_011041677.1|  PREDICTED: LRR receptor-like serine/threonin...  88.6    2e-16   
ref|XP_006842576.1|  hypothetical protein AMTR_s00077p00154750        88.6    2e-16   
gb|ACY07616.1|  stress-induced protein kinase                         88.6    2e-16   
ref|NP_001172626.1|  Os01g0818600                                     86.7    2e-16   
ref|XP_002269540.2|  PREDICTED: LRR receptor-like serine/threonin...  88.2    2e-16   
ref|XP_010277442.1|  PREDICTED: LRR receptor-like serine/threonin...  88.2    2e-16   
gb|KJB45795.1|  hypothetical protein B456_007G328700                  85.1    2e-16   
ref|XP_003568234.2|  PREDICTED: probable LRR receptor-like serine...  88.2    2e-16   
gb|AAK63879.2|AC074105_8  Putative receptor protein kinase            82.0    3e-16   
emb|CBI31162.3|  unnamed protein product                              88.2    3e-16   
ref|XP_010458858.1|  PREDICTED: receptor-like protein 12 isoform X1   84.7    3e-16   
ref|XP_002993941.1|  hypothetical protein SELMODRAFT_449258           87.4    4e-16   
ref|XP_004141340.1|  PREDICTED: LRR receptor-like serine/threonin...  87.4    4e-16   
ref|XP_008803012.1|  PREDICTED: probable LRR receptor-like serine...  87.4    4e-16   
ref|XP_009396739.1|  PREDICTED: probable LRR receptor-like serine...  85.1    4e-16   
ref|XP_008782697.1|  PREDICTED: probable LRR receptor-like serine...  87.4    4e-16   
ref|XP_006429640.1|  hypothetical protein CICLE_v10013792mg           87.4    4e-16   
ref|XP_002531014.1|  ATP binding protein, putative                    86.7    5e-16   
gb|KEH43759.1|  LRR receptor-like kinase family protein               87.0    5e-16   
ref|XP_008452789.1|  PREDICTED: LRR receptor-like serine/threonin...  87.0    5e-16   
ref|XP_006644909.1|  PREDICTED: probable LRR receptor-like serine...  87.0    6e-16   
gb|EEE55585.1|  hypothetical protein OsJ_03881                        87.0    6e-16   
ref|XP_006400197.1|  hypothetical protein EUTSA_v10012966mg           86.3    6e-16   
ref|XP_009136073.1|  PREDICTED: somatic embryogenesis receptor ki...  86.3    6e-16   
ref|XP_004309271.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  86.3    7e-16   
emb|CDX79173.1|  BnaA01g12400D                                        86.3    7e-16   
ref|XP_009772119.1|  PREDICTED: leucine-rich repeat receptor prot...  86.3    7e-16   
ref|XP_009124332.1|  PREDICTED: somatic embryogenesis receptor ki...  82.8    7e-16   
gb|KDO65398.1|  hypothetical protein CISIN_1g044913mg                 84.7    7e-16   
ref|XP_004234153.1|  PREDICTED: LRR receptor-like serine/threonin...  86.7    8e-16   
ref|XP_002971182.1|  hypothetical protein SELMODRAFT_94583            84.3    8e-16   



>ref|XP_009784886.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Nicotiana sylvestris]
Length=650

 Score =   219 bits (559),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 146/176 (83%), Gaps = 1/176 (1%)
 Frame = +1

Query  94   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  273
            RIQL  + ++I  L I A+T+ +D+ A+++L+D W+NVPP+WA G+DPCG  WEG+GC  
Sbjct  8    RIQLCFLVVWIHILAITAWTNPDDFAALQSLKDSWQNVPPNWA-GADPCGSQWEGIGCRN  66

Query  274  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  453
            SRV+S+TLSSM L+G+LSGDI+ LSELQ LDLSYNK+LTGSLP+ IG L KL NLILVGC
Sbjct  67   SRVISITLSSMSLSGQLSGDIQGLSELQTLDLSYNKELTGSLPQSIGKLTKLSNLILVGC  126

Query  454  GFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            GF G IPDSIGSL++L +LSLN N FIG IP ++G LS+LYWLDLADN+LTG++PV
Sbjct  127  GFSGPIPDSIGSLTQLVFLSLNSNNFIGRIPATIGYLSKLYWLDLADNKLTGTLPV  182



>ref|XP_009605195.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana tomentosiformis]
Length=957

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 152/186 (82%), Gaps = 2/186 (1%)
 Frame = +1

Query  67   MVI**TMIPR-IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCG  243
            MV+   M+PR IQL  + ++I  L I A+T+ +D+ A+++L+D W+NVPP+WA G+DPCG
Sbjct  1    MVVSLAMMPRRIQLCFLVVWIHVLAISAWTNPDDFAALQSLKDSWQNVPPNWA-GADPCG  59

Query  244  DHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLK  423
              WEG+GC  SRV+S+TLSSM L+G+LSGDI+ LSELQ LDLSYNK+LTGSLP+ IG L 
Sbjct  60   SQWEGIGCRNSRVISITLSSMSLSGQLSGDIQGLSELQTLDLSYNKELTGSLPQSIGKLT  119

Query  424  KLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQL  603
            KL NLILVGCGF G IPDSIGSL++L +LSLN N FIG IP ++G LS+LYWLDLADN+L
Sbjct  120  KLSNLILVGCGFSGPIPDSIGSLTQLVFLSLNSNNFIGRIPATIGYLSKLYWLDLADNKL  179

Query  604  TGSIPV  621
            TG++PV
Sbjct  180  TGTLPV  185



>ref|XP_002303227.1| hypothetical protein POPTR_0003s03700g [Populus trichocarpa]
 gb|EEE78206.1| hypothetical protein POPTR_0003s03700g [Populus trichocarpa]
Length=374

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 133/179 (74%), Gaps = 1/179 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            M PRI + LV    Q   I A TD  D+ A+KAL+D WKNVPP+W  G+DPCG  WEG+ 
Sbjct  1    MGPRILVFLVVALSQGCTIPAMTDEADFTALKALKDIWKNVPPTWV-GADPCGSRWEGIL  59

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            C  SRV S+TL+SM L G LSGDI+ LSELQILDLSYNK L+G LP  IG+LKKL NLIL
Sbjct  60   CANSRVTSITLASMGLKGSLSGDIQSLSELQILDLSYNKGLSGPLPSAIGDLKKLTNLIL  119

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            VGC F+G IPDSIGSL  L  LSLN N F G IP S+G L+ LYWLDLADN+LTG+IPV
Sbjct  120  VGCSFWGPIPDSIGSLPLLASLSLNSNGFTGSIPSSIGNLTSLYWLDLADNRLTGTIPV  178



>ref|XP_009605193.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana tomentosiformis]
Length=948

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 149/177 (84%), Gaps = 2/177 (1%)
 Frame = +1

Query  94   RIQLLL-VPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  270
            RIQL+  + +F+Q LG+ A T++ DY  +++LR+ W+NVPP+W+ G+DPCGD W+G+ CN
Sbjct  6    RIQLISWLLIFMQVLGLDALTNSGDYGVLESLREEWENVPPNWS-GTDPCGDPWDGIECN  64

Query  271  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  450
             SRVV++ LSSM+L GELSGDIE LSELQILDLSYNKDLTGSLP+ IG+LK L  LILVG
Sbjct  65   NSRVVTIKLSSMNLKGELSGDIEALSELQILDLSYNKDLTGSLPQSIGSLKSLSILILVG  124

Query  451  CGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            C F GLIPD++GSLS+L +LSLNLN F+GPIP S+G LS+LYWLDLADN+L+G +PV
Sbjct  125  CRFSGLIPDTVGSLSQLVFLSLNLNNFVGPIPASIGNLSKLYWLDLADNRLSGPLPV  181



>ref|XP_004230391.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Solanum lycopersicum]
Length=959

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 145/185 (78%), Gaps = 1/185 (1%)
 Frame = +1

Query  67   MVI**TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGD  246
            MV+   MIPRI L  + + I  L I A T+ +D  A+++L+D W+NVPP+W  G+DPCG 
Sbjct  1    MVVSQAMIPRILLCFLFVLIHVLSIAARTNPDDSAALQSLKDSWQNVPPNWV-GADPCGS  59

Query  247  HWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK  426
             W+G+GC  SRVVS+TLSSM L G+LSGDI+ L+EL+ LDLSYNK+L GSLP+ IG L K
Sbjct  60   SWDGIGCRNSRVVSITLSSMSLEGQLSGDIQGLAELETLDLSYNKELKGSLPQSIGKLTK  119

Query  427  LYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLT  606
            L NLILVGCGF G IPD+IGSL++L +LSLN N FIG IP ++G L+ELYWLDLADN+LT
Sbjct  120  LSNLILVGCGFSGPIPDTIGSLTRLVFLSLNSNNFIGGIPATVGYLTELYWLDLADNKLT  179

Query  607  GSIPV  621
            G+IPV
Sbjct  180  GTIPV  184



>gb|EYU33236.1| hypothetical protein MIMGU_mgv1a021943mg [Erythranthe guttata]
Length=955

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 141/179 (79%), Gaps = 1/179 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            MI  I L ++  FIQ L I A T++NDYVA+KAL+D W NVPP+W  GSDPCGD W+G+ 
Sbjct  1    MISGIHLTMLLAFIQVLSIAALTNSNDYVALKALKDTWINVPPNWV-GSDPCGDVWDGIT  59

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            C   RVVS+TL+S++LTG+LS DI  L+ELQ LDLSYNK +TGSLP  IGN+KKL +LIL
Sbjct  60   CKNDRVVSITLASINLTGQLSSDISGLTELQTLDLSYNKGMTGSLPSGIGNVKKLSSLIL  119

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            VGCGF G IP SIGSL +L+YLSLN N FIG IP S+G L  LYWLDLADN+LTG+IPV
Sbjct  120  VGCGFSGPIPPSIGSLQQLRYLSLNSNNFIGSIPPSIGNLLNLYWLDLADNKLTGTIPV  178



>ref|XP_006358482.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=959

 Score =   209 bits (532),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 144/185 (78%), Gaps = 1/185 (1%)
 Frame = +1

Query  67   MVI**TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGD  246
            MV+   MI RI L  + + I  L I A T+ +D  A+++L+D W+NVPP+W  G+DPCG 
Sbjct  1    MVVSRAMIRRILLCFLFVLIHVLSIAARTNPDDSAALQSLKDSWQNVPPNWV-GADPCGS  59

Query  247  HWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK  426
             W+G+GC  SRVVS+TLSSM L G+LSGDI+ L+EL+ LDLSYNK+L GSLP+ IG L K
Sbjct  60   SWDGIGCRNSRVVSITLSSMSLEGQLSGDIQGLAELETLDLSYNKELKGSLPQSIGKLTK  119

Query  427  LYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLT  606
            L NLILVGCGF G IPD+IGSL++L +LSLN N FIG IP ++G L+EL+WLDLADN+LT
Sbjct  120  LSNLILVGCGFSGPIPDTIGSLTRLVFLSLNSNNFIGGIPATIGNLTELHWLDLADNKLT  179

Query  607  GSIPV  621
            G+IPV
Sbjct  180  GTIPV  184



>gb|EYU33238.1| hypothetical protein MIMGU_mgv1a025286mg [Erythranthe guttata]
Length=952

 Score =   209 bits (532),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 140/179 (78%), Gaps = 1/179 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            MI R+ L L+  FIQ L I A T+ ND+ ++KAL+D W N PP+W  GSDPCGD W+G+ 
Sbjct  1    MIWRVLLSLLVAFIQVLAIAALTNTNDFTSLKALKDTWGNYPPNWI-GSDPCGDVWDGIT  59

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            C   RVVS+TL+S+DL+G+LS DI  L+ELQ LDLSYNK +TG LP +IGN+ KL +LIL
Sbjct  60   CKNDRVVSITLASIDLSGQLSSDIAGLTELQTLDLSYNKRMTGPLPPQIGNVNKLSSLIL  119

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            VGCGFFG IP SIGSL +L+YLSLN N FIG IP S+G L+ LYWLDLADN+LTG+IPV
Sbjct  120  VGCGFFGPIPGSIGSLQQLRYLSLNSNNFIGSIPPSIGNLTNLYWLDLADNKLTGTIPV  178



>ref|XP_009803111.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana sylvestris]
Length=948

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 145/177 (82%), Gaps = 2/177 (1%)
 Frame = +1

Query  94   RIQLLL-VPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  270
            RIQL+  + + +Q L + A T+  DY  +++L++ W+NVPPSW  G+DPCGD WEG+ CN
Sbjct  7    RIQLITWLVISMQVLVLQALTNPGDYGVLESLKEEWENVPPSW-RGTDPCGDPWEGIECN  65

Query  271  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  450
             SRVV++ LSSM+L G+LSGDIE LSELQILDLSYNK LTGSLP+ IG+LK L  LILVG
Sbjct  66   NSRVVTIKLSSMNLKGQLSGDIEALSELQILDLSYNKGLTGSLPQSIGSLKSLSILILVG  125

Query  451  CGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            CGF GLIPD++GSLS+L +LSLN+N FIGPIP S+G LS+LYWLDLADN+L+G +PV
Sbjct  126  CGFNGLIPDTVGSLSQLVFLSLNVNNFIGPIPASIGNLSKLYWLDLADNRLSGPLPV  182



>emb|CDO97682.1| unnamed protein product [Coffea canephora]
Length=953

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 141/179 (79%), Gaps = 1/179 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            M  RIQ  L+ +F+Q L + A T+  D+ A+++L+ GW+N PP+WA G+DPCG  W G+G
Sbjct  1    MFARIQPYLLVIFVQVLVVAAITNPQDFAALQSLKSGWENAPPNWA-GTDPCGSGWIGIG  59

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            C+ SRVVS+TL+S+ L+G++ GDI +LSEL  LDLSYN+ LTGSLPR IGNL KL +LIL
Sbjct  60   CSNSRVVSITLASVGLSGQVPGDIADLSELLTLDLSYNEGLTGSLPRTIGNLAKLTSLIL  119

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            VGCGF G IPD+IGS+ +L  LSLN NKFIG IP S+G L +L+WLDLADN+L+GSIPV
Sbjct  120  VGCGFSGQIPDTIGSMKQLYTLSLNSNKFIGQIPPSIGALPKLHWLDLADNKLSGSIPV  178



>ref|XP_009784887.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Nicotiana sylvestris]
Length=625

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = +1

Query  169  VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELS  348
             A+++L+D W+NVPP+WA G+DPCG  WEG+GC  SRV+S+TLSSM L+G+LSGDI+ LS
Sbjct  8    AALQSLKDSWQNVPPNWA-GADPCGSQWEGIGCRNSRVISITLSSMSLSGQLSGDIQGLS  66

Query  349  ELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnk  528
            ELQ LDLSYNK+LTGSLP+ IG L KL NLILVGCGF G IPDSIGSL++L +LSLN N 
Sbjct  67   ELQTLDLSYNKELTGSLPQSIGKLTKLSNLILVGCGFSGPIPDSIGSLTQLVFLSLNSNN  126

Query  529  FIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            FIG IP ++G LS+LYWLDLADN+LTG++PV
Sbjct  127  FIGRIPATIGYLSKLYWLDLADNKLTGTLPV  157



>ref|XP_006358481.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=947

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 146/179 (82%), Gaps = 5/179 (3%)
 Frame = +1

Query  97   IQLLLVPLFIQFLGIV----AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            IQL++  L I  + ++    A T++ DYV ++ L++ W+N+PPSW +GSDPC D WEG+ 
Sbjct  7    IQLIIFCLLIISMQVLVQLGASTNSGDYVVLEPLKEEWENIPPSW-DGSDPCNDPWEGID  65

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            CN SRV+S+ LSS++L GELSGDIE LSELQILDLSYNK LTGSLP+ IGNLK L  LIL
Sbjct  66   CNNSRVISIKLSSINLKGELSGDIEGLSELQILDLSYNKGLTGSLPQSIGNLKSLSILIL  125

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            VGCGF GLIP++IGSLS+L+YLSLNLN FIGPIP S+G LS+L+WLDLADN+L+G +PV
Sbjct  126  VGCGFSGLIPNTIGSLSQLEYLSLNLNNFIGPIPASVGNLSKLHWLDLADNKLSGPLPV  184



>gb|EYU33237.1| hypothetical protein MIMGU_mgv1a000884mg [Erythranthe guttata]
Length=951

 Score =   203 bits (517),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 140/179 (78%), Gaps = 1/179 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            MI RI L L+  FIQ L I A T++ND+ A+KAL+D W NVPP+W  GSDPCGD W+G+ 
Sbjct  1    MIWRIVLSLLLAFIQALAIGASTNSNDHAALKALKDTWTNVPPNWV-GSDPCGDVWDGIT  59

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            C   RVVS+TL+S++L G+LS DI  L+ELQ LDLSYNK +TGSLP  IG++KKL +LIL
Sbjct  60   CKNDRVVSITLASINLIGQLSSDISGLTELQTLDLSYNKGMTGSLPSGIGDVKKLSSLIL  119

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            VGCGF G IP SIGSL +L+YLSLN N FIG IP S+G L  LYWLDLADN+LTG+IPV
Sbjct  120  VGCGFSGPIPPSIGSLLQLRYLSLNSNNFIGSIPPSIGNLLNLYWLDLADNKLTGTIPV  178



>ref|XP_004230392.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Solanum lycopersicum]
Length=951

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 146/179 (82%), Gaps = 5/179 (3%)
 Frame = +1

Query  97   IQLLLVPLFIQFLGIV----AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            +QL++  L I  + ++    A TD+ DYV +++L++ W+NVPP+W +GSDPC D WEG+ 
Sbjct  7    VQLIIFCLLIISMQVLIQLEASTDSGDYVVLESLKEEWENVPPTW-DGSDPCDDPWEGID  65

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            CN SRV+S+ LSS++L GELSGDIE LSELQILDLSYNK LTGSLP+ IGNLK L  LIL
Sbjct  66   CNNSRVISIKLSSINLKGELSGDIEGLSELQILDLSYNKGLTGSLPQSIGNLKSLSILIL  125

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            VGCGF GLIP++IGSLS+L++LSLNLN FIGPIP S+G LS+L WLDLADN+L+G +P+
Sbjct  126  VGCGFSGLIPNTIGSLSQLEFLSLNLNNFIGPIPASVGNLSKLRWLDLADNKLSGPLPI  184



>ref|XP_010682082.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Beta vulgaris subsp. vulgaris]
Length=966

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +1

Query  82   TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  261
            +M  +I   L+ + +Q   I + TD+ND VA+ +L+  W+NVPPSW    DPCG+HWEG+
Sbjct  19   SMSLKIAFCLLLICVQLSYITSDTDSNDAVALSSLKALWENVPPSWNGFLDPCGNHWEGI  78

Query  262  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  441
             CN SRV+S+TLSSM L G+LSGDI++LSELQ LDLSYNK LT SLP  IG L KL NLI
Sbjct  79   VCNNSRVISITLSSMQLEGKLSGDIQQLSELQTLDLSYNKGLTSSLPEAIGKLAKLTNLI  138

Query  442  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L+ C F G IPDSIGSLS+L++LSLN N F G IP S+G LS+LYWLDLA+N+LTG++PV
Sbjct  139  LIDCNFIGKIPDSIGSLSELRFLSLNSNGFSGTIPRSIGSLSKLYWLDLAENKLTGTLPV  198



>gb|EPS63997.1| hypothetical protein M569_10784, partial [Genlisea aurea]
Length=390

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 131/168 (78%), Gaps = 1/168 (1%)
 Frame = +1

Query  118  LFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTL  297
            + I++  + A+T+ ND+ A+ AL+  W NVPP+W+ GSDPCG  W+G+ C  +RVVS+TL
Sbjct  7    IVIEYFVVTAWTNPNDFAALLALKSTWNNVPPNWS-GSDPCGSGWDGISCINNRVVSITL  65

Query  298  SSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPD  477
            +S++L G+LS DI  LSELQILDLSYN  +TG LP  IGNL KL +LILVGCGF G+IP 
Sbjct  66   ASINLNGQLSSDITALSELQILDLSYNPGMTGPLPTTIGNLVKLTSLILVGCGFSGVIPS  125

Query  478  SIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            SIGSL +L YLSLN N FIG IP S+G LS LYWLDLADN+L+GSIPV
Sbjct  126  SIGSLQQLVYLSLNSNNFIGEIPPSVGMLSNLYWLDLADNKLSGSIPV  173



>gb|KHG19770.1| hypothetical protein F383_03980 [Gossypium arboreum]
Length=826

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 132/175 (75%), Gaps = 1/175 (1%)
 Frame = +1

Query  97   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  276
            I +LL+   +Q     A TD  DY A+++L D W+N+PPSW  G+DPCGD W G+ C GS
Sbjct  5    IWVLLLAFSVQIYITTATTDGRDYAALRSLTDEWQNLPPSWT-GADPCGDSWVGIECTGS  63

Query  277  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  456
            RV S+TL +M+L GELSGDI  LSELQ LDLS+N++LTGSLP  IGNLKKL NLILVGCG
Sbjct  64   RVTSITLPNMNLVGELSGDIAMLSELQQLDLSFNRELTGSLPGSIGNLKKLKNLILVGCG  123

Query  457  FFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            F G IP +IGSL +L++LSLN N F G IP ++G LS LYWLD+ADNQL G IPV
Sbjct  124  FIGQIPYTIGSLPQLRFLSLNTNGFTGHIPPTIGNLSNLYWLDMADNQLEGPIPV  178



>ref|XP_007023745.1| Leucine-rich repeat protein kinase family protein isoform 3 [Theobroma 
cacao]
 gb|EOY26367.1| Leucine-rich repeat protein kinase family protein isoform 3 [Theobroma 
cacao]
Length=758

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 128/172 (74%), Gaps = 1/172 (1%)
 Frame = +1

Query  106  LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVV  285
            LL+ +F+Q   I A TD  D  A+K+L D W+  PPSW  G DPCGD W G+GCN SRV 
Sbjct  8    LLLVVFLQIYIIAATTDAGDSAALKSLMDEWEKAPPSWV-GGDPCGDSWVGIGCNDSRVT  66

Query  286  SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG  465
            S+TL SM L G LSGDI  LSELQ +DLSYN  LTGSLP  IGNLKKL NLILVGCGF G
Sbjct  67   SVTLPSMKLVGRLSGDISTLSELQQVDLSYNNGLTGSLPTSIGNLKKLTNLILVGCGFNG  126

Query  466  LIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             IPD+IGSLS+L++LSLN N F G IP S+G LS LYWLDLADNQL G IPV
Sbjct  127  PIPDAIGSLSQLRFLSLNSNGFTGRIPPSIGNLSNLYWLDLADNQLEGPIPV  178



>ref|XP_007023744.1| Leucine-rich repeat protein kinase family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY26366.1| Leucine-rich repeat protein kinase family protein, putative isoform 
2 [Theobroma cacao]
Length=909

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 128/172 (74%), Gaps = 1/172 (1%)
 Frame = +1

Query  106  LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVV  285
            LL+ +F+Q   I A TD  D  A+K+L D W+  PPSW  G DPCGD W G+GCN SRV 
Sbjct  8    LLLVVFLQIYIIAATTDAGDSAALKSLMDEWEKAPPSWV-GGDPCGDSWVGIGCNDSRVT  66

Query  286  SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG  465
            S+TL SM L G LSGDI  LSELQ +DLSYN  LTGSLP  IGNLKKL NLILVGCGF G
Sbjct  67   SVTLPSMKLVGRLSGDISTLSELQQVDLSYNNGLTGSLPTSIGNLKKLTNLILVGCGFNG  126

Query  466  LIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             IPD+IGSLS+L++LSLN N F G IP S+G LS LYWLDLADNQL G IPV
Sbjct  127  PIPDAIGSLSQLRFLSLNSNGFTGRIPPSIGNLSNLYWLDLADNQLEGPIPV  178



>ref|XP_007023743.1| Leucine-rich repeat protein kinase family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY26365.1| Leucine-rich repeat protein kinase family protein, putative isoform 
1 [Theobroma cacao]
Length=955

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 128/172 (74%), Gaps = 1/172 (1%)
 Frame = +1

Query  106  LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVV  285
            LL+ +F+Q   I A TD  D  A+K+L D W+  PPSW  G DPCGD W G+GCN SRV 
Sbjct  8    LLLVVFLQIYIIAATTDAGDSAALKSLMDEWEKAPPSWV-GGDPCGDSWVGIGCNDSRVT  66

Query  286  SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG  465
            S+TL SM L G LSGDI  LSELQ +DLSYN  LTGSLP  IGNLKKL NLILVGCGF G
Sbjct  67   SVTLPSMKLVGRLSGDISTLSELQQVDLSYNNGLTGSLPTSIGNLKKLTNLILVGCGFNG  126

Query  466  LIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             IPD+IGSLS+L++LSLN N F G IP S+G LS LYWLDLADNQL G IPV
Sbjct  127  PIPDAIGSLSQLRFLSLNSNGFTGRIPPSIGNLSNLYWLDLADNQLEGPIPV  178



>ref|XP_011092239.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Sesamum indicum]
Length=953

 Score =   197 bits (502),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 140/176 (80%), Gaps = 1/176 (1%)
 Frame = +1

Query  94   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  273
            RI L L+   +Q  GI A+T  +D+VA+K+L+D W+NVPP+W +G DPCG +W+G+ C+ 
Sbjct  5    RIHLCLLVALVQVFGIAAWTYTDDFVALKSLKDEWENVPPNW-DGDDPCGHNWDGISCSD  63

Query  274  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  453
            +RV+S+TL+S++L+G LS DI+ LS L+ LDLSYNK +TG LP  IGNL++L +LILVGC
Sbjct  64   TRVISITLASINLSGHLSSDIKGLSALETLDLSYNKGMTGPLPSSIGNLQELSSLILVGC  123

Query  454  GFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            GF G IP SIGSL +L YLSLN NKF+G IP S+G LS LYWLDLADN+L+G+IPV
Sbjct  124  GFSGPIPSSIGSLQQLVYLSLNSNKFVGEIPPSIGNLSNLYWLDLADNKLSGTIPV  179



>gb|AES64685.2| LRR receptor-like kinase [Medicago truncatula]
Length=954

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 127/161 (79%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            +V  T N+DY+A+  L+  WKNVPPSW +  DPCGDHWEG+ C+ SRV++++LSSMDL+G
Sbjct  20   VVTKTSNDDYLALSTLKYEWKNVPPSWEDSEDPCGDHWEGIECSNSRVITISLSSMDLSG  79

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            +LS +I  LSELQIL LSYNKDLTG LP EIGNLKKL NL L+ CGF G IPD+IG+L +
Sbjct  80   QLSSEIGSLSELQILVLSYNKDLTGPLPAEIGNLKKLTNLQLINCGFTGPIPDTIGNLQR  139

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +LSLN N+F G IP S+G LS + WLDLA+NQL G IPV
Sbjct  140  LVFLSLNSNRFSGRIPPSIGNLSNINWLDLAENQLEGPIPV  180



>ref|XP_003594434.1| Somatic embryogenesis receptor-like kinase [Medicago truncatula]
Length=986

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 127/161 (79%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            +V  T N+DY+A+  L+  WKNVPPSW +  DPCGDHWEG+ C+ SRV++++LSSMDL+G
Sbjct  20   VVTKTSNDDYLALSTLKYEWKNVPPSWEDSEDPCGDHWEGIECSNSRVITISLSSMDLSG  79

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            +LS +I  LSELQIL LSYNKDLTG LP EIGNLKKL NL L+ CGF G IPD+IG+L +
Sbjct  80   QLSSEIGSLSELQILVLSYNKDLTGPLPAEIGNLKKLTNLQLINCGFTGPIPDTIGNLQR  139

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +LSLN N+F G IP S+G LS + WLDLA+NQL G IPV
Sbjct  140  LVFLSLNSNRFSGRIPPSIGNLSNINWLDLAENQLEGPIPV  180



>ref|XP_002519381.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF42998.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=960

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 132/176 (75%), Gaps = 1/176 (1%)
 Frame = +1

Query  94   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  273
            RI L L+ + +Q   I A T+  D  A+ AL+D W+N PPSW +G+DPCGD WEG+ C  
Sbjct  11   RILLFLLFVSLQICNIAAVTNTADSSALNALKDIWQNTPPSW-KGADPCGDKWEGIECTN  69

Query  274  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  453
             RV S+TLSS+ +TG+LSGDI  L ELQILDLSYNK L G+LP  IGNLKKL NLILVGC
Sbjct  70   LRVTSITLSSIGITGQLSGDISNLQELQILDLSYNKGLEGTLPESIGNLKKLTNLILVGC  129

Query  454  GFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            GF G IP+SIGSL +L +LSLN N F G IP S+G L++LYWLDLADN+L G IPV
Sbjct  130  GFSGPIPNSIGSLQQLVFLSLNSNGFSGGIPPSIGNLAKLYWLDLADNKLEGRIPV  185



>ref|XP_006385116.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|ERP62913.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=958

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 132/179 (74%), Gaps = 1/179 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            M  RI + LV   IQ     A T+N+D+ A+KAL+D W+NVPP+W  G+DPCG  W+G+ 
Sbjct  1    MGSRILVFLVVALIQVCTTPAVTNNDDFNALKALKDVWENVPPTWV-GADPCGSRWDGIL  59

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            C  SRV S+TL+SM L G LSGDI  LSELQILDLSYN +L+G LP  IGNLK L +LIL
Sbjct  60   CTNSRVTSITLASMRLKGTLSGDISNLSELQILDLSYNTELSGPLPPAIGNLKMLTSLIL  119

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            VGC F G +PDSIGSL +L YLSLN N F G IP SLG L  LYWLDLADN+LTG+IPV
Sbjct  120  VGCRFSGPVPDSIGSLPRLTYLSLNSNGFTGTIPPSLGNLDNLYWLDLADNRLTGTIPV  178



>ref|XP_011028448.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Populus euphratica]
Length=888

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 133/179 (74%), Gaps = 1/179 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            M  RI + LV   IQ     A T+N+D+ A+KAL+D W+NVPPSW  GSDPCG  W+G+ 
Sbjct  1    MGSRILVFLVVALIQVCTTPAVTNNDDFNALKALKDIWENVPPSWV-GSDPCGSRWDGIL  59

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            C  SRV S+TL+SM L G LSGDI  LSELQILDLSYN +L+G LP  IG+LKKL +LIL
Sbjct  60   CTNSRVTSITLASMGLKGTLSGDISNLSELQILDLSYNPELSGPLPPAIGDLKKLTSLIL  119

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            V C F G IPD+IGSL +L YLSLN N F G IP SLG L +LYWLDLADN+LTG+IPV
Sbjct  120  VSCRFSGPIPDTIGSLPQLTYLSLNSNGFTGSIPPSLGNLDKLYWLDLADNRLTGNIPV  178



>gb|KJB68015.1| hypothetical protein B456_010G221900 [Gossypium raimondii]
 gb|KJB68017.1| hypothetical protein B456_010G221900 [Gossypium raimondii]
Length=736

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = +1

Query  97   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  276
            I +LL+   +Q     A TD  DY A+++L D W+N+PP+W E +DPCGD W G+ C GS
Sbjct  14   IWVLLLAFSVQIYITTATTDGRDYAALRSLTDEWQNLPPTWTE-ADPCGDSWVGIECTGS  72

Query  277  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  456
            RV S+TL +M+L GELSGDI  LSELQ LDLS+N++LTG LP  IGNLKKL NLILVGCG
Sbjct  73   RVTSITLPNMNLVGELSGDIAMLSELQQLDLSFNRELTGPLPGSIGNLKKLKNLILVGCG  132

Query  457  FFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            F G IP +IGSL +L++LSLN N F G IP ++G LS LYWLD+ADNQL G IPV
Sbjct  133  FIGQIPYTIGSLPQLRFLSLNTNGFTGHIPPTIGNLSNLYWLDMADNQLEGPIPV  187



>gb|KJB68018.1| hypothetical protein B456_010G221900 [Gossypium raimondii]
Length=710

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = +1

Query  97   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  276
            I +LL+   +Q     A TD  DY A+++L D W+N+PP+W E +DPCGD W G+ C GS
Sbjct  14   IWVLLLAFSVQIYITTATTDGRDYAALRSLTDEWQNLPPTWTE-ADPCGDSWVGIECTGS  72

Query  277  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  456
            RV S+TL +M+L GELSGDI  LSELQ LDLS+N++LTG LP  IGNLKKL NLILVGCG
Sbjct  73   RVTSITLPNMNLVGELSGDIAMLSELQQLDLSFNRELTGPLPGSIGNLKKLKNLILVGCG  132

Query  457  FFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            F G IP +IGSL +L++LSLN N F G IP ++G LS LYWLD+ADNQL G IPV
Sbjct  133  FIGQIPYTIGSLPQLRFLSLNTNGFTGHIPPTIGNLSNLYWLDMADNQLEGPIPV  187



>ref|XP_011028446.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Populus euphratica]
Length=958

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 133/179 (74%), Gaps = 1/179 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            M  RI + LV   IQ     A T+N+D+ A+KAL+D W+NVPPSW  GSDPCG  W+G+ 
Sbjct  1    MGSRILVFLVVALIQVCTTPAVTNNDDFNALKALKDIWENVPPSWV-GSDPCGSRWDGIL  59

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            C  SRV S+TL+SM L G LSGDI  LSELQILDLSYN +L+G LP  IG+LKKL +LIL
Sbjct  60   CTNSRVTSITLASMGLKGTLSGDISNLSELQILDLSYNPELSGPLPPAIGDLKKLTSLIL  119

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            V C F G IPD+IGSL +L YLSLN N F G IP SLG L +LYWLDLADN+LTG+IPV
Sbjct  120  VSCRFSGPIPDTIGSLPQLTYLSLNSNGFTGSIPPSLGNLDKLYWLDLADNRLTGNIPV  178



>gb|KJB68014.1| hypothetical protein B456_010G221900 [Gossypium raimondii]
Length=947

 Score =   195 bits (496),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = +1

Query  97   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  276
            I +LL+   +Q     A TD  DY A+++L D W+N+PP+W E +DPCGD W G+ C GS
Sbjct  14   IWVLLLAFSVQIYITTATTDGRDYAALRSLTDEWQNLPPTWTE-ADPCGDSWVGIECTGS  72

Query  277  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  456
            RV S+TL +M+L GELSGDI  LSELQ LDLS+N++LTG LP  IGNLKKL NLILVGCG
Sbjct  73   RVTSITLPNMNLVGELSGDIAMLSELQQLDLSFNRELTGPLPGSIGNLKKLKNLILVGCG  132

Query  457  FFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            F G IP +IGSL +L++LSLN N F G IP ++G LS LYWLD+ADNQL G IPV
Sbjct  133  FIGQIPYTIGSLPQLRFLSLNTNGFTGHIPPTIGNLSNLYWLDMADNQLEGPIPV  187



>ref|XP_010657900.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like protein kinase At5g49770 [Vitis vinifera]
Length=980

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 137/177 (77%), Gaps = 4/177 (2%)
 Frame = +1

Query  100  QLLLVPLFIQFLGIVAF---TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  270
            +L+LV L I F+ I A    T+ +D  A+ AL+D W+N PPSW  G DPCG  WEG+GC 
Sbjct  4    RLILVSLLIVFIQISATWARTNTDDATALVALKDLWENYPPSWV-GFDPCGSSWEGIGCY  62

Query  271  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  450
              RV+S+ L+SM L G LSGD+++LSELQILDLSYNK+LTG++P  IG+LKKL NLILVG
Sbjct  63   NQRVISIILTSMGLKGGLSGDLDQLSELQILDLSYNKNLTGNIPASIGSLKKLTNLILVG  122

Query  451  CGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            C F G IPD+IGSL++L +LSLN N F G IP S+G LS+LYWLDLADNQLTG+IP+
Sbjct  123  CSFSGPIPDTIGSLTELVFLSLNSNSFSGGIPPSIGNLSKLYWLDLADNQLTGTIPI  179



>ref|XP_006358480.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=960

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 138/185 (75%), Gaps = 2/185 (1%)
 Frame = +1

Query  67   MVI**TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGD  246
            MV+   M+ RI +  + + IQ L + A T+  D  A+K+L+D W   P +W  G DPCG 
Sbjct  1    MVVSMAMMLRIFVSFLVVLIQVLSVAARTNPVDSAALKSLKDSWYG-PSNWT-GEDPCGS  58

Query  247  HWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK  426
             WEGVGC  SRV+S+TLSSMDL G+LSGD++ LSEL+ LDLSYNKDLTG L + IG L K
Sbjct  59   SWEGVGCRNSRVISITLSSMDLNGQLSGDVQGLSELETLDLSYNKDLTGYLSQSIGKLTK  118

Query  427  LYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLT  606
            L NLILVGCGF G IPDSIGSL++L +LSLN NKF G IP ++G L+ELYWLDL+DNQ+ 
Sbjct  119  LSNLILVGCGFSGPIPDSIGSLTQLFFLSLNSNKFTGGIPATIGYLTELYWLDLSDNQIE  178

Query  607  GSIPV  621
            G+IPV
Sbjct  179  GNIPV  183



>gb|KDO40686.1| hypothetical protein CISIN_1g002189mg [Citrus sinensis]
Length=955

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 133/177 (75%), Gaps = 2/177 (1%)
 Frame = +1

Query  94   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDG-WKNVPPSWAEGSDPCGDHWEGVGCN  270
            + ++ L+ +++QFL I A T++ND+V +KAL+D  W+N PP+W + +DPCGD+WEG+GC 
Sbjct  4    KRKVFLLSVYLQFLIIAAVTNDNDFVILKALKDDIWENEPPNW-KNNDPCGDNWEGIGCT  62

Query  271  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  450
             SRV S+TLS M L G+LSGDI  L+EL  LDLS NKDL G LP  IGNLKKL NL+LVG
Sbjct  63   NSRVTSITLSGMGLKGQLSGDITGLTELHTLDLSNNKDLRGPLPTTIGNLKKLSNLMLVG  122

Query  451  CGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            C F G IPDSIGSL +L  LSLN N F G +P S+G LS LYWLDL DN+L G IPV
Sbjct  123  CSFSGPIPDSIGSLQELVLLSLNSNGFSGRVPPSIGNLSNLYWLDLTDNKLEGEIPV  179



>ref|XP_006431373.1| hypothetical protein CICLE_v10000176mg [Citrus clementina]
 gb|ESR44613.1| hypothetical protein CICLE_v10000176mg [Citrus clementina]
Length=955

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 133/177 (75%), Gaps = 2/177 (1%)
 Frame = +1

Query  94   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDG-WKNVPPSWAEGSDPCGDHWEGVGCN  270
            + ++ L+ +++QFL I A T++ND+V +KAL+D  W+N PP+W + +DPCGD+WEG+GC 
Sbjct  4    KRKVFLLSVYLQFLIIAAVTNDNDFVILKALKDDIWENEPPNW-KNNDPCGDNWEGIGCT  62

Query  271  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  450
             SRV S+TLS M L G+LSGDI  L+EL  LDLS NKDL G LP  IGNLKKL NL+LVG
Sbjct  63   NSRVTSITLSGMGLKGQLSGDITGLTELHTLDLSNNKDLRGPLPTTIGNLKKLSNLMLVG  122

Query  451  CGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            C F G IPDSIGSL +L  LSLN N F G +P S+G LS LYWLDL DN+L G IPV
Sbjct  123  CSFSGPIPDSIGSLQELVLLSLNSNGFSGRVPPSIGNLSNLYWLDLTDNKLEGEIPV  179



>ref|XP_010065204.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=955

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = +1

Query  145  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  324
            A T+  D+ AIK L   W+N PP+W  G DPCG+ W+G+GC  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFSAIKGLMSDWQNTPPNWV-GIDPCGNGWDGIGCKNSRITSITLSSMGLTGSL  79

Query  325  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  504
             GDI +LSELQILDLSYNKDLTGSLP +IGNL KL NL+LVGCG +G IPDSIGSL  L 
Sbjct  80   PGDIGQLSELQILDLSYNKDLTGSLPVQIGNLVKLTNLLLVGCGLYGPIPDSIGSLQNLV  139

Query  505  ylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LSLN N F G IP ++G LS LYWLDLADNQLTGSIPV
Sbjct  140  FLSLNSNGFSGLIPPTIGNLSRLYWLDLADNQLTGSIPV  178



>gb|KCW62551.1| hypothetical protein EUGRSUZ_G00043, partial [Eucalyptus grandis]
Length=945

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = +1

Query  145  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  324
            A T+  D+ AIK L   W+N PP+W  G DPCG+ W+G+GC  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFSAIKGLMSDWQNTPPNWV-GIDPCGNGWDGIGCKNSRITSITLSSMGLTGSL  79

Query  325  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  504
             GDI +LSELQILDLSYNKDLTGSLP +IGNL KL NL+LVGCG +G IPDSIGSL  L 
Sbjct  80   PGDIGQLSELQILDLSYNKDLTGSLPVQIGNLVKLTNLLLVGCGLYGPIPDSIGSLQNLV  139

Query  505  ylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LSLN N F G IP ++G LS LYWLDLADNQLTGSIPV
Sbjct  140  FLSLNSNGFSGLIPPTIGNLSRLYWLDLADNQLTGSIPV  178



>gb|KCW62549.1| hypothetical protein EUGRSUZ_G00041 [Eucalyptus grandis]
Length=940

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = +1

Query  145  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  324
            A T+  D+ AI  L+  W+N PP+W  G+DPCG+ W+G+ C  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFSAIMGLKSDWQNTPPNWV-GTDPCGNGWDGIHCTNSRITSITLSSMGLTGSL  79

Query  325  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  504
            SGDI +LS+LQILDLSYNK LTGSLP +IGNL KL NLILVGCGF G IPDSIGSL  L 
Sbjct  80   SGDIGQLSKLQILDLSYNKGLTGSLPVQIGNLMKLTNLILVGCGFSGQIPDSIGSLHNLV  139

Query  505  ylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LSLN N+F G IP ++G LS LYWLDLADNQLTGSIPV
Sbjct  140  FLSLNSNEFSGLIPPTIGNLSRLYWLDLADNQLTGSIPV  178



>ref|XP_006470792.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Citrus sinensis]
Length=955

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 133/177 (75%), Gaps = 2/177 (1%)
 Frame = +1

Query  94   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDG-WKNVPPSWAEGSDPCGDHWEGVGCN  270
            + ++ L+ +++QFL I A T++ND+V +KAL+D  W+N PP+W + +DPCGD+WEG+GC 
Sbjct  4    KRKVFLLSVYLQFLIIAAVTNDNDFVILKALKDDIWENEPPNW-KNNDPCGDNWEGIGCT  62

Query  271  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  450
             SRV S+TLS M L G+LSGDI  L+EL  LDLS N DL G LP  IGNLKKL NL+LVG
Sbjct  63   NSRVTSITLSGMGLKGQLSGDITGLTELHTLDLSNNNDLRGPLPTTIGNLKKLSNLMLVG  122

Query  451  CGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            C F G IPDSIGSL +L  LSLN N F G IP S+G LS+LYWLDL DN+L G IPV
Sbjct  123  CSFSGPIPDSIGSLQELVLLSLNSNGFSGRIPPSIGNLSKLYWLDLTDNKLEGEIPV  179



>ref|XP_010682075.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=959

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 131/176 (74%), Gaps = 1/176 (1%)
 Frame = +1

Query  94   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  273
            RI L +  + I+   I A T++ D  A+ AL  GW+N+PP+W  G DPCG+ WEG+ CN 
Sbjct  12   RIGLFVAFICIKIGDIAAQTNSQDSSALVALTSGWRNLPPNWT-GRDPCGNRWEGITCND  70

Query  274  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  453
            SR+ ++TL++M LTG+L+GD+  LSELQILDLSYN+ LTG LP+ IG L +L +LIL+GC
Sbjct  71   SRITAITLANMGLTGQLTGDLASLSELQILDLSYNRGLTGPLPQSIGRLSRLTSLILIGC  130

Query  454  GFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            GF G IPDSIGSL  +  LSLN N F GP+P ++G +  LYWLDLADNQL+GSIPV
Sbjct  131  GFSGRIPDSIGSLELVDNLSLNENNFTGPVPATIGNMLNLYWLDLADNQLSGSIPV  186



>ref|XP_010067941.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=947

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = +1

Query  145  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  324
            A T+  D+ AI  L+  W+N PP+W  G+DPCG+ W+G+ C  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFSAIMGLKSDWQNTPPNWV-GTDPCGNGWDGIHCTNSRITSITLSSMGLTGSL  79

Query  325  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  504
            SGDI +LS+LQILDLSYNK LTGSLP +IGNL KL NLILVGCGF G IPDSIGSL  L 
Sbjct  80   SGDIGQLSKLQILDLSYNKGLTGSLPVQIGNLMKLTNLILVGCGFSGQIPDSIGSLHNLV  139

Query  505  ylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LSLN N+F G IP ++G LS LYWLDLADNQLTGSIPV
Sbjct  140  FLSLNSNEFSGLIPPTIGNLSRLYWLDLADNQLTGSIPV  178



>gb|KCW62550.1| hypothetical protein EUGRSUZ_G00041 [Eucalyptus grandis]
Length=933

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = +1

Query  145  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  324
            A T+  D+ AI  L+  W+N PP+W  G+DPCG+ W+G+ C  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFSAIMGLKSDWQNTPPNWV-GTDPCGNGWDGIHCTNSRITSITLSSMGLTGSL  79

Query  325  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  504
            SGDI +LS+LQILDLSYNK LTGSLP +IGNL KL NLILVGCGF G IPDSIGSL  L 
Sbjct  80   SGDIGQLSKLQILDLSYNKGLTGSLPVQIGNLMKLTNLILVGCGFSGQIPDSIGSLHNLV  139

Query  505  ylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LSLN N+F G IP ++G LS LYWLDLADNQLTGSIPV
Sbjct  140  FLSLNSNEFSGLIPPTIGNLSRLYWLDLADNQLTGSIPV  178



>ref|XP_006385112.1| hypothetical protein POPTR_0004s24030g [Populus trichocarpa]
 gb|ERP62909.1| hypothetical protein POPTR_0004s24030g [Populus trichocarpa]
Length=959

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 133/180 (74%), Gaps = 2/180 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  261
            M  RI + LV   IQ      A T+N+D+ A+KAL+D W NVPP+W  G+DPCG  W+G+
Sbjct  1    MGSRILVFLVVALIQVCTTTPAVTNNDDFNALKALKDVWDNVPPTWV-GADPCGSRWDGI  59

Query  262  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  441
             C  SRV S+TL+SM L G LSGDI  LSELQILDLSYN +LTGSLP  IG+LKKL NLI
Sbjct  60   VCTNSRVTSITLASMGLKGTLSGDISLLSELQILDLSYNTELTGSLPLAIGDLKKLTNLI  119

Query  442  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            LV C F G IPD+IGSLS+L  LSLN N+F G IP SLG L +L+WLDLADN LTG+IPV
Sbjct  120  LVRCRFSGPIPDAIGSLSQLTDLSLNSNRFSGSIPPSLGNLDKLFWLDLADNMLTGTIPV  179



>emb|CBI29612.3| unnamed protein product [Vitis vinifera]
Length=2030

 Score =   194 bits (494),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 137/177 (77%), Gaps = 4/177 (2%)
 Frame = +1

Query  100  QLLLVPLFIQFLGIVAF---TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  270
            +L+LV L I F+ I A    T+ +D  A+ AL+D W+N PPSW  G DPCG  WEG+GC 
Sbjct  4    RLILVSLLIVFIQISATWARTNTDDATALVALKDLWENYPPSWV-GFDPCGSSWEGIGCY  62

Query  271  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  450
              RV+S+ L+SM L G LSGD+++LSELQILDLSYNK+LTG++P  IG+LKKL NLILVG
Sbjct  63   NQRVISIILTSMGLKGGLSGDLDQLSELQILDLSYNKNLTGNIPASIGSLKKLTNLILVG  122

Query  451  CGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            C F G IPD+IGSL++L +LSLN N F G IP S+G LS+LYWLDLADNQLTG+IP+
Sbjct  123  CSFSGPIPDTIGSLTELVFLSLNSNSFSGGIPPSIGNLSKLYWLDLADNQLTGTIPI  179


 Score =   160 bits (404),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 119/168 (71%), Gaps = 3/168 (2%)
 Frame = +1

Query  118   LFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTL  297
             LF   L +    D  D  A  AL+   KN+P +W  G+DPC + WEG+GC+  RV+S+TL
Sbjct  1099  LFESSLSLAHIYDFGD--ATTALKSLLKNLPFTWV-GADPCVNGWEGIGCSNGRVISITL  1155

Query  298   SSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPD  477
             +SMDL GELS D + LSEL+ILDLSYNK LTG++P  IG+LK L NLIL+GC F G IPD
Sbjct  1156  ASMDLKGELSEDFQGLSELKILDLSYNKGLTGNIPASIGSLKSLTNLILMGCSFSGQIPD  1215

Query  478   SIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             +IGSL+ L  LSLN N F G IP S+G L  L WLD+ +NQ+TG+IP+
Sbjct  1216  TIGSLTNLVVLSLNSNSFSGVIPPSIGNLYNLNWLDITENQITGTIPI  1263



>ref|XP_010252241.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Nelumbo nucifera]
Length=955

 Score =   192 bits (488),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 132/179 (74%), Gaps = 1/179 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            M  +IQ  L+ +  Q     A T++ND  A+ ++R  WKN P +W EGSDPCG  W G+ 
Sbjct  1    MDKKIQACLLVVLFQISFSGAQTNSNDVAALNSIRLLWKNTPSNW-EGSDPCGGGWVGIT  59

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            CN SRVVS+TLSSM L G+LSGDI+ LSELQ LDLSYNK L GSLP  IG+L KL NLIL
Sbjct  60   CNNSRVVSITLSSMGLKGQLSGDIQSLSELQALDLSYNKGLNGSLPVSIGSLTKLSNLIL  119

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            VGC F G IPD+IGSL +L +LSLN N F G IP S+G LS+LYWLDLADN+LTG+IPV
Sbjct  120  VGCSFSGPIPDTIGSLKQLAFLSLNSNSFTGEIPPSIGNLSKLYWLDLADNKLTGTIPV  178



>ref|XP_010065206.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
 gb|KCW62547.1| hypothetical protein EUGRSUZ_G00039 [Eucalyptus grandis]
Length=958

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = +1

Query  145  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  324
            A T+  D+ AIK L   W+N PP+W  G+DPCG  W+G+ C  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFGAIKGLMSDWQNTPPNWV-GTDPCGGDWDGIVCTNSRITSITLSSMGLTGSL  79

Query  325  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  504
             GDI +LSELQILDLSYN+ LTGSLP +IGNL KL NLILVGCGF G IPDSIGSL  L 
Sbjct  80   PGDIGQLSELQILDLSYNRGLTGSLPTQIGNLMKLTNLILVGCGFSGRIPDSIGSLQNLV  139

Query  505  ylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LSLN N F G IP ++G LS LYWLDLADNQLTGSIPV
Sbjct  140  FLSLNSNGFSGQIPPTIGNLSRLYWLDLADNQLTGSIPV  178



>gb|KJB68016.1| hypothetical protein B456_010G221900 [Gossypium raimondii]
Length=943

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 124/175 (71%), Gaps = 5/175 (3%)
 Frame = +1

Query  97   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  276
            I +LL+   +Q     A TD  DY A+++L D W+N+PP+W E +DPCGD W G+ C GS
Sbjct  14   IWVLLLAFSVQIYITTATTDGRDYAALRSLTDEWQNLPPTWTE-ADPCGDSWVGIECTGS  72

Query  277  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  456
            RV S+TL +M+L GELSGDI  LSELQ LDLS+N++LTG LP  IGNLKKL NLILVGCG
Sbjct  73   RVTSITLPNMNLVGELSGDIAMLSELQQLDLSFNRELTGPLPGSIGNLKKLKNLILVGCG  132

Query  457  FFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            F G IP +IG        SLN N F G IP ++G LS LYWLD+ADNQL G IPV
Sbjct  133  FIGQIPYTIG----SLPQSLNTNGFTGHIPPTIGNLSNLYWLDMADNQLEGPIPV  183



>ref|XP_004486417.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Cicer arietinum]
Length=953

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 130/177 (73%), Gaps = 1/177 (1%)
 Frame = +1

Query  94   RIQLLLVPLF-IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  270
            R+ + L  LF   F+ +V  T N DY+A+  L+  WKN PPSW    DPCGDHWEG+ C 
Sbjct  4    RVLVFLHLLFSYLFVVVVTKTSNEDYLALLTLKYEWKNTPPSWEGSEDPCGDHWEGIECI  63

Query  271  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  450
             SRV +++L+SMDL+G+LS DI  LSELQIL LSYNK+LTG L  EIGNLKKL NL L+ 
Sbjct  64   NSRVTTISLASMDLSGQLSADIGLLSELQILVLSYNKNLTGPLHAEIGNLKKLTNLQLIN  123

Query  451  CGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            CGF G IPD+IG+L +L +LSLN N+F G IP ++G LS +YWLDLA+NQL G IP+
Sbjct  124  CGFIGPIPDTIGNLQRLVFLSLNSNRFSGKIPPAIGNLSSIYWLDLAENQLEGRIPI  180



>gb|KCW62545.1| hypothetical protein EUGRSUZ_G00037, partial [Eucalyptus grandis]
Length=937

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = +1

Query  145  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  324
            A T+  D  A+  L   W+N PP+W  G+DPCGD+W G+ CN SRV S+ LSS  LTG L
Sbjct  21   AATNPYDLSALTGLMTDWQNAPPNWV-GTDPCGDNWVGIRCNNSRVTSIILSSAGLTGSL  79

Query  325  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  504
            SGDI +LSELQILDLSYNK LTGSLP +IGNL KL   ILVGCGFFG IPDSIG L  L 
Sbjct  80   SGDIGQLSELQILDLSYNKGLTGSLPEQIGNLIKLTRWILVGCGFFGQIPDSIGYLQNLV  139

Query  505  ylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            YL+LN N+F GPIP  +G LS LYWLDLADNQLTGSIP+
Sbjct  140  YLALNSNRFSGPIPAIIGNLSTLYWLDLADNQLTGSIPI  178



>ref|XP_010065205.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=955

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = +1

Query  145  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  324
            A T+  D+ AI+ L   W++ PP+W  G+DPCG+ W+G+GC  SR+ S+TLSSM LTG L
Sbjct  21   AATNPYDFSAIEGLMSYWQHTPPNWV-GTDPCGNGWDGIGCTNSRITSITLSSMGLTGSL  79

Query  325  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  504
             GDI +LSEL+ILDLSYN+ LTGSLP +IGNL KL NLILVGCGF G IPDSIGSL  L 
Sbjct  80   PGDIVQLSELRILDLSYNRGLTGSLPAQIGNLMKLTNLILVGCGFSGQIPDSIGSLQNLV  139

Query  505  ylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LSLN N+F G IP ++G LS LYWLDLADNQLTGSIPV
Sbjct  140  FLSLNSNEFSGLIPPTIGNLSRLYWLDLADNQLTGSIPV  178



>ref|XP_007156284.1| hypothetical protein PHAVU_003G273700g [Phaseolus vulgaris]
 gb|ESW28278.1| hypothetical protein PHAVU_003G273700g [Phaseolus vulgaris]
Length=965

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 131/177 (74%), Gaps = 5/177 (3%)
 Frame = +1

Query  106  LLVPLFIQFL-----GIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  270
            L V LF+ FL      I ++T+  D VA+++L+D W N PPSW    DPCG+ WEGV CN
Sbjct  4    LCVLLFLGFLWAEIHVISSYTETQDVVALRSLKDEWHNTPPSWDRSDDPCGEPWEGVTCN  63

Query  271  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  450
             SRV SL LS+M L G+LSGDI +LSEL+ LDLS+N+DLTGSL  E+G L KL  LIL G
Sbjct  64   KSRVTSLGLSTMGLKGKLSGDIGQLSELRSLDLSFNRDLTGSLSPELGELSKLNILILAG  123

Query  451  CGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            CGF G IPD +G+LS+L +L+LN N F G IP SLG+LS++YWLDLADNQLTG IPV
Sbjct  124  CGFSGNIPDELGNLSELSFLALNSNNFTGKIPPSLGKLSKIYWLDLADNQLTGPIPV  180



>ref|XP_011092237.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Sesamum indicum]
Length=943

 Score =   189 bits (481),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 135/176 (77%), Gaps = 2/176 (1%)
 Frame = +1

Query  94   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  273
            RI   L+ + +Q  G  A T+ +D+VA++AL+D WKN+PPSW +G DPCG+ W+G+ C+ 
Sbjct  5    RILCSLLVVLVQVFGTAARTNTDDFVALEALKDVWKNLPPSW-DGDDPCGNDWDGISCSD  63

Query  274  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  453
             RV S++L SM+L G+LS DI++LS L ILDLSYN +L G+LP  IGNLKKL  LILVGC
Sbjct  64   DRVTSISLGSMNLNGQLSSDIQKLSALVILDLSYN-NLNGALPTSIGNLKKLTTLILVGC  122

Query  454  GFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G  G IPDSIGSL +L+ LSLN N F+GPIP S+G LS+LY LDL DN+L+G+IPV
Sbjct  123  GLSGRIPDSIGSLPELQLLSLNSNNFVGPIPPSIGNLSKLYLLDLTDNKLSGTIPV  178



>ref|XP_010682077.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=954

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 131/180 (73%), Gaps = 3/180 (2%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            M+ RI L L  + I   G  A T N D VA+KAL +  K++P SW  G DPCG  WEG+ 
Sbjct  2    MLLRILLSLAFICIHVWGTTAQT-NEDGVALKALIEDRKSLPESWT-GEDPCGSRWEGIT  59

Query  265  CNGSRVVSLTLSSMDLTGELS-GDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  441
            CN SR++++TL+SM LTG+LS GD+  LSELQ LDLSYNK  TGSLP  IG+L KL +LI
Sbjct  60   CNNSRIITITLASMGLTGQLSTGDLTSLSELQTLDLSYNKGFTGSLPSNIGDLSKLTSLI  119

Query  442  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            LVGCGF G IPDS+GSL KL  LSLN N FIG +P S+G L  LYWLDL+DNQLTGSIPV
Sbjct  120  LVGCGFSGRIPDSVGSLKKLITLSLNSNSFIGEVPASIGNLKHLYWLDLSDNQLTGSIPV  179



>gb|KEH37006.1| LRR receptor-like kinase [Medicago truncatula]
Length=942

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = +1

Query  166  YVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEEL  345
            Y+A+  L+  WKNVPPSW +  DPCGDHWEG+ C+ SRV++++LSSMDL+G+LS +I  L
Sbjct  17   YLALSTLKYEWKNVPPSWEDSEDPCGDHWEGIECSNSRVITISLSSMDLSGQLSSEIGSL  76

Query  346  SELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnln  525
            SELQIL LSYNKDLTG LP EIGNLKKL NL L+ CGF G IPD+IG+L +L +LSLN N
Sbjct  77   SELQILVLSYNKDLTGPLPAEIGNLKKLTNLQLINCGFTGPIPDTIGNLQRLVFLSLNSN  136

Query  526  kFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +F G IP S+G LS + WLDLA+NQL G IPV
Sbjct  137  RFSGRIPPSIGNLSNINWLDLAENQLEGPIPV  168



>emb|CDX83185.1| BnaA03g23210D [Brassica napus]
Length=247

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 128/173 (74%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +LL+ LF Q L + A T+  D  A++AL+  W   P +W EG+DPCG  W G+ C+ +RV
Sbjct  9    MLLIFLFFQILSVSALTNGFDGSALQALKAEWTKPPSNW-EGADPCGTSWVGITCSNNRV  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            VS++L ++++ G+LSGDI  LSELQILDLSYN  LTG LP  IG LKKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSGDIAALSELQILDLSYNTGLTGPLPPNIGELKKLKNLILVGCSFT  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP SIG L +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++PV
Sbjct  128  GQIPQSIGQLEQLIYLSLNLNQFSGTIPASIGRLSKLYWFDIADNQIEGTLPV  180



>ref|XP_010088710.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
 gb|EXB36891.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
Length=1000

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 136/179 (76%), Gaps = 5/179 (3%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            M  ++QL L+ +F +   I A  +N+D++ +K+L   WKN PP+W +GSDPCG  WEG+ 
Sbjct  67   MDQKLQLFLLLVFSKTFFITA--ENSDFLGLKSLE--WKNTPPNW-KGSDPCGSEWEGID  121

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            C  SRV S+TLSS+ L G+LSG+I++LSEL+ LDLSYNK LTG LP  IGNLKKL NLIL
Sbjct  122  CTNSRVTSITLSSLGLEGQLSGEIDQLSELEALDLSYNKKLTGLLPESIGNLKKLSNLIL  181

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            VGCGF+G IP +IGSL +L +LSLN N+F G IP ++G LS+LYWLDLADN + G IP+
Sbjct  182  VGCGFYGQIPGTIGSLQELVFLSLNSNRFTGLIPPAIGNLSKLYWLDLADNNIEGMIPI  240



>ref|XP_010533231.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Tarenaya hassleriana]
Length=954

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 123/167 (74%), Gaps = 1/167 (1%)
 Frame = +1

Query  121  FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  300
            F++   + + TD+ D   +KAL DGWKN PP+W +GSDPCG +W G+ C   RV S+ LS
Sbjct  16   FVEICSVASQTDSRDSAGLKALMDGWKNFPPNW-QGSDPCGANWVGISCTNGRVTSIALS  74

Query  301  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  480
            +MDL G L GDI  LSELQILDLSYN  L G+L   IG LKKL NLILVGC F G IPD+
Sbjct  75   NMDLEGTLPGDISALSELQILDLSYNPSLAGTLSPGIGQLKKLKNLILVGCSFTGAIPDA  134

Query  481  IGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            IGSL++L YLSLN N+F G IP +LGQLS LYW D+ADNQ+ GSIPV
Sbjct  135  IGSLTQLVYLSLNSNQFSGRIPATLGQLSNLYWFDIADNQIEGSIPV  181



>ref|XP_010521415.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Tarenaya hassleriana]
Length=957

 Score =   187 bits (474),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 133/179 (74%), Gaps = 4/179 (2%)
 Frame = +1

Query  94   RIQLLLVPLF---IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            R++ LL+ L    +Q   + + T++ D   +KAL + WKN PP+W +GSDPCG  W G+ 
Sbjct  6    RVRTLLLVLMMASVQICSVTSQTNSGDSAGLKALMNEWKNFPPNW-KGSDPCGSGWVGIS  64

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            C   RV S++L++M+L G LSGDI  LSELQILDLSYN  LTG+LP  IG LKKL NLIL
Sbjct  65   CTNGRVTSISLANMNLKGTLSGDISALSELQILDLSYNLGLTGTLPSAIGQLKKLKNLIL  124

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            VGCGF G IP+SIGSLS+L YLSLN N+F G IP SLGQLS+LYW D+ADN++ GSIPV
Sbjct  125  VGCGFAGPIPESIGSLSQLVYLSLNSNQFSGRIPPSLGQLSDLYWFDIADNRIEGSIPV  183



>ref|XP_007019716.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007019717.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY16941.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY16942.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=963

 Score =   187 bits (474),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 124/161 (77%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            I AFTD +D  A+++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M L G
Sbjct  20   ISAFTDPHDAAALQSLKDSWQNTPPSWDKSDDPCGAPWEGVTCNSSRVTALGLSTMGLKG  79

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            +LSGDI EL+EL+ LDLS+N+DLTGSL   +G+L+KL  LIL GCGF G IP+ +G L++
Sbjct  80   KLSGDIGELTELRSLDLSFNRDLTGSLSPRLGDLEKLNILILAGCGFTGNIPEELGKLAE  139

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +L+LN N F G IP SLG LS+LYWLDLADNQL GSIPV
Sbjct  140  LSFLALNSNNFTGRIPPSLGTLSKLYWLDLADNQLMGSIPV  180



>ref|XP_010065203.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=929

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 113/142 (80%), Gaps = 1/142 (1%)
 Frame = +1

Query  196  WKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSY  375
            W+N PP+W  G+DPCGD+W G+ CN SRV S+ LSS  LTG LSGDI +LSELQILDLSY
Sbjct  4    WQNAPPNWV-GTDPCGDNWVGIRCNNSRVTSIILSSAGLTGSLSGDIGQLSELQILDLSY  62

Query  376  NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSL  555
            NK LTGSLP +IGNL KL   ILVGCGFFG IPDSIG L  L YL+LN N+F GPIP  +
Sbjct  63   NKGLTGSLPEQIGNLIKLTRWILVGCGFFGQIPDSIGYLQNLVYLALNSNRFSGPIPAII  122

Query  556  GQLSELYWLDLADNQLTGSIPV  621
            G LS LYWLDLADNQLTGSIP+
Sbjct  123  GNLSTLYWLDLADNQLTGSIPI  144



>gb|KCW62548.1| hypothetical protein EUGRSUZ_G00040, partial [Eucalyptus grandis]
Length=933

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = +1

Query  172  AIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSE  351
            AI+ L   W++ PP+W  G+DPCG+ W+G+GC  SR+ S+TLSSM LTG L GDI +LSE
Sbjct  22   AIEGLMSYWQHTPPNWV-GTDPCGNGWDGIGCTNSRITSITLSSMGLTGSLPGDIVQLSE  80

Query  352  LQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkF  531
            L+ILDLSYN+ LTGSLP +IGNL KL NLILVGCGF G IPDSIGSL  L +LSLN N+F
Sbjct  81   LRILDLSYNRGLTGSLPAQIGNLMKLTNLILVGCGFSGQIPDSIGSLQNLVFLSLNSNEF  140

Query  532  IGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             G IP ++G LS LYWLDLADNQLTGSIPV
Sbjct  141  SGLIPPTIGNLSRLYWLDLADNQLTGSIPV  170



>ref|XP_011464972.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
Length=962

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 128/181 (71%), Gaps = 2/181 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEG-SDPCGDHWEG  258
            M  R Q+ L+ +F  FL +    T   D + +  L+  W N PPSW    SDPC D W+G
Sbjct  1    MDHRTQVFLLLIFAPFLVLANHVTSPQDVMGLTFLKQLWNNTPPSWGTRLSDPCEDDWDG  60

Query  259  VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  438
            + C   RV+SL L SM+LTG LSGDI++ SELQILDLSYNK LTG LP EIG+LKKLYN+
Sbjct  61   IRCTNMRVISLILPSMNLTGTLSGDIDQFSELQILDLSYNKGLTGPLPTEIGSLKKLYNI  120

Query  439  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIP  618
            ILVGC F GLIP SIGSL +L +LSLN N+F G IP S+G LS+LYWLDLADN L G IP
Sbjct  121  ILVGCSFSGLIPASIGSLQELIFLSLNSNRFSGRIPSSIGNLSKLYWLDLADNNLEGPIP  180

Query  619  V  621
            V
Sbjct  181  V  181



>ref|XP_006836951.1| hypothetical protein AMTR_s00099p00159710 [Amborella trichopoda]
 gb|ERM99804.1| hypothetical protein AMTR_s00099p00159710 [Amborella trichopoda]
Length=951

 Score =   184 bits (468),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            T+  D   + +L++ W+NVPP+W +G DPC + W+G+ CNGSRV ++ LS+M L G L+G
Sbjct  26   TNPFDGAVLTSLQNVWQNVPPTW-KGGDPCLNQWDGISCNGSRVTAIKLSTMGLKGTLTG  84

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI  LSELQ LDLSYNKDLTGSLP+ IGNLKKL NLILVGC F G IP  IGSL +L +L
Sbjct  85   DIGSLSELQYLDLSYNKDLTGSLPQSIGNLKKLTNLILVGCSFSGTIPAQIGSLQELVFL  144

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            SLN N F G IP S+G LS+LYWLDLADNQLTGSIP+
Sbjct  145  SLNSNGFTGEIPPSIGSLSKLYWLDLADNQLTGSIPI  181


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 72/143 (50%), Gaps = 30/143 (21%)
 Frame = +1

Query  280  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNK--------------------------  381
            +V L+L+S   TGE+   I  LS+L  LDL+ N+                          
Sbjct  141  LVFLSLNSNGFTGEIPPSIGSLSKLYWLDLADNQLTGSIPISTPTSPGLDMLLGTRHFHF  200

Query  382  ---DLTGSLPREI-GNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPX  549
                L+GS+P ++  +   + +++  G  F G IP SIG ++ L+ L L+ NKF GP+P 
Sbjct  201  NRNKLSGSIPTQLFSSAMTVIHILFDGNNFSGKIPSSIGLVTSLEVLRLDRNKFEGPVPA  260

Query  550  SLGQLSELYWLDLADNQLTGSIP  618
            +L  L+++  L LA N LTG +P
Sbjct  261  NLNNLTKIQELSLAQNALTGPLP  283



>ref|XP_010682076.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=945

 Score =   184 bits (467),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = +1

Query  172  AIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSE  351
            A+ AL  GW+N+PP+W  G DPCG+ WEG+ CN SR+ ++TL++M LTG+L+GD+  LSE
Sbjct  24   ALVALTSGWRNLPPNWT-GRDPCGNRWEGITCNDSRITAITLANMGLTGQLTGDLASLSE  82

Query  352  LQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkF  531
            LQILDLSYN+ LTG LP+ IG L +L +LIL+GCGF G IPDSIGSL  +  LSLN N F
Sbjct  83   LQILDLSYNRGLTGPLPQSIGRLSRLTSLILIGCGFSGRIPDSIGSLELVDNLSLNENNF  142

Query  532  IGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             GP+P ++G +  LYWLDLADNQL+GSIPV
Sbjct  143  TGPVPATIGNMLNLYWLDLADNQLSGSIPV  172



>ref|XP_008366930.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Malus domestica]
Length=223

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = +1

Query  121  FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  300
            F +   I + TD +D  A+++L+  W NVPPSW + SDPCG  WEGV CN SRV +L LS
Sbjct  15   FSRLHVISSVTDPDDASALQSLKQTWSNVPPSWDKSSDPCGAQWEGVTCNDSRVTALGLS  74

Query  301  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  480
            ++++ G++ GDI  LSEL+ LDLS+NK LTGSL   +G+L KL  LIL GC F G IP  
Sbjct  75   AINVKGKIEGDIGGLSELRSLDLSFNKGLTGSLSPRLGDLSKLNILILAGCSFTGSIPSE  134

Query  481  IGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +G+L +L +L+LN N F G IP S G+LS LYWLDLADNQLTG IPV
Sbjct  135  LGNLKELTFLALNTNNFTGSIPASFGKLSNLYWLDLADNQLTGPIPV  181



>ref|XP_011088111.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Sesamum indicum]
Length=952

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 127/160 (79%), Gaps = 1/160 (1%)
 Frame = +1

Query  142  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE  321
             A+TD  D+ A+++L+D W NVPP+W+ G+DPCGD W G+ C  +RVVS+TL+S++L+G+
Sbjct  20   AAWTDPYDFAALRSLKDIWDNVPPNWS-GADPCGDGWSGISCINNRVVSITLASINLSGQ  78

Query  322  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  501
            LS DI +L+ELQ LDLSYN+ +TG LP  IGN  KL +LILVGCGF G IP SIGSL +L
Sbjct  79   LSSDIAKLAELQTLDLSYNEGMTGPLPSAIGNFPKLTSLILVGCGFSGQIPPSIGSLQQL  138

Query  502  kylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             YLSLN NKF+G IP ++G LS LYWLDLADN+L+G IPV
Sbjct  139  VYLSLNSNKFVGEIPPTIGNLSNLYWLDLADNKLSGKIPV  178



>gb|EPS73565.1| hypothetical protein M569_01189, partial [Genlisea aurea]
Length=957

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 127/178 (71%), Gaps = 1/178 (1%)
 Frame = +1

Query  88   IPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGC  267
            I RI  +L+ + IQ L + A+T+ ND  A+ AL++ W NVPPSW  G DPC   W+G+ C
Sbjct  7    ISRIDFILLAVLIQILVVGAWTNPNDRTALLALKEQWSNVPPSWV-GPDPCNSAWDGIRC  65

Query  268  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV  447
              S VVS+TL S  L G L  DI   SELQILDLSYN  LTG LP +IGNL KL NLILV
Sbjct  66   INSSVVSITLVSYSLKGYLPSDITLFSELQILDLSYNTRLTGPLPDKIGNLWKLRNLILV  125

Query  448  GCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            GCGF G IP SIGSL +L +LSLN N FIG IP S+G LS LYWLD+ADN+L+GSIPV
Sbjct  126  GCGFSGPIPSSIGSLQQLVFLSLNSNNFIGEIPNSIGLLSTLYWLDIADNKLSGSIPV  183



>gb|KJB29748.1| hypothetical protein B456_005G116800 [Gossypium raimondii]
Length=701

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 124/161 (77%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            + A TD +D  A+++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M L G
Sbjct  20   LSAVTDPHDAAALQSLKDSWQNTPPSWVKSDDPCGAPWEGVTCNSSRVTALGLSTMGLKG  79

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            +LSGDI  L+EL+ LDLS+N+DLTGSL   +G+L+KL  LIL GCGF G IP+ +G+L++
Sbjct  80   KLSGDIGGLTELRSLDLSFNRDLTGSLSPRLGDLEKLNILILAGCGFTGNIPEELGNLAE  139

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +L+LN N F G IP SLG+LS+LYWLDLADNQL G+IPV
Sbjct  140  LSFLALNSNNFTGKIPPSLGKLSKLYWLDLADNQLVGAIPV  180



>ref|XP_006481666.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Citrus sinensis]
Length=964

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 130/174 (75%), Gaps = 2/174 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVA-FTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR  279
            L+ + LF   + +++  TD+ D  A+++L+D W+N PP+W    DPCG  WEGV CN SR
Sbjct  7    LIFIALFSFHIQLISSATDSRDAAALQSLKDAWQNTPPTWKNSDDPCGS-WEGVTCNNSR  65

Query  280  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  459
            V +L LS+M LTG+LSGDI  L+EL+ LDLSYN  LTGSL   IG+L+KL  LIL GCGF
Sbjct  66   VTALGLSTMGLTGKLSGDIGGLTELRSLDLSYNGGLTGSLSPRIGDLQKLNILILAGCGF  125

Query  460  FGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             G IPD IG+L++L +L+LN N F G IP SLG+LS+LYWLDLADNQLTGSIPV
Sbjct  126  TGNIPDEIGNLAELSFLALNSNNFSGRIPPSLGKLSQLYWLDLADNQLTGSIPV  179



>emb|CDY68959.1| BnaCnng61190D, partial [Brassica napus]
Length=359

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 124/173 (72%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +LL+ L  QFL + A T+  D  A++AL+  W   P SW  G+DPCG +W G+ C   RV
Sbjct  25   MLLILLCFQFLSVSALTNGFDASALQALKADWTKYPESWV-GADPCGTNWVGITCTNDRV  83

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            VS++L ++D+ G+LS DI  L+ELQILDLSYN  LTG LP  IG LKKL NLILV C F 
Sbjct  84   VSISLGNLDVEGKLSSDIASLTELQILDLSYNTGLTGPLPSNIGQLKKLKNLILVACSFS  143

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP+SIG L +L YLSLNLN+F G IP S+G+LS LYW D+ADNQ+ G++PV
Sbjct  144  GQIPESIGDLEQLIYLSLNLNQFSGRIPASIGRLSNLYWFDIADNQIEGTLPV  196



>gb|KDO70764.1| hypothetical protein CISIN_1g002121mg [Citrus sinensis]
Length=964

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 130/174 (75%), Gaps = 2/174 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVA-FTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR  279
            L+ + LF   + +++  TD+ D  A+++L+D W+N PP+W    DPCG  WEGV CN SR
Sbjct  7    LIFIALFSFHIQLISSATDSRDAAALQSLKDAWQNTPPTWKNSDDPCGS-WEGVTCNNSR  65

Query  280  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  459
            V +L LS+M LTG+LSGDI  L+EL+ LDLSYN  LTGSL   IG+L+KL  LIL GCGF
Sbjct  66   VTALGLSTMGLTGKLSGDIGGLTELRSLDLSYNGGLTGSLSPRIGDLQKLNILILAGCGF  125

Query  460  FGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             G IPD IG+L++L +L+LN N F G IP SLG+LS+LYWLDLADNQLTGSIPV
Sbjct  126  TGNIPDEIGNLAELSFLALNSNNFSGRIPPSLGKLSQLYWLDLADNQLTGSIPV  179



>gb|KHN40734.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=969

 Score =   181 bits (460),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 121/161 (75%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            I +FTD  D VA+++L+D W++ PPSW +  DPCG  WEGV CN SRV SL LS+M L G
Sbjct  20   ISSFTDTRDVVALRSLKDAWQHTPPSWDKSDDPCGAPWEGVTCNKSRVTSLGLSTMGLKG  79

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            +L+GDI +L+EL+ LDLS+N+DLTG L  ++G+L  L  LIL GC F G IPD +G LS+
Sbjct  80   KLTGDIGQLTELRSLDLSFNRDLTGPLSPQLGDLSNLNILILAGCSFSGNIPDDLGKLSE  139

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +L+LN N F G IP SLG LS+LYWLDLADNQLTG IPV
Sbjct  140  LSFLALNSNNFTGKIPPSLGNLSKLYWLDLADNQLTGPIPV  180



>gb|KJB29747.1| hypothetical protein B456_005G116800 [Gossypium raimondii]
Length=965

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 124/161 (77%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            + A TD +D  A+++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M L G
Sbjct  20   LSAVTDPHDAAALQSLKDSWQNTPPSWVKSDDPCGAPWEGVTCNSSRVTALGLSTMGLKG  79

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            +LSGDI  L+EL+ LDLS+N+DLTGSL   +G+L+KL  LIL GCGF G IP+ +G+L++
Sbjct  80   KLSGDIGGLTELRSLDLSFNRDLTGSLSPRLGDLEKLNILILAGCGFTGNIPEELGNLAE  139

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +L+LN N F G IP SLG+LS+LYWLDLADNQL G+IPV
Sbjct  140  LSFLALNSNNFTGKIPPSLGKLSKLYWLDLADNQLVGAIPV  180



>ref|XP_003530535.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Glycine max]
Length=969

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 121/161 (75%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            I +FTD  D VA+++L+D W++ PPSW +  DPCG  WEGV CN SRV SL LS+M L G
Sbjct  20   ISSFTDTRDVVALRSLKDAWQHTPPSWDKSDDPCGAPWEGVTCNKSRVTSLGLSTMGLKG  79

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            +L+GDI +L+EL+ LDLS+N+DLTG L  ++G+L  L  LIL GC F G IPD +G LS+
Sbjct  80   KLTGDIGQLTELRSLDLSFNRDLTGPLSPQLGDLSNLNILILAGCSFSGNIPDDLGKLSE  139

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +L+LN N F G IP SLG LS+LYWLDLADNQLTG IPV
Sbjct  140  LSFLALNSNNFTGKIPPSLGNLSKLYWLDLADNQLTGPIPV  180



>ref|XP_011464973.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
 ref|XP_011464974.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
Length=955

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 129/180 (72%), Gaps = 2/180 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAF-TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  261
            M  R Q+ L+ ++   L +    T   D   +K+L   W N PPSW    DPC D W+G+
Sbjct  1    MDQRTQVFLLLIYAPVLVLSNHQTSIPDVTGLKSLMALWTNTPPSWG-ARDPCEDSWDGI  59

Query  262  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  441
            GC   RVVSLTLSSM+L+G LSGDI++LSELQILDLSYNK L+G LP +IG+L KL N+I
Sbjct  60   GCTNMRVVSLTLSSMNLSGSLSGDIQQLSELQILDLSYNKGLSGPLPTQIGSLTKLTNII  119

Query  442  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            LVGC F GLIP SIGSL +L++LSLN N+F G IP S+G LS+LYWLDLADN L G IPV
Sbjct  120  LVGCSFSGLIPASIGSLQELRFLSLNANRFSGKIPSSIGNLSKLYWLDLADNNLEGPIPV  179



>ref|XP_010252232.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Nelumbo nucifera]
Length=984

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = +1

Query  145  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  324
            A TD  D  A+++L   W+N+PPSW +  DPCG  WEGV C  SR+ +L+LS+M L G L
Sbjct  53   ASTDTEDVAALRSLMSHWQNIPPSWGKTDDPCGTPWEGVSCRNSRITALSLSTMGLKGTL  112

Query  325  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  504
            SGDI + +EL  LDLSYNK+LTG L   IG+L+KL  LIL GCGF G IP  IG+L+KL 
Sbjct  113  SGDIGQFTELTTLDLSYNKELTGPLSPRIGDLQKLNILILAGCGFTGTIPTEIGNLAKLT  172

Query  505  ylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +L+LN N FIG IP SLG LS+LYWLDLADNQLTGS+PV
Sbjct  173  FLALNSNNFIGGIPPSLGSLSQLYWLDLADNQLTGSLPV  211



>ref|XP_010252252.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nelumbo nucifera]
Length=953

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 127/180 (71%), Gaps = 2/180 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            M  RI+  L+ +  Q     A TD  D  A+ + +  WKN PP+W    DPC  +W G+ 
Sbjct  1    MDQRIKAFLLVVLFQVSSAAAQTDPQDAAALNSFKRLWKNTPPNW-NNPDPCNGNWVGIT  59

Query  265  CNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  441
            CN + RV+S+TLSSM L G+LSGDI  LSELQ LDLSYNK LTGSLP  IG+L KL NLI
Sbjct  60   CNSNFRVISITLSSMGLEGQLSGDIGSLSELQTLDLSYNKGLTGSLPEAIGSLMKLSNLI  119

Query  442  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L+GC F G IPD+IGSL +L +LSLN N F G IP S+G LS+LYWLDLADN+LTG+IPV
Sbjct  120  LLGCSFSGPIPDAIGSLKQLVFLSLNSNSFSGEIPPSIGNLSKLYWLDLADNKLTGTIPV  179



>emb|CDY21455.1| BnaC03g27420D [Brassica napus]
Length=953

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 129/173 (75%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +LL+ LF Q L + A T+  D  A++AL+  W   P SW EG+DPCG  W G+ C+ +RV
Sbjct  9    MLLIFLFFQILSVSALTNGFDGPALQALKAEWTKPPSSW-EGADPCGTSWVGITCSNNRV  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            VS++L ++++ G+LSGDI  LSELQILDLSYN  LTG LP  IG LKKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSGDIAALSELQILDLSYNTGLTGPLPPNIGELKKLKNLILVGCSFT  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP+SIG L +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++PV
Sbjct  128  GQIPESIGQLEQLIYLSLNLNQFSGTIPASIGRLSKLYWFDIADNQIEGTLPV  180



>ref|XP_003547844.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Glycine max]
 gb|KHN01903.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=967

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 122/161 (76%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            I +FTD  D VA+++L+D W+N PPSW +  DPCG  WEGV CN SRV SL LS+M L G
Sbjct  20   ISSFTDTQDVVALRSLKDVWQNTPPSWDKADDPCGAPWEGVTCNKSRVTSLGLSTMGLKG  79

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            +L+GDI +L+EL+ LDLS+N+ LTG L  ++G+L  L  LIL GC F G IPD +G+LS+
Sbjct  80   KLTGDIGQLTELRSLDLSFNRGLTGPLSPQLGDLSNLNILILAGCSFGGNIPDELGNLSE  139

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +L+LN N F G IP SLG+LS+LYWLDLADNQLTG IPV
Sbjct  140  LSFLALNSNNFTGKIPPSLGKLSKLYWLDLADNQLTGPIPV  180



>gb|KEH20269.1| LRR receptor-like kinase [Medicago truncatula]
Length=966

 Score =   179 bits (453),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 127/178 (71%), Gaps = 0/178 (0%)
 Frame = +1

Query  88   IPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGC  267
            I  + L L+ L+ Q   I + TD  D  A+++L+D W+N PPSW +  DPCG  WEGV C
Sbjct  3    IQSVFLFLLFLWAQIHLIFSITDPQDVAALRSLKDIWENTPPSWDKSDDPCGAPWEGVTC  62

Query  268  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV  447
            N SRV SL LS+M L G+LSGDI  L+EL+ LDLS+NKDL G +  E+G+L KL  LIL 
Sbjct  63   NKSRVTSLGLSTMGLKGKLSGDIGGLTELRSLDLSFNKDLMGPISPELGDLSKLNILILA  122

Query  448  GCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            GC F G IPD +G LS+L +L+LN N F G IP SLG+LS+LYWLDLADNQLTG +PV
Sbjct  123  GCSFSGNIPDKLGDLSELSFLALNSNNFTGKIPPSLGKLSKLYWLDLADNQLTGPLPV  180



>ref|XP_007023753.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY26375.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
Length=956

 Score =   179 bits (453),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 123/176 (70%), Gaps = 5/176 (3%)
 Frame = +1

Query  106  LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVV  285
            LL+ +FIQ   +   TD  D  A+K+L   W+NVPPSW  G DPCGD W G+ C  SRV 
Sbjct  8    LLLVVFIQIYIVAPTTDFGDSTALKSLVAEWENVPPSWV-GGDPCGDGWVGISCTDSRVT  66

Query  286  SLTLSSMDLTGELSGDIEELSELQ----ILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  453
            S+ L SM+L G LSGDI  LSELQ      DLSYN+ LTGSLP  IGNLK L NLILVGC
Sbjct  67   SIILPSMNLVGRLSGDISTLSELQQTSMFRDLSYNQGLTGSLPASIGNLKNLTNLILVGC  126

Query  454  GFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            GF G IPDSIGSLS+L++LSLN N F G IP S+G LS L WLDLADN L G IPV
Sbjct  127  GFNGPIPDSIGSLSQLRFLSLNSNGFTGRIPPSIGNLSNLVWLDLADNHLEGPIPV  182



>gb|KFK27543.1| hypothetical protein AALP_AA8G397000 [Arabis alpina]
Length=401

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 123/176 (70%), Gaps = 1/176 (1%)
 Frame = +1

Query  94   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  273
            R  + ++  F Q   + A T+  D  A+KAL+ GW   P SW EGSDPCG +W G+ CN 
Sbjct  6    RAFMFMILFFFQISYVSAVTNGLDVYALKALKSGWSKFPESW-EGSDPCGTNWIGITCNN  64

Query  274  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  453
             RVVS++L + +L G+LS  I  LSEL ILDLSYN  L+G LP  IG+LKKL NL+LVGC
Sbjct  65   DRVVSISLVNFNLEGKLSSYISFLSELHILDLSYNTGLSGPLPPNIGDLKKLTNLVLVGC  124

Query  454  GFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             F G IP+SIGSL +L YLSLN N+F G IP S+GQLS+LYW D+ DNQ+ G +P+
Sbjct  125  TFSGQIPESIGSLEQLMYLSLNSNQFSGTIPASIGQLSKLYWFDITDNQIEGKLPI  180



>ref|XP_009593371.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana tomentosiformis]
Length=951

 Score =   179 bits (453),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 124/179 (69%), Gaps = 1/179 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            M  R Q+ L+    Q L I+  T++ND  A+ A++  W N+PP+W EGSDPCG  WEG+ 
Sbjct  4    MGSRSQVFLLIFASQILAILGQTNSNDVTALFAIKSSWNNLPPNW-EGSDPCGSSWEGIV  62

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            C  SR+ S+ LS M L G   GD+  L+ LQILDLS N  L G+LP  IGNLK L  LIL
Sbjct  63   CKDSRITSIKLSGMGLEGNQFGDLSSLTALQILDLSNNVGLKGTLPSSIGNLKNLTTLIL  122

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            VGC FFG IP+SIGSL +L ++SL  N F GPIP S+G LS+L WLDL+DN+L+G+IPV
Sbjct  123  VGCSFFGPIPESIGSLQQLVFISLTSNSFTGPIPPSIGNLSKLSWLDLSDNKLSGTIPV  181



>ref|XP_008782739.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
Length=960

 Score =   178 bits (452),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 114/157 (73%), Gaps = 0/157 (0%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            TD  D  A+++L DGW+N PPSW +  DPCG  WEGV C  SRV  L LS+M L G LSG
Sbjct  23   TDPTDAAALRSLMDGWQNTPPSWGQSDDPCGTPWEGVNCINSRVTVLKLSTMGLKGTLSG  82

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI +LSELQ LDLSYN +L G L   IGNLKK+  LILVGC F G IP+ +G+L KL YL
Sbjct  83   DIGQLSELQTLDLSYNNELGGPLASNIGNLKKITTLILVGCSFSGQIPEELGNLEKLSYL  142

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            ++N NKF G IP SLG LS LYWLD+ADNQL+G IPV
Sbjct  143  AINSNKFTGRIPASLGTLSNLYWLDVADNQLSGPIPV  179



>ref|XP_010065202.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=975

 Score =   179 bits (453),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = +1

Query  145  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  324
            A T+  D+ AI  L   W+  PP+W  G+DPCG++W G+ CN SRV S+ LSS  LTG L
Sbjct  41   AATNPYDFSAIMGLMTDWQIAPPNWV-GNDPCGNNWVGIVCNNSRVTSIILSSAGLTGPL  99

Query  325  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  504
            SGDI +LSELQ LDLS NK LTGSLP +IGNL KL +LILVGCGF G IPDS+GSL  L 
Sbjct  100  SGDIGQLSELQFLDLSNNKGLTGSLPEQIGNLMKLTHLILVGCGFSGQIPDSVGSLQNLV  159

Query  505  ylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LSLN N+F G IP  +G LS LYWLDLADNQLTGSIPV
Sbjct  160  HLSLNSNRFTGLIPAIIGNLSRLYWLDLADNQLTGSIPV  198



>ref|XP_011092240.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Sesamum indicum]
Length=934

 Score =   178 bits (451),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 125/151 (83%), Gaps = 1/151 (1%)
 Frame = +1

Query  169  VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELS  348
            VA+K+L+D W+NVPP+W +G DPCG +W+G+ C+ +RV+S+TL+S++L+G LS DI+ LS
Sbjct  11   VALKSLKDEWENVPPNW-DGDDPCGHNWDGISCSDTRVISITLASINLSGHLSSDIKGLS  69

Query  349  ELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnk  528
             L+ LDLSYNK +TG LP  IGNL++L +LILVGCGF G IP SIGSL +L YLSLN NK
Sbjct  70   ALETLDLSYNKGMTGPLPSSIGNLQELSSLILVGCGFSGPIPSSIGSLQQLVYLSLNSNK  129

Query  529  FIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            F+G IP S+G LS LYWLDLADN+L+G+IPV
Sbjct  130  FVGEIPPSIGNLSNLYWLDLADNKLSGTIPV  160



>emb|CDX83184.1| BnaA03g23220D [Brassica napus]
Length=953

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 128/173 (74%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +LL+ LF Q L + A T+  D  A++AL+  W   P +W EG+DPCG  W G+ C+ +RV
Sbjct  9    MLLIFLFFQILSVSALTNGFDGSALQALKAEWTKPPSNW-EGADPCGTSWVGITCSNNRV  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            VS++L ++++ G+LSGDI  LSELQILDLSYN  LTG LP  IG LKKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSGDIAALSELQILDLSYNTGLTGPLPPNIGELKKLKNLILVGCSFT  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP SIG L +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++PV
Sbjct  128  GQIPQSIGQLEQLIYLSLNLNQFSGTIPASIGRLSKLYWFDIADNQIEGTLPV  180



>gb|AAF68126.1|AC010793_21 F20B17.5 [Arabidopsis thaliana]
Length=980

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 124/183 (68%), Gaps = 3/183 (2%)
 Frame = +1

Query  82   TMIPRIQLLLVPL---FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHW  252
            T+    +LLL+     F  F  I + TD  D  A+++L D W N PPSW    DPCG  W
Sbjct  6    TVTATSRLLLICFAYSFTVFSMISSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPW  65

Query  253  EGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY  432
            EGV CN SR+ +L LS+M L G LSGDI EL+EL+ LDLS+N+ LTGSL   +G+L+KL 
Sbjct  66   EGVSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNRGLTGSLTSRLGDLQKLN  125

Query  433  NLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGS  612
             LIL GCGF G IP+ +G L  L +L+LN N F G IP SLG L+++YWLDLADNQLTG 
Sbjct  126  ILILAGCGFTGTIPNELGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGP  185

Query  613  IPV  621
            IP+
Sbjct  186  IPI  188



>ref|XP_011092238.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Sesamum indicum]
Length=964

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 125/151 (83%), Gaps = 1/151 (1%)
 Frame = +1

Query  169  VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELS  348
            VA+K+L+D W+NVPP+W +G DPCG +W+G+ C+ +RV+S+TL+S++L+G LS DI+ LS
Sbjct  41   VALKSLKDEWENVPPNW-DGDDPCGHNWDGISCSDTRVISITLASINLSGHLSSDIKGLS  99

Query  349  ELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnk  528
             L+ LDLSYNK +TG LP  IGNL++L +LILVGCGF G IP SIGSL +L YLSLN NK
Sbjct  100  ALETLDLSYNKGMTGPLPSSIGNLQELSSLILVGCGFSGPIPSSIGSLQQLVYLSLNSNK  159

Query  529  FIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            F+G IP S+G LS LYWLDLADN+L+G+IPV
Sbjct  160  FVGEIPPSIGNLSNLYWLDLADNKLSGTIPV  190



>ref|NP_178080.2| putative serine/threonine kinase [Arabidopsis thaliana]
 dbj|BAC42504.1| unknown protein [Arabidopsis thaliana]
 gb|ACN59279.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE36273.1| putative serine/threonine kinase [Arabidopsis thaliana]
Length=971

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 124/183 (68%), Gaps = 3/183 (2%)
 Frame = +1

Query  82   TMIPRIQLLLVPL---FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHW  252
            T+    +LLL+     F  F  I + TD  D  A+++L D W N PPSW    DPCG  W
Sbjct  6    TVTATSRLLLICFAYSFTVFSMISSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPW  65

Query  253  EGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY  432
            EGV CN SR+ +L LS+M L G LSGDI EL+EL+ LDLS+N+ LTGSL   +G+L+KL 
Sbjct  66   EGVSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNRGLTGSLTSRLGDLQKLN  125

Query  433  NLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGS  612
             LIL GCGF G IP+ +G L  L +L+LN N F G IP SLG L+++YWLDLADNQLTG 
Sbjct  126  ILILAGCGFTGTIPNELGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGP  185

Query  613  IPV  621
            IP+
Sbjct  186  IPI  188



>gb|KHN40742.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=954

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 128/176 (73%), Gaps = 1/176 (1%)
 Frame = +1

Query  94   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  273
            R+ +L++  F   L +   T   D  A+ AL + W+N PP+W +G+DPCG  W+G+ C  
Sbjct  4    RVIVLILLFFTHLLIVFTKTSPQDSAALLALVNEWQNTPPNW-DGTDPCGAGWDGIECTN  62

Query  274  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  453
            SR+ S++L+SMDL+G+L+ DI  LSEL ILDLSYNK LTG LP +IGNL+KL NL+++ C
Sbjct  63   SRITSISLASMDLSGQLTSDIGSLSELLILDLSYNKKLTGPLPNDIGNLRKLRNLLVINC  122

Query  454  GFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            GF G IP +IG+L +L +LSLN N F GPIP ++G LS +YWLDLA+NQL G IP+
Sbjct  123  GFTGPIPVTIGNLERLVFLSLNSNGFTGPIPAAIGNLSNVYWLDLAENQLEGPIPI  178



>ref|XP_002889259.1| hypothetical protein ARALYDRAFT_477135 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65518.1| hypothetical protein ARALYDRAFT_477135 [Arabidopsis lyrata subsp. 
lyrata]
Length=971

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 123/181 (68%), Gaps = 1/181 (1%)
 Frame = +1

Query  82   TMIPRIQLL-LVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  258
            T I R+ L+     F  F  I + TD  D  A+++L D W N PPSW    DPCG  WEG
Sbjct  8    TAISRLLLIGFAYSFTVFSIISSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPWEG  67

Query  259  VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  438
            V CN SR+ +L LS+M L G LSGDI EL+EL+ LDLS+N+ LTGSL   +G+L+KL  L
Sbjct  68   VSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNRGLTGSLTSRLGDLQKLNIL  127

Query  439  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIP  618
            IL GCGF G IP+ +G L  L +L+LN N F G IP SLG L+++YWLDLADNQLTG IP
Sbjct  128  ILAGCGFTGSIPNELGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGPIP  187

Query  619  V  621
            +
Sbjct  188  I  188



>ref|XP_009377697.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=385

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            I + T  +D  A+++LR  W NVPPSW + +DPCG+ WEG+ CNGSRV +L LS M++ G
Sbjct  18   ISSSTHLDDANALQSLRQTWINVPPSWDKSNDPCGESWEGITCNGSRVTALGLSGMNVEG  77

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            ++ GDI  LSEL+ LDLS+NK LTGSL   +G+L  L  LIL GC F G+IP  +G L +
Sbjct  78   KIEGDIAGLSELRFLDLSFNKGLTGSLSPRLGDLSNLNILILAGCSFSGIIPSELGKLGE  137

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +L+LN N F G IP SLG LS LYWLDLADNQLTG +PV
Sbjct  138  LTFLALNTNNFTGSIPASLGNLSNLYWLDLADNQLTGPLPV  178



>ref|XP_004137665.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Cucumis sativus]
 ref|XP_004160329.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Cucumis sativus]
 gb|KGN58673.1| hypothetical protein Csa_3G727910 [Cucumis sativus]
Length=966

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 125/180 (69%), Gaps = 1/180 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  261
            M P   LLL   F   +    +FTD  D  A+++LR+ W+N PPSW    DPCG  WEGV
Sbjct  1    MSPVETLLLFAFFYAGIDTAGSFTDPRDSAALESLRNEWQNTPPSWGASIDPCGTPWEGV  60

Query  262  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  441
             C  SRV +L LS+M L G+L GDI  L+EL+ LDLS+NKDLTGS+   +G+L+ L  LI
Sbjct  61   ACINSRVTALRLSTMGLKGKLGGDIGGLTELKSLDLSFNKDLTGSISPALGDLQNLSILI  120

Query  442  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L GCGF G IP+ +G+LS L +L+LN N F G IP SLG+LS LYWLDLADNQLTGS+PV
Sbjct  121  LAGCGFSGSIPEQLGNLSNLSFLALNSNNFTGTIPPSLGKLSNLYWLDLADNQLTGSLPV  180



>ref|XP_006389866.1| hypothetical protein EUTSA_v10018176mg [Eutrema salsugineum]
 gb|ESQ27152.1| hypothetical protein EUTSA_v10018176mg [Eutrema salsugineum]
Length=756

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 116/167 (69%), Gaps = 0/167 (0%)
 Frame = +1

Query  121  FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  300
            F  F  + + TD  D  AI++L D W N PPSW    DPCG  WEGV CN SR+ +L LS
Sbjct  23   FTVFSMVSSVTDPRDAAAIRSLMDQWDNTPPSWGGSDDPCGTPWEGVSCNDSRITALGLS  82

Query  301  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  480
            +M L G LSGDI EL+EL+ LDLS+N  LTGSL   +G+L+KL  LIL GCGF G IP+ 
Sbjct  83   TMGLKGRLSGDIGELAELRSLDLSFNPGLTGSLTSRLGDLQKLNILILAGCGFTGSIPNE  142

Query  481  IGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +G L  L +L+LN N F G IP SLG L+++YWLDLADNQLTG IP+
Sbjct  143  LGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGPIPI  189



>ref|XP_010441081.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=952

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 127/182 (70%), Gaps = 4/182 (2%)
 Frame = +1

Query  85   MIPRIQL--LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  258
            M  RI L  LL+ L +Q   +   TD  D  A++ L+  W  +  SW +GSDPCG+HW G
Sbjct  1    MSSRIGLFKLLILLVVQVCSVSTTTDGADSSALQVLKSEWTALSKSW-KGSDPCGNHWVG  59

Query  259  VGCNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN  435
            + CN + RVVS+ LS+++L G L  DI  LSEL+ILDLSYN  L+G+LP  IGNLK L N
Sbjct  60   ITCNNNNRVVSIMLSNLNLKGNLPADISTLSELEILDLSYNTGLSGALPSSIGNLKNLRN  119

Query  436  LILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSI  615
            LIL+GCGF G IP+SIGSL KL  LSLN N F G IP S+G+LSELYW D+ DNQ+ GSI
Sbjct  120  LILMGCGFSGQIPESIGSLEKLTTLSLNSNHFSGTIPASIGRLSELYWFDITDNQIEGSI  179

Query  616  PV  621
            PV
Sbjct  180  PV  181



>ref|XP_009134023.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=953

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 127/173 (73%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +LL+ LF Q L + A T+  D  A++AL+  W   P +W EG+DPCG  W G+ C+ +RV
Sbjct  9    MLLIFLFFQILSVSALTNGFDGSALQALKAEWTKPPSNW-EGADPCGTSWVGITCSNNRV  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            VS++L ++++ G+LSGDI  LSELQILDLSYN  LTG LP  IG LKKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSGDIAALSELQILDLSYNTGLTGPLPPNIGELKKLKNLILVGCSFT  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP SIG L +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++P 
Sbjct  128  GQIPQSIGQLEQLIYLSLNLNQFSGTIPASIGRLSKLYWFDIADNQIEGTLPA  180



>gb|KFK42372.1| hypothetical protein AALP_AA2G247300 [Arabis alpina]
Length=970

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 121/181 (67%), Gaps = 1/181 (1%)
 Frame = +1

Query  82   TMIPRIQLL-LVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  258
            T IPR  L+     F  F    + TD  D  A+++L D W N PPSW    DPCG  WEG
Sbjct  6    TAIPRFLLICFAYCFTVFSMTSSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPWEG  65

Query  259  VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  438
            V CN SR+ +L LS+M L G LSGDI EL+EL+ LDLS+N  LTGSL   +G+L+KL  L
Sbjct  66   VSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNPGLTGSLTSRLGDLQKLNIL  125

Query  439  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIP  618
            IL GCGF G IP+ +G L  L +L+LN N F G IP +LG L+++YWLDLADNQLTG IP
Sbjct  126  ILAGCGFTGSIPNELGYLKDLSFLALNSNNFTGKIPSALGNLTKVYWLDLADNQLTGPIP  185

Query  619  V  621
            +
Sbjct  186  I  186



>ref|XP_006402242.1| hypothetical protein EUTSA_v10012589mg [Eutrema salsugineum]
 gb|ESQ43695.1| hypothetical protein EUTSA_v10012589mg [Eutrema salsugineum]
Length=953

 Score =   176 bits (447),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 127/173 (73%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +LL+ LF Q   + A T+  D  A++AL+  W   P SW EG+DPCG +W G+ C+  RV
Sbjct  9    MLLILLFFQTCSVSALTNGLDASALQALKAEWTTSPDSW-EGADPCGTNWVGITCSNDRV  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            VS++L ++++ G+LS DI  L ELQILDLSYN  LTG LP  IG LKKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSADIAALPELQILDLSYNTGLTGPLPPNIGQLKKLRNLILVGCSFT  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP+SIG+L +L YLSLNLNKF G IP S+G+LS+LYW D+ADNQ+ GSIPV
Sbjct  128  GQIPESIGNLEQLIYLSLNLNKFSGTIPASIGRLSKLYWFDIADNQIEGSIPV  180



>emb|CDY61244.1| BnaCnng37500D [Brassica napus]
Length=953

 Score =   176 bits (447),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 125/173 (72%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +LL+ L  QFL + A T+  D  A++AL+  W   P +W  G+DPCG +W G+ C   RV
Sbjct  9    MLLILLCFQFLSVSALTNGFDASALQALKADWTKYPENWV-GADPCGTNWVGITCTNDRV  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            VS++L ++D+ G+LS DI  L+ELQILDLSYN +LTG LP  IG LKKL NLILV C F 
Sbjct  68   VSISLGNLDVEGKLSSDIASLTELQILDLSYNTELTGPLPSNIGQLKKLKNLILVACSFS  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP+SIG L +L YLSLNLN+F G IP S+G+LS LYW D+ADNQ+ G+IPV
Sbjct  128  GQIPESIGDLEQLIYLSLNLNQFSGRIPASIGRLSNLYWFDIADNQIEGTIPV  180



>gb|KGN59773.1| hypothetical protein Csa_3G844910 [Cucumis sativus]
Length=771

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 127/174 (73%), Gaps = 1/174 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAF-TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR  279
            L++  LF+ F  + A  TD+ D   +++L+DGW+N PPSW   +DPCG  W+GV C  SR
Sbjct  41   LVVSLLFLDFFYLAASSTDSRDSSVLQSLKDGWQNTPPSWGTSNDPCGTPWDGVICKNSR  100

Query  280  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  459
            VV+L LSSM L G+L GDI  L+EL+ LDL+ N+DL GS+ R +GNL KL  LIL  CGF
Sbjct  101  VVALKLSSMGLKGKLGGDIGGLTELRSLDLAANRDLVGSISRALGNLLKLDTLILSTCGF  160

Query  460  FGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             G IP+ +G+LS+L +LSL  N F G IP +LG+LS+LYWLDLADNQLTG++PV
Sbjct  161  SGKIPEELGNLSELTFLSLYSNSFTGTIPATLGKLSKLYWLDLADNQLTGALPV  214



>ref|XP_006852584.1| hypothetical protein AMTR_s00021p00213800 [Amborella trichopoda]
 gb|ERN14051.1| hypothetical protein AMTR_s00021p00213800 [Amborella trichopoda]
Length=962

 Score =   176 bits (445),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 126/175 (72%), Gaps = 1/175 (1%)
 Frame = +1

Query  97   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  276
            + L L+    QF  I+  TD  D  A+ AL+   +N PP+W+ G+DPCG +W+GV C+ S
Sbjct  6    VLLFLLSTGFQFHLILGITDPGDGAAMIALKSYMQNTPPNWS-GADPCGSNWDGVSCSNS  64

Query  277  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  456
            RV++L LS+M L G L GDI  L+ELQ LDLS+N+DL GS+P+ I NLKKL  LIL GC 
Sbjct  65   RVIALKLSTMGLRGFLPGDIGSLTELQFLDLSFNQDLGGSIPKSIENLKKLTTLILAGCS  124

Query  457  FFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            F G IPD +GSL +L +L+LN NKF G IP SLG+LS+LYW DLADNQLTG +PV
Sbjct  125  FSGTIPDELGSLQELAFLALNTNKFTGRIPASLGKLSKLYWFDLADNQLTGGLPV  179



>ref|XP_010442445.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Camelina sativa]
 ref|XP_010442446.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Camelina sativa]
Length=950

 Score =   176 bits (445),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 127/182 (70%), Gaps = 4/182 (2%)
 Frame = +1

Query  85   MIPRIQL--LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  258
            M  RI L  LL+ L +Q   + A TD +D  A++ L+  W  +  SW +GSDPCG+HW G
Sbjct  1    MSSRIGLFKLLILLVVQVCSVSAITDGSDSSALQVLKSEWTALSKSW-KGSDPCGNHWVG  59

Query  259  VGCNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN  435
            + CN + RVVS+ LS+++L G L  DI  LSEL+ILDLSYN  L+G+LP  IGNLK L  
Sbjct  60   ITCNNNNRVVSIMLSNLNLKGNLPADISTLSELEILDLSYNTGLSGALPSSIGNLKHLKR  119

Query  436  LILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSI  615
            LIL+GCGF G IP+SIGS+ KL  LSLN N F G IP S+G+LSELYW D+ DNQ+ G I
Sbjct  120  LILMGCGFSGQIPESIGSVEKLTTLSLNSNHFSGTIPASIGRLSELYWFDITDNQIEGKI  179

Query  616  PV  621
            PV
Sbjct  180  PV  181



>emb|CDP08081.1| unnamed protein product [Coffea canephora]
Length=962

 Score =   176 bits (445),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 124/173 (72%), Gaps = 0/173 (0%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            L  + +  +F GI ++TD  D   +++L+D W+N PP+W +  DPCG  WEGV CN SRV
Sbjct  8    LFYLVMSARFRGIFSYTDPRDVAVLRSLKDQWQNTPPNWGKSDDPCGAPWEGVSCNNSRV  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
             +L LSSM L+G+L+GDI  L+EL  LDLS+N+ LTGSL   IG+L+ L  LIL GC F 
Sbjct  68   TALGLSSMGLSGKLNGDIGGLTELISLDLSFNRGLTGSLSPRIGDLQNLSILILAGCSFN  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G +P  +G+L++L +L+LN N F G IP SLG+LS LYWLDLADNQLTG IPV
Sbjct  128  GNVPSELGNLAQLSFLALNSNNFTGGIPPSLGKLSHLYWLDLADNQLTGPIPV  180



>ref|XP_009128375.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=976

 Score =   176 bits (445),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = +1

Query  121  FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  300
            F  F  + + TD  D  A+++L D W N PPSW    DPCG  WEGV CN SR+ +L LS
Sbjct  23   FTVFSMVSSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPWEGVSCNNSRITALGLS  82

Query  301  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  480
            +M L G LSGDI ELSEL+ LDLS+N  LTGSL   + +L+KL  LIL GCGF G IP+ 
Sbjct  83   TMGLKGRLSGDIGELSELRSLDLSFNPGLTGSLTSRLRDLQKLNILILAGCGFTGSIPNE  142

Query  481  IGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            IG L  L +L+LN N F G IP SLG LS++YWLDLADNQLTG IP+
Sbjct  143  IGYLKDLSFLALNSNNFTGKIPASLGNLSKVYWLDLADNQLTGPIPI  189



>ref|XP_008442305.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Cucumis melo]
Length=965

 Score =   175 bits (444),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 124/180 (69%), Gaps = 1/180 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGV  261
            M P   LLL   F        +FTD  D  A+++LR+ W+N PPSW    DPCG  WEGV
Sbjct  1    MSPVETLLLFAFFYAGQDTAGSFTDPRDSAALESLRNEWQNTPPSWGASIDPCGTPWEGV  60

Query  262  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI  441
             C  SRV +L LS+M L G+L GDI  L+EL+ LDLS+NKDLTGS+   +G+L+ L  LI
Sbjct  61   ACINSRVTALRLSTMGLKGKLGGDIGGLTELKSLDLSFNKDLTGSISPALGDLQNLSILI  120

Query  442  LVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L GCGF G IP+ +G+LS L +L+LN N F G IP SLG+LS LYWLDLADNQLTGS+PV
Sbjct  121  LAGCGFSGSIPEQLGNLSNLSFLALNSNNFTGTIPPSLGKLSNLYWLDLADNQLTGSLPV  180



>ref|XP_009118911.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=940

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 124/173 (72%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +LL+ L  QFL + A T+  D  A++AL+  W   P SW  G+DPCG +W G+ C   RV
Sbjct  9    MLLILLCFQFLSVSALTNGFDASALQALKADWTKYPESWV-GADPCGTNWVGITCTNDRV  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            VS++L ++D+ G+LS DI  L+ELQILDLSYN  LTG LP  IG LKKL NLILV C F 
Sbjct  68   VSISLGNLDVEGKLSSDIASLTELQILDLSYNTGLTGPLPSNIGQLKKLKNLILVACSFS  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP+SIG L +L YLSLNLN+F G IP S+G+LS LYW D+ADNQ+ G++PV
Sbjct  128  GQIPESIGDLEQLIYLSLNLNQFSGRIPASIGRLSNLYWFDIADNQIEGTLPV  180



>ref|XP_010275979.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nelumbo nucifera]
Length=964

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 118/157 (75%), Gaps = 0/157 (0%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            TD  D VA+++L++ W+N PPSW + +DPCG  WEGV C  SRV +L LS+M+L G LSG
Sbjct  25   TDTQDAVALQSLKEQWQNTPPSWGKSNDPCGAPWEGVTCTNSRVTALRLSTMNLKGTLSG  84

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI + +EL+ LDLS+N+ LTGSL   IG+L+KL  LIL GC F G IP  +G+L++L +L
Sbjct  85   DIGQFTELRSLDLSFNRGLTGSLSPRIGDLQKLNILILAGCSFTGSIPKELGNLAQLSFL  144

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LN N F G IP SLG LS+LYWLDLADNQLTG IPV
Sbjct  145  ALNSNNFTGGIPPSLGTLSKLYWLDLADNQLTGVIPV  181



>ref|XP_010671953.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like protein kinase At5g49770 [Beta vulgaris subsp. 
vulgaris]
Length=945

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 131/176 (74%), Gaps = 5/176 (3%)
 Frame = +1

Query  103  LLLVPLFIQFLG-IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGC--NG  273
            LL+V  F  ++G I A T++ D+ A+ AL   W+N+PPSW  G + C   WEG+ C  NG
Sbjct  6    LLVVGFFCIYVGNIAAQTNSRDHAALVALTTDWENLPPSWT-GQNSCTS-WEGITCDANG  63

Query  274  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  453
            +R++++TL+SM L+G+L+GD+  LSELQILDLSYN+ LTGSLP +IG L +L NLIL+GC
Sbjct  64   TRIIAITLASMQLSGQLTGDLVFLSELQILDLSYNRGLTGSLPGDIGQLSRLTNLILLGC  123

Query  454  GFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
               G IPDSIG L +L  LSLN N+F GP+P S+G L+ L+WLDL DN+LTGSIPV
Sbjct  124  SLSGRIPDSIGLLQQLVSLSLNSNRFSGPVPASIGNLTNLFWLDLTDNRLTGSIPV  179



>emb|CDX83183.1| BnaA03g23230D [Brassica napus]
Length=812

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 124/173 (72%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +LL+ LF Q   + A T+  D  A++AL+  W   P SW +G DPCG  W G+ C   RV
Sbjct  9    MLLIFLFFQIFSVSALTNGFDGAALQALKAEWTKPPSSW-DGDDPCGTSWVGITCISDRV  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            VS++L ++++ G+LSGDI  LSELQILDLSYN  LTG LP  IG  KKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSGDIAALSELQILDLSYNTGLTGPLPPNIGETKKLKNLILVGCSFT  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP+SIG L +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++PV
Sbjct  128  GQIPESIGKLEQLIYLSLNLNQFSGTIPASIGRLSKLYWFDIADNQIEGTLPV  180



>ref|XP_010417632.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=973

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 120/181 (66%), Gaps = 1/181 (1%)
 Frame = +1

Query  82   TMIPRIQLLLVPLFIQFLGIVA-FTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  258
            T   R+ L+       F  + +  TD  D  ++++L D W N PPSW    DPCG  WEG
Sbjct  8    TATSRLLLICFAYSFTFFSMTSSVTDPRDAASLRSLMDQWDNTPPSWGGSEDPCGTPWEG  67

Query  259  VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  438
            V CN SR+ +L LS+M L G LSGDI EL+EL+ LDLS+N  LTGSL   +G+L+KL  L
Sbjct  68   VSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNPGLTGSLTSRLGDLQKLNIL  127

Query  439  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIP  618
            IL GCGF G IP+ IG L  L +L+LN N F G IP SLG L+++YWLDLADNQLTG IP
Sbjct  128  ILAGCGFTGSIPNEIGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGPIP  187

Query  619  V  621
            +
Sbjct  188  I  188



>emb|CDY49740.1| BnaA02g19320D [Brassica napus]
Length=1396

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = +1

Query  121  FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  300
            F  F  + + TD  D  A+++L D W N PPSW    DPCG  WEGV CN SR+ +L LS
Sbjct  472  FTVFSMVSSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPWEGVSCNNSRITALGLS  531

Query  301  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  480
            +M L G LSGDI ELSEL+ LDLS+N  LTGSL   + +L+KL  LIL GCGF G IP+ 
Sbjct  532  TMGLKGRLSGDIGELSELRSLDLSFNPGLTGSLTSRLRDLQKLNILILAGCGFTGSIPNE  591

Query  481  IGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            IG L  L +L+LN N F G IP SLG LS++YWLDLADNQLTG IP+
Sbjct  592  IGYLKDLSFLALNSNNFTGKIPASLGNLSKVYWLDLADNQLTGPIPI  638



>ref|XP_007154094.1| hypothetical protein PHAVU_003G0900000g, partial [Phaseolus vulgaris]
 gb|ESW26088.1| hypothetical protein PHAVU_003G0900000g, partial [Phaseolus vulgaris]
Length=797

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            T + D+  + +L   WKN  P W  GSDPC D WEG+ C  +RV S+TLSS    G LSG
Sbjct  23   TADEDFTTLMSLMSTWKNTSPDWV-GSDPCED-WEGIKCKNTRVTSITLSSTGFGGPLSG  80

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI  LSEL+ILDLSYNKD TG LP  IG L+KL  LILVGC F G IPDSIG+L +L +L
Sbjct  81   DIGSLSELEILDLSYNKDFTGPLPESIGELRKLSTLILVGCNFNGPIPDSIGNLQELLFL  140

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            SLN N+F GPIP S+G LS+LYWLDLADNQL GSIPV
Sbjct  141  SLNSNRFSGPIPPSIGSLSKLYWLDLADNQLEGSIPV  177



>ref|XP_010930348.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=952

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = +1

Query  145  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  324
            A TD  D   + +L   W N P +W  GSDPCGD W G+ C  SRV+S+TLSS+ LTG L
Sbjct  21   ADTDPQDAAVLNSLASSWDNTPSNWI-GSDPCGDKWVGISCTNSRVISITLSSLGLTGTL  79

Query  325  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  504
            SGDI+ L+ELQ LDLSYNK LTG +P  IG+L KL NLILVGC F G IP  IG+L +L 
Sbjct  80   SGDIQSLNELQALDLSYNKGLTGGIPASIGSLSKLVNLILVGCSFSGEIPPEIGNLPRLV  139

Query  505  ylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LSLN N F G IP +LG LS+LYW DLADN+LTG+IPV
Sbjct  140  FLSLNSNSFTGSIPKTLGNLSKLYWFDLADNKLTGTIPV  178



>emb|CDY22287.1| BnaC02g25910D [Brassica napus]
Length=1719

 Score =   176 bits (445),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = +1

Query  121  FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  300
            F  F  + + TD  D  A+++L D W N PPSW    DPCG  WEGV CN SR+ +L LS
Sbjct  381  FTVFSMVSSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPWEGVSCNSSRITALGLS  440

Query  301  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  480
            +M L G LSGDI ELSEL+ LDLS+N  LTGSL   + +L+KL  LIL GCGF G IP+ 
Sbjct  441  TMGLKGRLSGDIGELSELRSLDLSFNPGLTGSLTSRLRDLQKLNILILAGCGFTGSIPNE  500

Query  481  IGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            IG L  L +L+LN N F G IP SLG LS++YWLDLADNQLTG IP+
Sbjct  501  IGYLKDLSFLALNSNNFTGKIPASLGNLSKVYWLDLADNQLTGPIPI  547


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  529  FIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            F G IP SLG LS++YWLDLADNQLTG IP+
Sbjct  916  FTGKIPASLGNLSKVYWLDLADNQLTGPIPI  946



>ref|XP_009134024.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=899

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 124/173 (72%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +LL+ LF Q   + A T+  D  A++AL+  W   P SW +G DPCG  W G+ C   RV
Sbjct  9    MLLIFLFFQIFSVSALTNGFDGAALQALKAEWTKPPSSW-DGDDPCGTSWVGITCISDRV  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            VS++L ++++ G+LSGDI  LSELQILDLSYN  LTG LP  IG  KKL NLILVGC F 
Sbjct  68   VSISLGNLNVEGKLSGDIAALSELQILDLSYNTGLTGPLPPNIGETKKLKNLILVGCSFT  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP+SIG L +L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++PV
Sbjct  128  GQIPESIGKLEQLIYLSLNLNQFSGTIPASIGRLSKLYWFDIADNQIEGTLPV  180



>ref|XP_007154093.1| hypothetical protein PHAVU_003G0900000g [Phaseolus vulgaris]
 gb|ESW26087.1| hypothetical protein PHAVU_003G0900000g [Phaseolus vulgaris]
Length=874

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            T + D+  + +L   WKN  P W  GSDPC D WEG+ C  +RV S+TLSS    G LSG
Sbjct  23   TADEDFTTLMSLMSTWKNTSPDWV-GSDPCED-WEGIKCKNTRVTSITLSSTGFGGPLSG  80

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI  LSEL+ILDLSYNKD TG LP  IG L+KL  LILVGC F G IPDSIG+L +L +L
Sbjct  81   DIGSLSELEILDLSYNKDFTGPLPESIGELRKLSTLILVGCNFNGPIPDSIGNLQELLFL  140

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            SLN N+F GPIP S+G LS+LYWLDLADNQL GSIPV
Sbjct  141  SLNSNRFSGPIPPSIGSLSKLYWLDLADNQLEGSIPV  177



>ref|XP_006358564.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=950

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 122/179 (68%), Gaps = 1/179 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            M  R  + L+    Q L I+  T++ND  A+ +L+  W N+PP+W EGSDPCG  W G+ 
Sbjct  4    MGSRSHVFLLIFVSQILAILGQTNSNDATALFSLKSSWNNLPPNW-EGSDPCGSSWAGIV  62

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            C+ SRV S+ LS M L G   GD+  L+ LQILDLS N  L G+LP  IGNLK L  LIL
Sbjct  63   CDNSRVTSIKLSGMGLEGNQFGDLSSLTALQILDLSNNVGLKGTLPPSIGNLKNLTTLIL  122

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            VGC FFG IP+SIGSL +L ++SL  N F GPIP S+G LS+L WLDL+DN++ G+IP+
Sbjct  123  VGCSFFGPIPESIGSLQQLVFISLTSNSFTGPIPPSIGNLSKLSWLDLSDNKINGTIPI  181



>ref|XP_010113026.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
 gb|EXC35197.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
Length=964

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 123/176 (70%), Gaps = 0/176 (0%)
 Frame = +1

Query  94   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  273
            ++QLLL  +      + ++T+ ND   + +L++ W+N PPSW E  DPCG  WEGV CN 
Sbjct  5    KLQLLLAFVCAGIYLVSSYTNPNDVAVLHSLKEAWENTPPSWEESDDPCGGQWEGVKCND  64

Query  274  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  453
            SRV +L+LS+M L G+L GDI  L EL+ LDLSYNKDLTG L   +G+L+ L  LIL GC
Sbjct  65   SRVTALSLSTMGLKGKLDGDIGGLIELRSLDLSYNKDLTGPLSPRLGDLQNLNILILAGC  124

Query  454  GFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             F G IP+ +G+L  L +L+LN N F G IP +LG+LS +YW D++DNQLTGS+P+
Sbjct  125  RFSGKIPEELGNLKSLSFLALNSNNFTGSIPATLGKLSNVYWFDVSDNQLTGSLPI  180



>ref|XP_010314121.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Solanum lycopersicum]
Length=950

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 122/179 (68%), Gaps = 1/179 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            M  R  + L+    Q L I+  T++ND  A+ AL+  W N+PP+W EGSDPCG  W G+ 
Sbjct  4    MGSRSHVFLLIFVSQILAILGQTNSNDATALFALKSSWNNLPPNW-EGSDPCGSSWAGLI  62

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            C+ SRV S+ LS M L G   GD+  L+ LQILDLS N  L G+LP  IGNLK L  LIL
Sbjct  63   CDNSRVTSIKLSGMGLEGNQFGDLSSLAALQILDLSNNVGLKGTLPPSIGNLKNLTTLIL  122

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            VGC FFG IP+SIGSL +L ++SL  N F GPIP S+G LS+L WLDL+DN++ G+IP+
Sbjct  123  VGCSFFGPIPESIGSLQQLVFISLTSNSFTGPIPPSIGNLSKLSWLDLSDNKINGTIPI  181



>ref|XP_006300598.1| hypothetical protein CARUB_v10019721mg, partial [Capsella rubella]
 gb|EOA33496.1| hypothetical protein CARUB_v10019721mg, partial [Capsella rubella]
Length=982

 Score =   173 bits (439),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 124/188 (66%), Gaps = 3/188 (2%)
 Frame = +1

Query  67   MVI**TMIPRIQLLLVPL---FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDP  237
            MV   T+    +LLL+     F  F    + TD  D  ++++L D W N PPSW    DP
Sbjct  9    MVASNTVTATSRLLLICFSYSFTVFSLTSSVTDPRDAASLRSLMDQWDNTPPSWGGSDDP  68

Query  238  CGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGN  417
            CG  WEGV CN SR+ +L LS+M L G LSGDI EL+EL+ LDLS+N  LTGSL   +G+
Sbjct  69   CGTPWEGVSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDLSFNPGLTGSLTSRLGD  128

Query  418  LKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADN  597
            L+KL  LIL GCGF G IP+ +G L  L +L+LN N F G IP SLG L+++YWLDLADN
Sbjct  129  LQKLNILILAGCGFTGSIPNELGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADN  188

Query  598  QLTGSIPV  621
            QLTG IP+
Sbjct  189  QLTGPIPI  196



>ref|XP_011028445.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Populus euphratica]
Length=952

 Score =   172 bits (437),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 115/166 (69%), Gaps = 1/166 (1%)
 Frame = +1

Query  124  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSS  303
            +Q L I A TD+ND  A+ +L+  WKN PP+W+ G DPCG  WEG+GC GSR+ S+ LS 
Sbjct  14   LQVLVITAATDSNDLSALNSLKSNWKNTPPNWS-GFDPCGGRWEGIGCTGSRITSIVLSG  72

Query  304  MDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSI  483
            M L+G LSGDI    ELQ LDLS N  LTG LP  I NLKKL NL LV C F G IPD I
Sbjct  73   MGLSGTLSGDIGNFPELQTLDLSQNNGLTGILPPAIVNLKKLENLFLVDCNFNGPIPDEI  132

Query  484  GslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            GSL+ L  LSL  N F GPIP S+G++S L  LDL DN+L+G+IPV
Sbjct  133  GSLTHLVSLSLASNNFNGPIPPSIGKMSNLSLLDLTDNKLSGTIPV  178



>gb|KFK26616.1| hypothetical protein AALP_AA8G271800 [Arabis alpina]
Length=952

 Score =   172 bits (437),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 126/173 (73%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +LL+ LF     + A T+  D  A++AL+  W   P  W EGSDPCG +W G+ C   R+
Sbjct  9    MLLILLFFHICYVSALTNGLDASALQALKSEWTRSPEGW-EGSDPCGTNWVGITCINDRI  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            VS+++++++L G+LSGDI  L+ELQILDLS++  L+G LP  IG+LKKL NLILVGC F 
Sbjct  68   VSISVANLNLEGKLSGDISALTELQILDLSFSTGLSGPLPPNIGDLKKLRNLILVGCSFS  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IPDSIGSL +L YLSLN N+F G IP S+G+LS+LYW D+ADNQL G IPV
Sbjct  128  GQIPDSIGSLEQLIYLSLNSNQFSGTIPASIGRLSKLYWFDIADNQLEGEIPV  180



>ref|XP_010441110.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=247

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 123/173 (71%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +LL+ LF Q   + A T++ D VA+ AL+      P +W +G DPCG +W G+ C+  RV
Sbjct  9    MLLILLFFQISSVSALTNSIDAVALLALKSELTGTPKNW-KGFDPCGTNWVGISCSNGRV  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            V+++LS+++L G+LS DI  LSEL  LDL+ N ++TG LP  IGNLKKL  L L+GCGF 
Sbjct  68   VNISLSNLNLQGKLSADISTLSELVTLDLTSNSNITGPLPPNIGNLKKLTELNLMGCGFD  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP+SIG+L KL  LSLN NKF G IP S+G+LS+LYW D+ADNQ+ G IPV
Sbjct  128  GQIPESIGNLEKLTKLSLNSNKFNGKIPASMGRLSKLYWFDIADNQIEGEIPV  180



>ref|XP_004249557.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Solanum lycopersicum]
Length=964

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 115/161 (71%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            I   TD  D   +++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M L G
Sbjct  20   IYTVTDPRDVTILRSLKDQWENTPPSWQKSDDPCGTSWEGVTCNNSRVTALGLSTMGLRG  79

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            +LSGDI  L+EL  LDLS+N+ LTGSL   IG+L+KL  LIL GC F G IP  +G LS+
Sbjct  80   KLSGDIGGLTELISLDLSFNRGLTGSLSPRIGDLQKLNILILAGCSFSGSIPRELGRLSE  139

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +L+LN N F G IP +LG LS+LYWLDLADNQLTG IPV
Sbjct  140  LSFLALNSNNFTGEIPRTLGNLSKLYWLDLADNQLTGPIPV  180



>gb|KHN40213.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=944

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            T + D     +L + W+N PP+W  GSDPC D W G+ C  S + S+TLSS  L G+LSG
Sbjct  7    TADGDLTTFLSLINTWENTPPNWV-GSDPCDD-WVGIKCKNSHITSITLSSTSLAGQLSG  64

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI  LSEL+ LDLSYNKDLTG LP  IG LKKL  LILVGC F G IPDSIG++ +L +L
Sbjct  65   DIGSLSELETLDLSYNKDLTGPLPESIGELKKLATLILVGCSFKGPIPDSIGNMQELLFL  124

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            SLN N F GPIP S+G LS+LYWLDLADNQL G+IPV
Sbjct  125  SLNSNSFSGPIPHSIGNLSKLYWLDLADNQLQGNIPV  161



>ref|XP_010038738.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=959

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 124/176 (70%), Gaps = 1/176 (1%)
 Frame = +1

Query  94   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  273
            R+   L  L      I +FTD  D  A++ALR  W+N PPSWA+  DPCG  W+GV CN 
Sbjct  3    RLVFFLAILLAGIHVICSFTDPGDSAALQALRGIWQNTPPSWAK-DDPCGVPWDGVTCNN  61

Query  274  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  453
             RV +L LSSM++ G LSGDI  L+EL+ LDLS+N+DLTGSL   +G+L  L  LIL GC
Sbjct  62   LRVTALGLSSMNIKGSLSGDIGGLTELRSLDLSFNQDLTGSLTARLGDLSNLNTLILQGC  121

Query  454  GFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            GF G IPD +G LS+L +L+LN NKF G IP SLG LS+L WLDLA+NQLTGSIP+
Sbjct  122  GFTGNIPDELGKLSQLTFLALNNNKFTGSIPASLGNLSQLSWLDLAENQLTGSIPL  177



>ref|XP_008465342.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Cucumis melo]
Length=941

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAF-TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR  279
            L++  LF+ F  + A  TD+ D   +++L+DGW+N PPSW   +DPCG  W+GV C  SR
Sbjct  5    LVVSLLFLAFFYLAASSTDSRDSSVLQSLKDGWQNTPPSWGTSNDPCGTPWDGVICKNSR  64

Query  280  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  459
            VV+L LSSM L G+L GDI  L+EL+ LDL+ N+DL GS+   +GNL KL  LIL  CGF
Sbjct  65   VVALKLSSMGLKGKLGGDIGGLTELRSLDLAANRDLVGSISPALGNLLKLETLILSTCGF  124

Query  460  FGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             G IP+ +G+LS+L +LSL  N F G IP +LG+LS+LYWLDLADNQLTG++PV
Sbjct  125  SGNIPEELGNLSELTFLSLYSNNFTGTIPATLGKLSKLYWLDLADNQLTGALPV  178



>gb|KCW47574.1| hypothetical protein EUGRSUZ_K01321 [Eucalyptus grandis]
Length=955

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 124/176 (70%), Gaps = 1/176 (1%)
 Frame = +1

Query  94   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  273
            R+   L  L      I +FTD  D  A++ALR  W+N PPSWA+  DPCG  W+GV CN 
Sbjct  3    RLVFFLAILLAGIHVICSFTDPGDSAALQALRGIWQNTPPSWAK-DDPCGVPWDGVTCNN  61

Query  274  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  453
             RV +L LSSM++ G LSGDI  L+EL+ LDLS+N+DLTGSL   +G+L  L  LIL GC
Sbjct  62   LRVTALGLSSMNIKGSLSGDIGGLTELRSLDLSFNQDLTGSLTARLGDLSNLNTLILQGC  121

Query  454  GFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            GF G IPD +G LS+L +L+LN NKF G IP SLG LS+L WLDLA+NQLTGSIP+
Sbjct  122  GFTGNIPDELGKLSQLTFLALNNNKFTGSIPASLGNLSQLSWLDLAENQLTGSIPL  177



>ref|XP_007147540.1| hypothetical protein PHAVU_006G133200g [Phaseolus vulgaris]
 gb|ESW19534.1| hypothetical protein PHAVU_006G133200g [Phaseolus vulgaris]
Length=944

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = +1

Query  142  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE  321
            VA     D+  +K+L D W+   P+W EGSDPC D W G+ C  SRVVS++L+ + LTG+
Sbjct  20   VAQDITKDFQVLKSLSDSWQGQIPNW-EGSDPCQD-WYGINCRNSRVVSISLTDIGLTGK  77

Query  322  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  501
            LSGDI  LSEL  LDLSYN+ LTG LP+EIGNLKKL  L LVGCGF G IPD IGSL  L
Sbjct  78   LSGDIGSLSELDSLDLSYNRGLTGPLPQEIGNLKKLTKLTLVGCGFTGRIPDEIGSLQHL  137

Query  502  kylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            ++LSLN N F GPIP S+G LS L WLDLADNQL GSIPV
Sbjct  138  EFLSLNSNNFAGPIPPSIGNLSNLTWLDLADNQLDGSIPV  177



>ref|XP_010938089.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=986

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 123/174 (71%), Gaps = 1/174 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGI-VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR  279
            LLL+  F+  L +    TD  D  A+++L D W+N PP+W +  DPCG  W GV C+GSR
Sbjct  29   LLLLLAFVSGLRVGYGITDPTDAAALRSLIDTWQNTPPNWGQSDDPCGTPWVGVSCHGSR  88

Query  280  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  459
            V +LTLS+M L G LSGDI +LSELQ LDLSYN +L G L   IGNLKKL  LIL+GC F
Sbjct  89   VTALTLSTMGLKGILSGDIGQLSELQSLDLSYNNELGGPLTANIGNLKKLATLILLGCSF  148

Query  460  FGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             G IPD +G+L KL YL+LN NKF G IP SLG LS LY LD++DNQL+G IP+
Sbjct  149  SGQIPDELGNLGKLSYLALNSNKFTGSIPASLGTLSNLYCLDVSDNQLSGPIPI  202



>ref|XP_011012973.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Populus euphratica]
Length=978

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 126/173 (73%), Gaps = 5/173 (3%)
 Frame = +1

Query  118  LFIQFLG-----IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            LF+ F       I + TD +D  A+++L+  W+N PPSW +  DPCG  WEGV C+ SR+
Sbjct  12   LFLTFFTSGIHLIFSDTDPSDAAALQSLKRQWQNTPPSWGQSPDPCGAPWEGVTCSNSRI  71

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
             +L LS+M+L G+LSGDI  L+EL+ LDLS+N +LTGSL   +G+L KL  LIL GCGF 
Sbjct  72   TALGLSTMNLKGKLSGDIGGLTELRSLDLSFNTNLTGSLTPRLGDLLKLNILILAGCGFS  131

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IPD +G+L++L +L+LN N F G IP SLG+LS+LYWLDLADNQLTG IP+
Sbjct  132  GSIPDELGNLAELSFLALNSNNFSGGIPPSLGKLSKLYWLDLADNQLTGPIPI  184



>ref|XP_002323702.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF05463.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=978

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 121/161 (75%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            I + TD +D  A+++L+  W+N PPSW +  DPCG  WEGV C+ SR+ +L LS+M+L G
Sbjct  24   IFSDTDPSDAAALQSLKKQWQNTPPSWGQSHDPCGAPWEGVTCSNSRITALGLSTMNLKG  83

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            +LSGDI  L+EL+ LDLS+N +LTGSL    G+L KL  LIL GCGF G IPD +G+L++
Sbjct  84   KLSGDIGGLTELRSLDLSFNTNLTGSLTPRFGDLLKLNILILAGCGFSGSIPDELGNLAE  143

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +L+LN N F G IP SLG+LS+LYWLDLADNQLTG IP+
Sbjct  144  LSFLALNSNNFSGGIPPSLGKLSKLYWLDLADNQLTGPIPI  184



>ref|XP_006584124.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Glycine max]
Length=960

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            T + D     +L + W+N PP+W  GSDPC D W G+ C  S + S+TLSS  L G+LSG
Sbjct  23   TADGDLTTFLSLINTWENTPPNWV-GSDPCDD-WVGIKCKNSHITSITLSSTGLAGQLSG  80

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI  LSEL+ LDLSYNKDLTG LP  IG LKKL  LILVGC F G IPDSIG++ +L +L
Sbjct  81   DIGSLSELETLDLSYNKDLTGPLPESIGELKKLATLILVGCSFKGPIPDSIGNMQELLFL  140

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            SLN N F GPIP S+G LS+LYWLDLADNQL G+IPV
Sbjct  141  SLNSNSFSGPIPHSIGNLSKLYWLDLADNQLQGNIPV  177



>ref|XP_010482269.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=955

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 125/173 (72%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            ++L+ LF     +   T+  D  A++A++  W   P +W EGSDPCG +W G+ C+  R+
Sbjct  13   MILILLFFHICCVYGLTNGPDATALQAVKSEWTKFPKNW-EGSDPCGTNWVGITCSNDRI  71

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            VS++L ++DL G+LS DI  LSELQILDL+ N +LTG LP  IGNLKKL  L L+GCGF 
Sbjct  72   VSISLGNVDLEGKLSADIAALSELQILDLTSNPNLTGPLPPNIGNLKKLVILNLMGCGFS  131

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP+SIGSL +L  LSLN NKFIG IP S+G+LS+L+WLD+ADNQ+ G +PV
Sbjct  132  GQIPESIGSLEQLTTLSLNSNKFIGTIPASIGRLSQLFWLDIADNQIEGKLPV  184



>ref|XP_010921260.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=602

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 122/174 (70%), Gaps = 1/174 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVA-FTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR  279
            LLL+ +F+  L + +  TD  D   +++L   W+N PP+W +  DPCG  W GV C+ SR
Sbjct  5    LLLLLVFVAGLQVSSGTTDLTDAAVLRSLMGEWQNTPPNWGQSDDPCGTPWIGVNCSNSR  64

Query  280  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  459
            V  L LS+M L G LSGDI +LSELQILDLSYNK+L G LP  IGNLKK+  LIL+GC F
Sbjct  65   VTVLKLSTMGLKGTLSGDIGQLSELQILDLSYNKELGGQLPANIGNLKKINTLILIGCNF  124

Query  460  FGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             G IP+ +G++  L +L+LN NKF G IP SLG LS LY LD+ADNQL+G IP+
Sbjct  125  GGEIPEELGNIGNLSFLALNSNKFTGRIPASLGTLSHLYLLDVADNQLSGPIPI  178



>ref|XP_006338928.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=964

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 115/161 (71%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            I   TD  D   +++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M L G
Sbjct  20   IYTVTDPRDVTILRSLKDQWENTPPSWQKSDDPCGTSWEGVTCNNSRVTALGLSTMGLRG  79

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            +LSGDI  L+EL  LDLS+N+ LTGSL   IG+L+KL  LIL GC F G IP  +G L++
Sbjct  80   KLSGDIGGLTELISLDLSFNRGLTGSLSPRIGDLQKLNILILAGCSFSGSIPMELGRLAE  139

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +L+LN N F G IP +LG LS+LYWLDLADNQLTG IPV
Sbjct  140  LSFLALNSNNFTGEIPQTLGNLSKLYWLDLADNQLTGPIPV  180



>ref|XP_006584125.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X2 [Glycine max]
Length=945

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            T + D     +L + W+N PP+W  GSDPC D W G+ C  S + S+TLSS  L G+LSG
Sbjct  23   TADGDLTTFLSLINTWENTPPNWV-GSDPCDD-WVGIKCKNSHITSITLSSTGLAGQLSG  80

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI  LSEL+ LDLSYNKDLTG LP  IG LKKL  LILVGC F G IPDSIG++ +L +L
Sbjct  81   DIGSLSELETLDLSYNKDLTGPLPESIGELKKLATLILVGCSFKGPIPDSIGNMQELLFL  140

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            SLN N F GPIP S+G LS+LYWLDLADNQL G+IPV
Sbjct  141  SLNSNSFSGPIPHSIGNLSKLYWLDLADNQLQGNIPV  177



>ref|XP_009387132.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=965

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 112/157 (71%), Gaps = 0/157 (0%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            TD  D  A++++   WKN PP+W + SDPCG  WEGV C+ SRV SL LS+M + G LS 
Sbjct  25   TDPQDAAALRSMLSEWKNAPPTWGQSSDPCGSPWEGVFCDASRVTSLRLSTMGIKGTLSS  84

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI +L+ELQ LDLSYN DL G L   IGNLKKL  LIL GC F G IP+ +G+L  L +L
Sbjct  85   DISQLTELQSLDLSYNGDLGGLLTPNIGNLKKLTTLILAGCSFNGKIPEELGNLKLLSFL  144

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LN NKF G IP SLG LS LYWLDLADNQL GS+P+
Sbjct  145  ALNSNKFNGRIPASLGLLSNLYWLDLADNQLIGSLPI  181



>ref|NP_001066400.1| Os12g0210400 [Oryza sativa Japonica Group]
 gb|ABA96703.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29419.1| Os12g0210400 [Oryza sativa Japonica Group]
 dbj|BAG91081.1| unnamed protein product [Oryza sativa Japonica Group]
Length=967

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 120/177 (68%), Gaps = 1/177 (1%)
 Frame = +1

Query  91   PRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  270
            P I + L+ + +Q     A T+  D   +  L   W + P +WA G+DPCGD W G+ C 
Sbjct  5    PWIIIFLLIVLVQAFVASADTNAQDTSGLNGLAGSWGSAPSNWA-GNDPCGDKWIGIICT  63

Query  271  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  450
            G+RV S+ LSS  L+G LSGDI+ LSELQ LDLSYNK+L G LP  IG L KL NLILVG
Sbjct  64   GNRVTSIRLSSFGLSGTLSGDIQSLSELQYLDLSYNKNLNGPLPSTIGTLSKLQNLILVG  123

Query  451  CGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            CGF G IP  IG LS L +LSLN NKF G IP SLG LS+LYW DLADNQLTG +P+
Sbjct  124  CGFTGEIPKEIGQLSNLIFLSLNSNKFTGSIPPSLGGLSKLYWFDLADNQLTGGLPI  180



>gb|EEE52938.1| hypothetical protein OsJ_35570 [Oryza sativa Japonica Group]
Length=967

 Score =   171 bits (433),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 120/177 (68%), Gaps = 1/177 (1%)
 Frame = +1

Query  91   PRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN  270
            P I + L+ + +Q     A T+  D   +  L   W + P +WA G+DPCGD W G+ C 
Sbjct  5    PWIIIFLLIVLVQAFVASADTNAQDTSGLNGLAGSWGSAPSNWA-GNDPCGDKWIGIICT  63

Query  271  GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  450
            G+RV S+ LSS  L+G LSGDI+ LSELQ LDLSYNK+L G LP  IG L KL NLILVG
Sbjct  64   GNRVTSIRLSSFGLSGTLSGDIQSLSELQYLDLSYNKNLNGPLPSTIGTLSKLQNLILVG  123

Query  451  CGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            CGF G IP  IG LS L +LSLN NKF G IP SLG LS+LYW DLADNQLTG +P+
Sbjct  124  CGFTGEIPKEIGQLSNLIFLSLNSNKFTGSIPPSLGGLSKLYWFDLADNQLTGGLPI  180



>ref|XP_009337850.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
 ref|XP_009337851.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=963

 Score =   171 bits (433),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = +1

Query  121  FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS  300
            F +   I + T+ +D  A+++L+  W NVPPSW + SDPCG  WEGV CN SRV +L LS
Sbjct  15   FSRLHVISSVTNPDDASALQSLKQTWSNVPPSWDKSSDPCGAQWEGVTCNDSRVTALGLS  74

Query  301  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  480
            ++++ G++ GDI  LSEL+ LDLS+NK LTGSL   +G+L KL  LIL GC F G IP  
Sbjct  75   AINVKGKIEGDIGGLSELRSLDLSFNKGLTGSLSPRLGDLSKLNILILAGCSFSGSIPSE  134

Query  481  IGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +G+L +L +L+LN N F G IP SLG+LS LYWLDLADNQLTG IPV
Sbjct  135  LGNLKELTFLALNTNNFTGRIPASLGKLSNLYWLDLADNQLTGPIPV  181



>gb|KJB57523.1| hypothetical protein B456_009G167900 [Gossypium raimondii]
Length=959

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 118/173 (68%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            L LV +      + A TD +D  +++A+   WKNVP +W  G DPC D W G+GC GSRV
Sbjct  7    LFLVVVLFHIYIVAAETDPDDNSSLRAVMSEWKNVPSNWGRG-DPCDDKWVGIGCTGSRV  65

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
             SL L +M L G L GDI  LSEL+ LDLSYNK L G LP  + NLKKL NLILVGCGF 
Sbjct  66   TSLNLPNMKLEGRLVGDIFFLSELKELDLSYNKGLRGILPPAVQNLKKLENLILVGCGFS  125

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IPD+IGSL +L+ LSLN N F G IP S+G LS L WLD+ADNQL G IPV
Sbjct  126  GQIPDTIGSLPQLRILSLNSNAFSGNIPPSIGNLSTLNWLDMADNQLEGEIPV  178



>ref|XP_010044506.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
 ref|XP_010044514.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
 gb|KCW88495.1| hypothetical protein EUGRSUZ_A00882 [Eucalyptus grandis]
Length=968

 Score =   171 bits (432),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 129/177 (73%), Gaps = 2/177 (1%)
 Frame = +1

Query  97   IQLLLVPLFIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  273
            I L+ V LF + L +V +FT+ +D VA+++L+  W+N PPSW   SDPCG  WEGV CN 
Sbjct  9    IFLVAVLLFGKDLQLVFSFTNPDDSVALQSLKMSWQNTPPSWERSSDPCGLPWEGVTCNS  68

Query  274  -SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  450
             SRV SL LS+M + G+L  +I  L+EL+ LDLS+NK+LTG L R++GNL+KL  LIL G
Sbjct  69   NSRVTSLGLSTMGIKGQLISEIAGLAELRSLDLSFNKELTGPLARQLGNLQKLNILILAG  128

Query  451  CGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            C F G IPD +G+L++L +L+LN N   G IP SLG LS+LYW DLADNQLTG IP+
Sbjct  129  CSFTGSIPDELGNLAELSFLALNSNNLTGNIPASLGNLSKLYWFDLADNQLTGPIPI  185



>ref|XP_002467924.1| hypothetical protein SORBIDRAFT_01g036470 [Sorghum bicolor]
 gb|EER94922.1| hypothetical protein SORBIDRAFT_01g036470 [Sorghum bicolor]
Length=966

 Score =   171 bits (432),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 115/161 (71%), Gaps = 1/161 (1%)
 Frame = +1

Query  142  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WEGVGCNGSRVVSLTLSSMDLTG  318
            +A TD+ D   ++AL D W+N PPSW +  DPCGD  WEGV C   +V+S+ LS+M + G
Sbjct  20   LAMTDSQDTSVLRALMDQWQNAPPSWGQSDDPCGDSPWEGVTCGSDKVISIKLSTMGIKG  79

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
             L+ DI +LS LQ LDLS+NKDL+G L   IGNLK+L  LIL GC F G IPD +GSL K
Sbjct  80   TLAADIGQLSNLQSLDLSFNKDLSGVLSPTIGNLKQLTTLILAGCSFHGTIPDELGSLPK  139

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L Y++LN N+F G IP SLG LS LYW D+ADNQL+G +PV
Sbjct  140  LSYMALNSNQFSGKIPASLGNLSSLYWFDIADNQLSGPLPV  180



>ref|XP_010537840.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Tarenaya hassleriana]
Length=964

 Score =   171 bits (432),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 121/172 (70%), Gaps = 0/172 (0%)
 Frame = +1

Query  94   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  273
            R+   LV  F  F  I + TD  D  A+++L D W+N PPSW E  DPCG  WEGV CN 
Sbjct  7    RLLFFLVCCFAVFSVISSVTDPRDAAAMRSLMDQWENTPPSWRESDDPCGTPWEGVTCNN  66

Query  274  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  453
            SR+ +L LS+M L G+LSGDI  L+EL+ LDLS+N  L GSL  ++G+L+ L  LIL GC
Sbjct  67   SRITALGLSTMGLKGKLSGDIGGLTELRSLDLSFNPGLKGSLTPQLGDLQNLNILILAGC  126

Query  454  GFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTG  609
            GF G IP+ +G+LS+L +L+LN N F G IP SLG LS++YWLDLADNQLTG
Sbjct  127  GFTGNIPEELGNLSELSFLALNSNNFSGRIPASLGNLSKVYWLDLADNQLTG  178



>ref|XP_010252249.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Nelumbo nucifera]
Length=915

 Score =   170 bits (430),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 125/176 (71%), Gaps = 5/176 (3%)
 Frame = +1

Query  106  LLVPLFIQFLGIVAF---TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  276
            LL+ + IQ     A    TD ND  A+ + +  WKN PP+W E SDPC   W GV CN S
Sbjct  12   LLLVVLIQISSAAAQQAPTDPNDAAALNSFKLMWKNRPPNW-ENSDPCVGGWVGVTCNNS  70

Query  277  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE-IGNLKKLYNLILVGC  453
            +V+S+ LSSM L G+LSGDI  L+ELQ LDLSYN+ L G LP E IG+LKKL NLILVGC
Sbjct  71   QVISIKLSSMGLEGQLSGDIGALTELQTLDLSYNRGLNGPLPAEAIGSLKKLSNLILVGC  130

Query  454  GFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             F G IP +IG L +L +LSLN N F G IP S+G+LS+LYWLD+ADN+L+G+IPV
Sbjct  131  SFSGRIPSTIGDLEELVFLSLNSNSFTGEIPPSIGKLSKLYWLDIADNKLSGTIPV  186



>ref|XP_009761326.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana sylvestris]
Length=961

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = +1

Query  145  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  324
            + TD  D   +++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M L G+L
Sbjct  22   SVTDPRDVAILRSLKDQWENTPPSWQKSDDPCGTSWEGVTCNNSRVTALGLSTMGLRGKL  81

Query  325  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  504
            SGDI  L+EL  LDLS+N+ LTGSL   IG+L+KL  LIL GC F G IP  +G L++L 
Sbjct  82   SGDIGGLTELISLDLSFNRGLTGSLSPRIGDLQKLNILILAGCSFSGSIPRELGKLAELS  141

Query  505  ylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +L+LN N F G IP +LG L++LYWLDLADNQLTG IPV
Sbjct  142  FLALNSNNFTGEIPRTLGNLAKLYWLDLADNQLTGPIPV  180



>ref|XP_010252248.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Nelumbo nucifera]
Length=959

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 125/176 (71%), Gaps = 5/176 (3%)
 Frame = +1

Query  106  LLVPLFIQFLGIVAF---TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  276
            LL+ + IQ     A    TD ND  A+ + +  WKN PP+W E SDPC   W GV CN S
Sbjct  12   LLLVVLIQISSAAAQQAPTDPNDAAALNSFKLMWKNRPPNW-ENSDPCVGGWVGVTCNNS  70

Query  277  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE-IGNLKKLYNLILVGC  453
            +V+S+ LSSM L G+LSGDI  L+ELQ LDLSYN+ L G LP E IG+LKKL NLILVGC
Sbjct  71   QVISIKLSSMGLEGQLSGDIGALTELQTLDLSYNRGLNGPLPAEAIGSLKKLSNLILVGC  130

Query  454  GFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             F G IP +IG L +L +LSLN N F G IP S+G+LS+LYWLD+ADN+L+G+IPV
Sbjct  131  SFSGRIPSTIGDLEELVFLSLNSNSFTGEIPPSIGKLSKLYWLDIADNKLSGTIPV  186



>ref|XP_010429861.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=973

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 119/181 (66%), Gaps = 1/181 (1%)
 Frame = +1

Query  82   TMIPRIQLLLVPLFIQFLGIVA-FTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  258
            T   R+ L+        L + +  TD  D  ++++L D W N PPSW    DPCG  WEG
Sbjct  8    TATSRLLLICFAYSFSVLSMTSSVTDPRDAASLRSLMDQWDNTPPSWGGSDDPCGTPWEG  67

Query  259  VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  438
            V CN SR+ +L LS+M L G LSGDI EL+EL+ LD+S+N  LTGSL   +G+L KL  L
Sbjct  68   VSCNNSRITALGLSTMGLKGRLSGDIGELAELRSLDISFNPGLTGSLTSRLGDLPKLNIL  127

Query  439  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIP  618
            IL GCGF G IP+ IG L  L +L+LN N F G IP SLG L+++YWLDLADNQLTG IP
Sbjct  128  ILAGCGFTGSIPNEIGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGPIP  187

Query  619  V  621
            +
Sbjct  188  I  188



>ref|XP_009416032.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=965

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 125/177 (71%), Gaps = 2/177 (1%)
 Frame = +1

Query  94   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  273
            R  + L+    Q L + + TD+ D  A+ AL   WKN+P +W   SDPCGD+W G+ CN 
Sbjct  20   RCLVFLLGFLTQMLVVTSDTDSQDAAALNALATLWKNIPSNW-RSSDPCGDNWVGISCNN  78

Query  274  -SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG  450
             SRV S++LSS+ L G L+GDI+ L+ELQ LDLSYNK LTG LP  IG+L KL NLILVG
Sbjct  79   ESRVTSISLSSLGLKGTLTGDIQYLTELQALDLSYNKGLTGGLPSSIGSLSKLVNLILVG  138

Query  451  CGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            C F G IP  IGSLS L +LSLN N F G IP S+G LS LYWLDLADN+L+G+IPV
Sbjct  139  CSFSGEIPPEIGSLSLLTFLSLNSNSFTGGIPSSIGNLSNLYWLDLADNKLSGTIPV  195



>ref|XP_002864013.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40272.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=428

 Score =   165 bits (417),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 127/183 (69%), Gaps = 5/183 (3%)
 Frame = +1

Query  85   MIPRIQ----LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHW  252
            M  RI+    +L+V  F Q   + AFT+  +  A++AL++ W   P SW EGSDPCG +W
Sbjct  1    MSSRIEALSFMLVVFFFFQRCYVSAFTNGLEASALRALKNEWTRSPKSW-EGSDPCGTNW  59

Query  253  EGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY  432
             G+ C  +RVVS++L + +L G LS  I  LSEL+ILDLS+N  LTG LP  IGNLKKL 
Sbjct  60   VGITCTNNRVVSISLVNHNLEGTLSEYISALSELEILDLSFNTGLTGPLPPNIGNLKKLK  119

Query  433  NLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGS  612
            NLILVGCGF G IP+S+GSL +L  L+LN NKF G IP S+G+LS+L W D+ DN++ G 
Sbjct  120  NLILVGCGFSGQIPESVGSLEQLIKLALNSNKFNGTIPASVGRLSKLDWFDIDDNRIEGE  179

Query  613  IPV  621
            +P+
Sbjct  180  LPI  182



>ref|XP_008802221.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
Length=967

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 118/159 (74%), Gaps = 1/159 (1%)
 Frame = +1

Query  145  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  324
            A TD  D  A+ +L   W+N P +W  GSDPCG++W G+ C  SRV+S+TLSS+ L G L
Sbjct  37   AETDPQDAAALNSLASLWENTPSNWI-GSDPCGNNWVGISCTNSRVISITLSSLGLIGTL  95

Query  325  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  504
            SGDI+ L+ELQ LDLSYNK L G +P  IG+L KL NLILVGC F G IP  IG+L++L 
Sbjct  96   SGDIQSLNELQALDLSYNKGLNGGIPASIGSLSKLVNLILVGCSFSGKIPPEIGNLARLV  155

Query  505  ylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LSLN N F G IP ++G LS+LYWLD+ADN+LTG+IPV
Sbjct  156  FLSLNSNGFTGSIPETVGNLSKLYWLDMADNKLTGTIPV  194



>ref|XP_010482274.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X4 [Camelina sativa]
Length=800

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 119/167 (71%), Gaps = 2/167 (1%)
 Frame = +1

Query  124  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS-RVVSLTLS  300
            +Q   + A  D +D  A++ L+  W  +  SW +GSDPCG+HW G+ CN + RVVS+ LS
Sbjct  16   VQVCSVSAIPDGSDSSALQVLKSEWTALSKSW-KGSDPCGNHWVGITCNNNNRVVSIMLS  74

Query  301  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  480
            +++L G L  DI  LSEL+ILDLSYN  L+G+LP  IGNLK L +LIL+GCGF G IP+S
Sbjct  75   NLNLKGNLPADISTLSELEILDLSYNTGLSGALPSSIGNLKNLKSLILMGCGFSGQIPES  134

Query  481  IGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            IGSL KL  LSLN N F G IP S+G+LSELYW D+ DNQ+ G IPV
Sbjct  135  IGSLEKLTTLSLNSNHFSGTIPASIGRLSELYWFDITDNQIEGKIPV  181



>ref|XP_009600216.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana tomentosiformis]
Length=964

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 115/164 (70%), Gaps = 0/164 (0%)
 Frame = +1

Query  130  FLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMD  309
            F  I   TD  D   +++L+D W+N PPSW +  DPCG  WEGV CN SRV +L LS+M 
Sbjct  17   FHLIYTVTDPRDVAILRSLKDQWENTPPSWQKSDDPCGTTWEGVTCNNSRVTALGLSTMG  76

Query  310  LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGs  489
            L G+LSGDI  L+EL  LDLS+N+ LTGSL   IG+L+ L  LIL GC F G IP  +G 
Sbjct  77   LRGKLSGDIGGLTELISLDLSFNRGLTGSLSPRIGDLQNLNILILAGCSFSGSIPRELGK  136

Query  490  lsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L++L +L+LN N F G IP +LG L++LYWLDLADNQLTG IPV
Sbjct  137  LAELSFLALNSNNFTGEIPRTLGNLAKLYWLDLADNQLTGQIPV  180



>gb|KHN40741.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=945

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 123/160 (77%), Gaps = 2/160 (1%)
 Frame = +1

Query  142  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE  321
            VA   N+D+  +K+LR  W +  P+W EGSDPC D WEG+ C  SRV+S++LS + LTG 
Sbjct  22   VAQDVNSDFAVLKSLRGSWLSPTPNW-EGSDPCKD-WEGIKCKNSRVISISLSDIGLTGH  79

Query  322  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  501
            LSGDI  LSEL+ILDLSYN+ LTGSLP+EIGNLKKL  L+LVGCGF G IPD IG L +L
Sbjct  80   LSGDIGSLSELEILDLSYNRGLTGSLPQEIGNLKKLLKLVLVGCGFTGRIPDEIGFLEQL  139

Query  502  kylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             +LSLN N F+GPIP S+G LS L WLDLADNQL GSIPV
Sbjct  140  VFLSLNSNNFVGPIPPSIGNLSNLTWLDLADNQLDGSIPV  179



>ref|XP_009391654.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=926

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 113/157 (72%), Gaps = 1/157 (1%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            TD+ D  A+KAL + WKN PPSW   +DPC D W+GV C GSRV  L L SM++ G LSG
Sbjct  22   TDSQDVSALKALSNQWKNTPPSWRRSNDPC-DQWDGVNCTGSRVKELKLFSMNIEGRLSG  80

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI+ L+EL +LDLS NK+L G LPR IGNLK+L  L L+GC F G IP  +G+L  LK L
Sbjct  81   DIQNLTELTLLDLSSNKNLGGPLPRSIGNLKQLQTLRLIGCSFSGSIPVEVGNLLNLKIL  140

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            SLN N+F G IP SLG+LS L WLDLA+NQLTG IP 
Sbjct  141  SLNSNQFNGTIPGSLGRLSNLEWLDLAENQLTGIIPT  177



>ref|XP_002864014.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40273.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=953

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 122/173 (71%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +LL+  F Q   + A T+  D  A+ AL+  W + P  W EGSDPCG +W G+ C   RV
Sbjct  9    MLLIMFFFQICSVSALTNGLDSSALNALKAEWTSPPDGW-EGSDPCGTNWVGITCQNDRV  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            VS++L +++L G+L  DI  LSEL+ILDLSYN  L+G LP  IGNL KL NLILVGC F 
Sbjct  68   VSISLGNLNLEGKLQPDISFLSELRILDLSYNPKLSGPLPPNIGNLGKLRNLILVGCSFS  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP+SIG L +L YLSLNLN+F G IP S+GQLS+LYW D+ADNQ+ G +PV
Sbjct  128  GQIPESIGMLKELIYLSLNLNQFSGTIPASIGQLSKLYWFDIADNQIEGELPV  180



>ref|XP_006402241.1| hypothetical protein EUTSA_v10012584mg [Eutrema salsugineum]
 gb|ESQ43694.1| hypothetical protein EUTSA_v10012584mg [Eutrema salsugineum]
Length=964

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 125/173 (72%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +LL  LF Q   + A T+ +D  A++AL+  W   P SW +GSDPCG +W G+ C+  R+
Sbjct  9    MLLTLLFFQNCFVSALTNGSDASALQALKSDWSRFPESW-KGSDPCGTNWVGITCSNDRI  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            VS++L +++L G+LS DI  L+ELQILDL+ N  L+G LP  IGNLKKL  L L+GCGF 
Sbjct  68   VSISLGNINLEGKLSADISALAELQILDLTSNPKLSGPLPPNIGNLKKLNTLNLMGCGFS  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP+SIGSL +L  LSLN NKF G IP S+G+LS+L+W D+ADNQ+ G++PV
Sbjct  128  GQIPESIGSLEQLTTLSLNSNKFSGTIPASIGRLSKLFWFDIADNQIEGTVPV  180



>ref|XP_009417853.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X4 [Musa acuminata subsp. malaccensis]
Length=841

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 112/157 (71%), Gaps = 0/157 (0%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            T+  D  A+++L   W+N PP+W +  DPCG  WEG+GC+ SRV  L LS+M + G LSG
Sbjct  22   TNPQDAAALRSLMSQWQNTPPNWGKSDDPCGTPWEGIGCSNSRVTVLRLSTMGIKGTLSG  81

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI +L EL+ LDLSYN +L G LP  I NL+K+  LIL GC F G IPD +GSL  L YL
Sbjct  82   DIGQLGELKTLDLSYNSELGGPLPPNIANLRKITTLILAGCSFSGNIPDELGSLVNLSYL  141

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LN N+F G IP SLG+LS LYW D+ADNQL+GS+P+
Sbjct  142  ALNSNQFTGSIPASLGKLSNLYWFDVADNQLSGSLPI  178



>ref|XP_010688349.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Beta vulgaris subsp. vulgaris]
Length=962

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 124/176 (70%), Gaps = 0/176 (0%)
 Frame = +1

Query  94   RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  273
            R+ LL +  F +   I+  TD+ D  A+ +L+  W+N PPSW++  DPC   WEGV CN 
Sbjct  5    RVLLLCLLGFAKVNLILCLTDSGDAAALHSLKAQWQNTPPSWSKSDDPCAAPWEGVTCNK  64

Query  274  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  453
            SR+ +L LS+M L G+LSGDI  L+EL+ LDLS+N+ LTGSL   +G+L+KL  LIL GC
Sbjct  65   SRITALGLSTMGLKGKLSGDIGGLTELRSLDLSFNRGLTGSLTPRLGDLQKLNILILAGC  124

Query  454  GFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             F G IP  +G+L++L +L+LN N   G IP SLG LS+LYWLDLADNQL+GSIP 
Sbjct  125  SFSGSIPMELGNLAELSFLALNSNNLTGEIPHSLGNLSKLYWLDLADNQLSGSIPT  180



>ref|XP_010482273.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Camelina sativa]
Length=950

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 119/167 (71%), Gaps = 2/167 (1%)
 Frame = +1

Query  124  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS-RVVSLTLS  300
            +Q   + A  D +D  A++ L+  W  +  SW +GSDPCG+HW G+ CN + RVVS+ LS
Sbjct  16   VQVCSVSAIPDGSDSSALQVLKSEWTALSKSW-KGSDPCGNHWVGITCNNNNRVVSIMLS  74

Query  301  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  480
            +++L G L  DI  LSEL+ILDLSYN  L+G+LP  IGNLK L +LIL+GCGF G IP+S
Sbjct  75   NLNLKGNLPADISTLSELEILDLSYNTGLSGALPSSIGNLKNLKSLILMGCGFSGQIPES  134

Query  481  IGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            IGSL KL  LSLN N F G IP S+G+LSELYW D+ DNQ+ G IPV
Sbjct  135  IGSLEKLTTLSLNSNHFSGTIPASIGRLSELYWFDITDNQIEGKIPV  181



>ref|NP_199787.2| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 dbj|BAC41801.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|AAP21294.1| At5g49760 [Arabidopsis thaliana]
 gb|ACN59388.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED95854.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=953

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 121/173 (70%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            LLL+  F Q   + A T+  D  A+ AL+  W   P  W EGSDPCG +W G+ C   RV
Sbjct  9    LLLILFFFQICSVSALTNGLDASALNALKSEWTTPPDGW-EGSDPCGTNWVGITCQNDRV  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            VS++L ++DL G+L  DI  LSEL+ILDLSYN  L+G LP  IGNL KL NLILVGC F 
Sbjct  68   VSISLGNLDLEGKLPADISFLSELRILDLSYNPKLSGPLPPNIGNLGKLRNLILVGCSFS  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP+SIG+L +L YLSLNLNKF G IP S+G LS+LYW D+ADNQ+ G +PV
Sbjct  128  GQIPESIGTLKELIYLSLNLNKFSGTIPPSIGLLSKLYWFDIADNQIEGELPV  180



>ref|XP_009370844.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=959

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            I + T  +D  A+++LR  W NVPPSW + +DPCG+ WEG+ C+GSRV +L LS M++ G
Sbjct  18   ISSSTHLDDANALQSLRQKWINVPPSWDKSNDPCGESWEGITCHGSRVTALGLSGMNVEG  77

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            ++ GDI  LSEL+ LDLS+NK LTGSL   +G+L  L  LIL GC F G+IP  +G L +
Sbjct  78   KIEGDIAGLSELRFLDLSFNKGLTGSLSPRLGDLSNLNILILAGCSFSGIIPSELGKLGE  137

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +L+LN N F G IP SLG LS LYWLDLADNQLTG +PV
Sbjct  138  LTFLALNTNNFTGSIPASLGNLSNLYWLDLADNQLTGPLPV  178



>ref|XP_010482271.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Camelina sativa]
Length=954

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 119/167 (71%), Gaps = 2/167 (1%)
 Frame = +1

Query  124  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS-RVVSLTLS  300
            +Q   + A  D +D  A++ L+  W  +  SW +GSDPCG+HW G+ CN + RVVS+ LS
Sbjct  16   VQVCSVSAIPDGSDSSALQVLKSEWTALSKSW-KGSDPCGNHWVGITCNNNNRVVSIMLS  74

Query  301  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  480
            +++L G L  DI  LSEL+ILDLSYN  L+G+LP  IGNLK L +LIL+GCGF G IP+S
Sbjct  75   NLNLKGNLPADISTLSELEILDLSYNTGLSGALPSSIGNLKNLKSLILMGCGFSGQIPES  134

Query  481  IGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            IGSL KL  LSLN N F G IP S+G+LSELYW D+ DNQ+ G IPV
Sbjct  135  IGSLEKLTTLSLNSNHFSGTIPASIGRLSELYWFDITDNQIEGKIPV  181



>dbj|BAA98164.1| receptor protein kinase-like [Arabidopsis thaliana]
Length=941

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 121/173 (70%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            LLL+  F Q   + A T+  D  A+ AL+  W   P  W EGSDPCG +W G+ C   RV
Sbjct  9    LLLILFFFQICSVSALTNGLDASALNALKSEWTTPPDGW-EGSDPCGTNWVGITCQNDRV  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            VS++L ++DL G+L  DI  LSEL+ILDLSYN  L+G LP  IGNL KL NLILVGC F 
Sbjct  68   VSISLGNLDLEGKLPADISFLSELRILDLSYNPKLSGPLPPNIGNLGKLRNLILVGCSFS  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP+SIG+L +L YLSLNLNKF G IP S+G LS+LYW D+ADNQ+ G +PV
Sbjct  128  GQIPESIGTLKELIYLSLNLNKFSGTIPPSIGLLSKLYWFDIADNQIEGELPV  180



>ref|XP_010482272.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Camelina sativa]
Length=953

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 119/167 (71%), Gaps = 2/167 (1%)
 Frame = +1

Query  124  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS-RVVSLTLS  300
            +Q   + A  D +D  A++ L+  W  +  SW +GSDPCG+HW G+ CN + RVVS+ LS
Sbjct  16   VQVCSVSAIPDGSDSSALQVLKSEWTALSKSW-KGSDPCGNHWVGITCNNNNRVVSIMLS  74

Query  301  SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS  480
            +++L G L  DI  LSEL+ILDLSYN  L+G+LP  IGNLK L +LIL+GCGF G IP+S
Sbjct  75   NLNLKGNLPADISTLSELEILDLSYNTGLSGALPSSIGNLKNLKSLILMGCGFSGQIPES  134

Query  481  IGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            IGSL KL  LSLN N F G IP S+G+LSELYW D+ DNQ+ G IPV
Sbjct  135  IGSLEKLTTLSLNSNHFSGTIPASIGRLSELYWFDITDNQIEGKIPV  181



>ref|XP_009417852.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Musa acuminata subsp. malaccensis]
Length=928

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 112/157 (71%), Gaps = 0/157 (0%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            T+  D  A+++L   W+N PP+W +  DPCG  WEG+GC+ SRV  L LS+M + G LSG
Sbjct  22   TNPQDAAALRSLMSQWQNTPPNWGKSDDPCGTPWEGIGCSNSRVTVLRLSTMGIKGTLSG  81

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI +L EL+ LDLSYN +L G LP  I NL+K+  LIL GC F G IPD +GSL  L YL
Sbjct  82   DIGQLGELKTLDLSYNSELGGPLPPNIANLRKITTLILAGCSFSGNIPDELGSLVNLSYL  141

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LN N+F G IP SLG+LS LYW D+ADNQL+GS+P+
Sbjct  142  ALNSNQFTGSIPASLGKLSNLYWFDVADNQLSGSLPI  178



>ref|XP_009417851.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Musa acuminata subsp. malaccensis]
Length=933

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 112/157 (71%), Gaps = 0/157 (0%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            T+  D  A+++L   W+N PP+W +  DPCG  WEG+GC+ SRV  L LS+M + G LSG
Sbjct  22   TNPQDAAALRSLMSQWQNTPPNWGKSDDPCGTPWEGIGCSNSRVTVLRLSTMGIKGTLSG  81

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI +L EL+ LDLSYN +L G LP  I NL+K+  LIL GC F G IPD +GSL  L YL
Sbjct  82   DIGQLGELKTLDLSYNSELGGPLPPNIANLRKITTLILAGCSFSGNIPDELGSLVNLSYL  141

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LN N+F G IP SLG+LS LYW D+ADNQL+GS+P+
Sbjct  142  ALNSNQFTGSIPASLGKLSNLYWFDVADNQLSGSLPI  178



>ref|XP_007206754.1| hypothetical protein PRUPE_ppa025198mg [Prunus persica]
 gb|EMJ07953.1| hypothetical protein PRUPE_ppa025198mg [Prunus persica]
Length=416

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 115/161 (71%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            I + TD ND   + +L++ W+N PPSW + +DPC   WEGV CN SRV  L LS++ L G
Sbjct  21   ISSVTDPNDAAVLLSLKNSWQNTPPSWDKSNDPCDSRWEGVTCNNSRVSGLGLSNISLKG  80

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            +L GDI  L EL+ LDLS+N  LTG L   +GNLK L  LIL GC F G IPD +G+L++
Sbjct  81   KLYGDIGGLIELKSLDLSFNPGLTGPLSPRLGNLKNLSILILAGCSFNGEIPDELGNLAE  140

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +L+LN N F G IP SLG+LS+LYWLDLADNQLTG+IP+
Sbjct  141  LSFLALNSNNFSGVIPPSLGKLSKLYWLDLADNQLTGTIPI  181



>ref|XP_006651341.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like, partial [Oryza brachyantha]
Length=964

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 115/158 (73%), Gaps = 1/158 (1%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WEGVGCNGSRVVSLTLSSMDLTGELS  327
            TD+ D   ++AL D W+N PP+W +  DPCGD  W+GV C+ SRV+S+ +S+M + G L+
Sbjct  18   TDSQDTSVLRALMDQWQNAPPTWGQSDDPCGDAPWDGVVCSNSRVISIKISTMGIKGVLA  77

Query  328  GDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklky  507
             DI +L+ELQ LDLS+NKDL G L   IGNLK+L  LIL GC F G IPD +G+L KL Y
Sbjct  78   ADIGQLTELQSLDLSFNKDLGGVLTPNIGNLKQLTTLILAGCSFHGTIPDELGTLPKLSY  137

Query  508  lslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            ++LN N+F G IP SLG LS LYW D+ADNQLTG +P+
Sbjct  138  MALNSNQFSGKIPASLGNLSNLYWFDIADNQLTGPLPI  175



>ref|XP_009417849.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Musa acuminata subsp. malaccensis]
Length=958

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 112/157 (71%), Gaps = 0/157 (0%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            T+  D  A+++L   W+N PP+W +  DPCG  WEG+GC+ SRV  L LS+M + G LSG
Sbjct  22   TNPQDAAALRSLMSQWQNTPPNWGKSDDPCGTPWEGIGCSNSRVTVLRLSTMGIKGTLSG  81

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI +L EL+ LDLSYN +L G LP  I NL+K+  LIL GC F G IPD +GSL  L YL
Sbjct  82   DIGQLGELKTLDLSYNSELGGPLPPNIANLRKITTLILAGCSFSGNIPDELGSLVNLSYL  141

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LN N+F G IP SLG+LS LYW D+ADNQL+GS+P+
Sbjct  142  ALNSNQFTGSIPASLGKLSNLYWFDVADNQLSGSLPI  178



>gb|KHG12756.1| hypothetical protein F383_03913 [Gossypium arboreum]
 gb|KHG27402.1| hypothetical protein F383_16446 [Gossypium arboreum]
Length=959

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 119/173 (69%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            L L+ + I    + A TD +D  +++A+   WKNVP +W  G DPC D W G+GC GSRV
Sbjct  7    LFLLVVSIHIYIVTAETDPDDNSSLRAVMSEWKNVPSNWGRG-DPCDDKWVGIGCTGSRV  65

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
             S+ L +M L G L GDI  LSEL+ LDLSYNK L G LP  + NLKKL NLILVGCGF 
Sbjct  66   TSINLPNMKLEGGLVGDIFFLSELKELDLSYNKGLRGILPPAVQNLKKLENLILVGCGFS  125

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IPD+IGSL +L+ LSLN N F G IP S+G LS L WLD+ADNQL G IPV
Sbjct  126  GQIPDTIGSLPQLRILSLNSNAFSGNIPPSIGNLSTLNWLDMADNQLEGEIPV  178



>ref|XP_009365989.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Pyrus x bretschneideri]
Length=962

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 117/161 (73%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            IV+ TD ND   +++L+  W+N PPSW + +DPCG  WEGV CNGSRV +L LSS  L G
Sbjct  21   IVSLTDLNDAAVLQSLKGAWQNTPPSWDKSNDPCGLRWEGVTCNGSRVSALALSSTGLKG  80

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            EL+GDI  L+EL+ +DLS+N  LTGSL   +G+LKKL  ++L GC F G IPD +G+L++
Sbjct  81   ELTGDIGGLTELRSMDLSFNPGLTGSLSPRLGDLKKLNVMVLAGCSFSGNIPDELGNLAE  140

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +L+LN N   G IP  LG+LS LYWLDLA NQL+G IP+
Sbjct  141  LTFLALNSNNLTGVIPHPLGKLSNLYWLDLAKNQLSGPIPI  181



>ref|XP_004960772.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Setaria italica]
Length=962

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 119/173 (69%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            L L  + +Q   I+A TD  D   + A+   WKN P +W  G DPC D W G+ C G+RV
Sbjct  8    LFLFSVLVQTSAILADTDPGDSAGLTAIAANWKNKPSNW-NGDDPCRDKWIGIICTGNRV  66

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
             S+ LSS  L+G LSGDI+ L+EL  LDLSYNKDL+G LP  IG+L  L NLILVGC F 
Sbjct  67   TSIRLSSFGLSGTLSGDIQTLTELVYLDLSYNKDLSGPLPSTIGSLSNLQNLILVGCSFS  126

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP  +G LSKL +LSLN NKF G IP SLG LS+LYW DLADN+LTG++P+
Sbjct  127  GEIPKELGQLSKLIFLSLNSNKFSGSIPASLGNLSKLYWFDLADNKLTGTLPI  179



>ref|XP_003535032.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Glycine max]
Length=945

 Score =   167 bits (424),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 123/160 (77%), Gaps = 2/160 (1%)
 Frame = +1

Query  142  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE  321
            VA   N+D++ +K+LR  W +  P+W EGSDPC D WEG+ C  SRV+S++L  + LTG 
Sbjct  22   VAQDVNSDFLVLKSLRGSWLSPTPNW-EGSDPCKD-WEGIKCKNSRVISISLPDIGLTGH  79

Query  322  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  501
            LSGDI  LSEL+ILDLSYN+ LTGSLP+EIGNLKKL  L+LVGCGF G IPD IG L +L
Sbjct  80   LSGDIGSLSELEILDLSYNRGLTGSLPQEIGNLKKLLKLVLVGCGFTGRIPDEIGFLEQL  139

Query  502  kylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             +LSLN N F+GPIP S+G LS L WLDLADNQL GSIPV
Sbjct  140  VFLSLNSNNFVGPIPPSIGNLSNLTWLDLADNQLDGSIPV  179



>ref|XP_009365988.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Pyrus x bretschneideri]
Length=959

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 114/161 (71%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            I + T  +D  A+++LR  W NVPPSW + +DPCG+ WEG+ C+GSRV +L LS M++ G
Sbjct  18   ISSSTHPDDANALQSLRQTWTNVPPSWDKSNDPCGERWEGITCSGSRVTALGLSGMNVKG  77

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
             + GDI  LS+L  LDLS+NK LTGSL   +G+L  L  LIL GC F G+IP  +G L +
Sbjct  78   TIEGDIAGLSKLISLDLSFNKGLTGSLSPRLGDLSNLNTLILAGCNFSGIIPSELGKLGE  137

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +L+LN N F G IP SLG LS LYWLDLADNQLTG +PV
Sbjct  138  LTFLALNTNNFTGSIPASLGNLSNLYWLDLADNQLTGPLPV  178



>ref|XP_010930467.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=970

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = +1

Query  145  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  324
            A TD  D  A+ +L   W+N P +W  GSDPCGD+W G+ CN S V+++TLSS+ L G L
Sbjct  37   AETDPQDADALISLASSWENPPSNWI-GSDPCGDNWVGISCNNSHVIAITLSSLGLIGTL  95

Query  325  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  504
            SGDI+ L+EL+ LDLSYNK LTG +P  IG+L KL NL+LV C F G IP  IG+L +L 
Sbjct  96   SGDIQSLNELRALDLSYNKGLTGGIPASIGSLSKLINLVLVDCSFSGEIPREIGNLPRLV  155

Query  505  ylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +L+LN N F G IP +LG LS+LYWLDLADN+LTG+IPV
Sbjct  156  FLALNSNSFTGTIPETLGNLSKLYWLDLADNKLTGTIPV  194



>emb|CDP16125.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            + +FTD  D   +++++  WKN+PPSW   +DPCG  WEGV C+ SRV +L LSSM L+G
Sbjct  20   VFSFTDPQDATVLQSIKQQWKNLPPSWNNSNDPCGTPWEGVTCSNSRVKALALSSMRLSG  79

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            +L  DI  L+EL  LDLS N DLTGS+   +G+L+KL  LIL GCG  G IP  +G+L++
Sbjct  80   KLGDDIGGLTELTSLDLSSNPDLTGSVSSRLGDLRKLNVLILAGCGLSGTIPSELGNLAQ  139

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +L+LN N F G IP SLG L+ LYWLDL++N+L+GSIPV
Sbjct  140  LSFLALNSNNFTGEIPASLGNLTNLYWLDLSNNRLSGSIPV  180



>ref|XP_007208371.1| hypothetical protein PRUPE_ppa000921mg [Prunus persica]
 gb|EMJ09570.1| hypothetical protein PRUPE_ppa000921mg [Prunus persica]
Length=961

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 121/173 (70%), Gaps = 6/173 (3%)
 Frame = +1

Query  118  LFIQFLG-----IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            LF+ F       I + TD  D     +L+  W N+PPSW + +DPCG  WEGV CN SRV
Sbjct  8    LFLAFCSAGIHMIFSETDPGDAAVFISLKGAWTNLPPSW-KSNDPCGMSWEGVTCNNSRV  66

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
             +L LS+MDL G + GDI  LSEL+ LDLS+NK LTGSL   +G+L KL  LIL GCGF 
Sbjct  67   TALGLSAMDLKGHIEGDIGGLSELRSLDLSFNKGLTGSLSPRLGDLSKLNILILAGCGFS  126

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IPD +G+L +L +L+LN N F G IP SLG+LS+L+WLDLADNQLTG++P+
Sbjct  127  GNIPDELGNLGELTFLALNTNNFTGKIPPSLGKLSKLFWLDLADNQLTGTLPI  179



>ref|XP_011012972.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Populus euphratica]
Length=979

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 124/179 (69%), Gaps = 11/179 (6%)
 Frame = +1

Query  118  LFIQFLG-----IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            LF+ F       I + TD +D  A+++L+  W+N PPSW +  DPCG  WEGV C+ SR+
Sbjct  12   LFLTFFTSGIHLIFSDTDPSDAAALQSLKRQWQNTPPSWGQSPDPCGAPWEGVTCSNSRI  71

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
             +L LS+M+L G+LSGDI  L+EL+ LDLS+N +LTGSL   +G+L KL  LIL GCGF 
Sbjct  72   TALGLSTMNLKGKLSGDIGGLTELRSLDLSFNTNLTGSLTPRLGDLLKLNILILAGCGFS  131

Query  463  GLIPDSIGs------lsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IPD +G+       + L++ +LN N F G IP SLG+LS+LYWLDLADNQLTG IP+
Sbjct  132  GSIPDELGNLAELSFFTTLRHRALNSNNFSGGIPPSLGKLSKLYWLDLADNQLTGPIPI  190



>ref|XP_011012970.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Populus euphratica]
Length=984

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 124/179 (69%), Gaps = 11/179 (6%)
 Frame = +1

Query  118  LFIQFLG-----IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            LF+ F       I + TD +D  A+++L+  W+N PPSW +  DPCG  WEGV C+ SR+
Sbjct  12   LFLTFFTSGIHLIFSDTDPSDAAALQSLKRQWQNTPPSWGQSPDPCGAPWEGVTCSNSRI  71

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
             +L LS+M+L G+LSGDI  L+EL+ LDLS+N +LTGSL   +G+L KL  LIL GCGF 
Sbjct  72   TALGLSTMNLKGKLSGDIGGLTELRSLDLSFNTNLTGSLTPRLGDLLKLNILILAGCGFS  131

Query  463  GLIPDSIGs------lsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IPD +G+       + L++ +LN N F G IP SLG+LS+LYWLDLADNQLTG IP+
Sbjct  132  GSIPDELGNLAELSFFTTLRHRALNSNNFSGGIPPSLGKLSKLYWLDLADNQLTGPIPI  190



>ref|XP_007208107.1| hypothetical protein PRUPE_ppa000924mg [Prunus persica]
 gb|EMJ09306.1| hypothetical protein PRUPE_ppa000924mg [Prunus persica]
Length=960

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 125/174 (72%), Gaps = 6/174 (3%)
 Frame = +1

Query  118  LFIQFLG-----IVAFTDNNDYVAIKALRDGWKNVPPSWAEGS-DPCGDHWEGVGCNGSR  279
            LF+ F       I + T++ D     +L++ W ++PPSW + S DPCG +WEGV CN SR
Sbjct  8    LFLAFCSAGIHVIFSETNSRDAAVFISLKEAWTDLPPSWNDKSNDPCGMNWEGVKCNNSR  67

Query  280  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  459
            V +L LS+MDL G++ GDI  LSEL+ LDLS+NK LTGSL   +G+L KL  LIL GCGF
Sbjct  68   VTALGLSAMDLKGQIEGDIGGLSELRSLDLSFNKGLTGSLSPRLGDLSKLNILILAGCGF  127

Query  460  FGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             G IP+ +G+L +L +L+LN NKF G IP SLG+LS+LYWLDL DNQLTG++P+
Sbjct  128  SGNIPEELGNLGELTFLALNTNKFTGQIPPSLGKLSKLYWLDLVDNQLTGTLPI  181



>gb|EYU39493.1| hypothetical protein MIMGU_mgv1a025586mg [Erythranthe guttata]
Length=950

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 124/183 (68%), Gaps = 5/183 (3%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFL---GIVAFTDNNDYVAIKALRDGWKNVPPSW-AEGSDPCGDHW  252
            M  + QLL   + +  L    + A TD+ D   +++L+D W NVPPSW   G DPC   W
Sbjct  1    MAEKRQLLFCYMLVFSLWSCIVYAVTDSQDAAVLRSLKDQWGNVPPSWDTSGGDPCAS-W  59

Query  253  EGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY  432
            EGV CN SRV +L LS+M LTG +SGDI  LSEL  LDLS+N+ LTGSL   +G+L+KL 
Sbjct  60   EGVVCNNSRVTTLGLSTMGLTGTMSGDIGGLSELISLDLSFNRGLTGSLSPRLGDLRKLT  119

Query  433  NLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGS  612
             LIL GC F   IP  +G+LS+L +L+LN N+  G IP SLGQLS LYWLDLADNQLTG 
Sbjct  120  VLILAGCSFTNSIPTELGNLSELTFLALNSNQLSGEIPASLGQLSNLYWLDLADNQLTGQ  179

Query  613  IPV  621
            IPV
Sbjct  180  IPV  182



>ref|XP_003593681.1| Somatic embryogenesis receptor-like kinase [Medicago truncatula]
 gb|AES63932.1| LRR receptor-like kinase [Medicago truncatula]
Length=934

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 113/166 (68%), Gaps = 1/166 (1%)
 Frame = +1

Query  124  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSS  303
             Q L + + TD  D+ A+ +L   W N P +W  GSDPCG +W G+GC+ SR+  L L  
Sbjct  16   FQVLHVASQTDRGDFTALSSLTQSWNNRPSNWV-GSDPCGSNWAGIGCDNSRITELKLLG  74

Query  304  MDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSI  483
            + L G+LS  I+ LSEL+ LDLS N  +TG++PREIGNLK L +L LVGCGF G IPDSI
Sbjct  75   LSLEGQLSSAIQSLSELETLDLSSNTGMTGTIPREIGNLKNLNSLALVGCGFSGPIPDSI  134

Query  484  GslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            GSL KL +L+LN N F G IP SLG LS L WLDL  NQL G IPV
Sbjct  135  GSLKKLTFLALNSNNFTGNIPHSLGNLSNLDWLDLDQNQLEGPIPV  180



>ref|XP_004485853.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Cicer arietinum]
Length=934

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 112/160 (70%), Gaps = 1/160 (1%)
 Frame = +1

Query  142  VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE  321
             A TD+ D+ A+ +L   WKN P  W  GSDPCG  W+G+ C  SR+  L L  ++L G+
Sbjct  22   AAQTDSGDFTALSSLIQSWKNKPSDWV-GSDPCGSDWDGIRCTNSRITELKLPGLNLVGQ  80

Query  322  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  501
            LS  I+ LSEL  LDLSYN  +TG++PREIGNLK L +L LVGCGF G IPDSIGSL KL
Sbjct  81   LSSAIQSLSELDTLDLSYNTGITGTIPREIGNLKNLNSLALVGCGFIGPIPDSIGSLKKL  140

Query  502  kylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             +L+LN NK  G IP SLG LS L WLDLADNQL G IPV
Sbjct  141  TFLALNSNKLNGNIPRSLGNLSNLDWLDLADNQLEGPIPV  180



>ref|XP_002269419.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Vitis vinifera]
Length=944

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 129/178 (72%), Gaps = 8/178 (4%)
 Frame = +1

Query  100  QLLLVPL---FIQFLGIV-AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGC  267
            +L+LV L   FIQF     A T+ +D  A+K+L    KN+P +W  G+DPC + WEG+GC
Sbjct  4    RLILVSLLIVFIQFNSATWASTNTDDATALKSL---LKNLPFTWV-GADPCVNGWEGIGC  59

Query  268  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV  447
            +  RV+S+TL+SMDL GELS D + LSEL+ILDLSYNK LTG++P  IG+LK L NLIL+
Sbjct  60   SNGRVISITLASMDLKGELSEDFQGLSELKILDLSYNKGLTGNIPASIGSLKSLTNLILM  119

Query  448  GCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            GC F G IPD+IGSL+ L  LSLN N F G IP S+G L  L WLD+ +NQ+TG+IP+
Sbjct  120  GCSFSGQIPDTIGSLTNLVVLSLNSNSFSGVIPPSIGNLYNLNWLDITENQITGTIPI  177



>ref|XP_010484994.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770, partial [Camelina sativa]
Length=846

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 122/173 (71%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +LL+ LF     + A T+  D  A+  L+  W + P  W EGSDPCG +W G+ C   RV
Sbjct  9    MLLILLFFHICSVSALTNTLDSSALSGLKSEWTSSPDGW-EGSDPCGTNWVGIKCRNDRV  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            +S++L +++L G+L  DI  LSEL+ILDLSYN  L+G LP  IGNLK L +LILVGC F 
Sbjct  68   ISISLGNLNLEGKLPADISFLSELEILDLSYNTGLSGPLPPNIGNLKNLKSLILVGCSFS  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP+SIGSL +L YLSLNLNKF G IP S+G+LS+LYW D+ADNQ+ G +PV
Sbjct  128  GEIPESIGSLKELIYLSLNLNKFSGTIPASIGRLSKLYWFDIADNQIEGELPV  180



>emb|CDM81501.1| unnamed protein product [Triticum aestivum]
Length=957

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 118/173 (68%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            L+L  + +Q   I+A T+  D   +  +   W   P +W +G+DPCGD W G+ C   RV
Sbjct  7    LILFGVLVQASVILADTNAQDTAGLTGIAASWDTKPSNW-DGNDPCGDKWIGIICTQDRV  65

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
             S+ LSS  L+G LSGDI+ LSELQ LDLSYNKDL GSLP  IG+L  L NLILVGC F 
Sbjct  66   TSIRLSSQSLSGTLSGDIQSLSELQYLDLSYNKDLGGSLPSSIGSLSNLQNLILVGCSFA  125

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP  IG LSKL +LSLN N+F G IP SLG LS+LYW DLADN+LTG +PV
Sbjct  126  GEIPKEIGQLSKLIFLSLNSNRFTGRIPPSLGGLSKLYWFDLADNKLTGGLPV  178



>emb|CDM81495.1| unnamed protein product [Triticum aestivum]
Length=957

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 118/173 (68%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            L+L  + +Q   I+A T+  D   +  +   W   P +W +G+DPCGD W G+ C   RV
Sbjct  7    LILFGVLVQASVILADTNAQDTAGLTGIAASWDTKPSNW-DGNDPCGDKWIGIICTQDRV  65

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
             S+ LSS  L+G LSGDI+ LSELQ LDLSYNKDL GSLP  IG+L  L NLILVGC F 
Sbjct  66   TSIRLSSQSLSGTLSGDIQSLSELQYLDLSYNKDLGGSLPSSIGSLSNLQNLILVGCSFA  125

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP  IG LSKL +LSLN N+F G IP SLG LS+LYW DLADN+LTG +PV
Sbjct  126  GEIPKEIGQLSKLIFLSLNSNRFTGRIPPSLGGLSKLYWFDLADNKLTGGLPV  178



>ref|XP_009387702.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=961

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 112/157 (71%), Gaps = 0/157 (0%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            TD ND   ++++ + W+N PP+W +  DPCG  WEGV C+ +RV +L LS+M + G L+G
Sbjct  23   TDPNDAAVLRSMLNQWENAPPTWGQSDDPCGTPWEGVSCDSTRVTALRLSTMGIKGTLNG  82

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            D+ +L++LQ LDLSYN  L+G L   IGNLK+L   IL GC F G IP  +G+L  L +L
Sbjct  83   DVGQLTQLQSLDLSYNGGLSGPLSASIGNLKQLTTFILAGCSFSGSIPQELGNLKLLSFL  142

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LN NKF G IP SLG LS LYWLDLADNQLTGS+P+
Sbjct  143  ALNSNKFSGRIPASLGLLSNLYWLDLADNQLTGSLPI  179



>gb|KHN40214.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=871

 Score =   164 bits (416),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 124/181 (69%), Gaps = 4/181 (2%)
 Frame = +1

Query  82   TMIPRIQLLLVPLFIQFLGI-VAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  258
             M+P   L+L+  +I  + + VA T+N+D+ A+ +L   W+N P +W    DPC D W+G
Sbjct  21   AMLP---LMLILNYIMLVSVAVAQTNNDDFTALVSLTSTWQNKPLNWKGSPDPCNDGWDG  77

Query  259  VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL  438
            + C  S V S+ L+ +D+ GELS DI  LSEL+ LDLS+NK LTGSLP  IGNL KL NL
Sbjct  78   IKCINSHVTSIRLTGLDIKGELSEDIGLLSELETLDLSHNKGLTGSLPHSIGNLTKLSNL  137

Query  439  ILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIP  618
             LV CGF G IPD IGSL +L +LSLN N F G IP S+G L +L WLD+ADNQL G+IP
Sbjct  138  FLVDCGFTGPIPDEIGSLKELVFLSLNSNSFSGGIPASIGNLPKLNWLDIADNQLEGTIP  197

Query  619  V  621
            +
Sbjct  198  I  198



>emb|CDY21452.1| BnaC03g27450D [Brassica napus]
Length=953

 Score =   165 bits (417),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 117/161 (73%), Gaps = 1/161 (1%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            + A T+  D  A++AL+  W   P SW EG DPCG  W G+ C   RVVS++L ++++ G
Sbjct  21   VSALTNGFDGAALQALKAEWTKPPSSW-EGDDPCGTSWVGITCISDRVVSISLGNLNVEG  79

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            +LSGDI  LSELQILDLSYN  LTG LP  IG  KKL NLILVGC F G IP+SIG L +
Sbjct  80   KLSGDIAALSELQILDLSYNTGLTGPLPPNIGEAKKLKNLILVGCSFTGQIPESIGKLEQ  139

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L YLSLNLN+F G IP S+G+LS+LYW D+ADNQ+ G++PV
Sbjct  140  LIYLSLNLNQFSGTIPVSIGRLSKLYWFDIADNQIEGTLPV  180



>ref|XP_008782792.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
Length=914

 Score =   164 bits (416),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = +1

Query  169  VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELS  348
             A+++L + WKN PP+W +  DPCG  WEGV CN SRV  L L SM L G LS DI+ L+
Sbjct  3    AALRSLANQWKNTPPNWGQSDDPCGTPWEGVTCNNSRVTVLKLFSMGLEGTLSSDIQNLT  62

Query  349  ELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnk  528
            +LQILDLSYN+ L G+LPR IGNL +L +LILV C F G IP+ +G+LS+L +L+LNLN+
Sbjct  63   QLQILDLSYNQKLGGTLPRAIGNLTQLTSLILVHCSFNGSIPEELGNLSELTFLALNLNE  122

Query  529  FIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            F G IP SLG+LS+L +LDLA+N L GS+PV
Sbjct  123  FTGEIPASLGRLSKLNYLDLAENHLVGSLPV  153



>ref|NP_001242669.1| probable leucine-rich repeat receptor-like protein kinase At5g49770-like 
precursor [Glycine max]
 gb|ACM89577.1| leucine-rich repeat family protein / protein kinase family protein 
[Glycine max]
Length=723

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 114/157 (73%), Gaps = 1/157 (1%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            TD+ DY  + +L + W N P +W  G DPCG  W+G+ C+ S++  L L  ++L G+LS 
Sbjct  24   TDSQDYSGLNSLTESWSNKPQNWV-GPDPCGSGWDGIRCSNSKITQLRLPGLNLAGQLSS  82

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
             I+ LSEL  LDLSYN  LTG++P+EIGNLKKL +L LVGCGF G IPDSIGSL +L +L
Sbjct  83   AIQSLSELDTLDLSYNTGLTGTIPQEIGNLKKLKSLSLVGCGFSGPIPDSIGSLKQLTFL  142

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LN N+F G IP SLG LS + WLDLA+NQL G+IPV
Sbjct  143  ALNSNRFSGTIPRSLGNLSNIDWLDLAENQLEGTIPV  179



>dbj|BAJ89467.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=957

 Score =   164 bits (416),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 118/173 (68%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            L+L  + +Q   ++A T+  D   +  +   W   P +W +G+DPCGD W G+ C   RV
Sbjct  7    LVLFGILVQASVVLADTNAQDTAGLTGIAASWDTRPSNW-DGNDPCGDKWIGIICTQDRV  65

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
             S+ LSS  L+G LSGDI+ LSELQ LDLSYNKDL GSLP  IG+L  L NLILVGC F 
Sbjct  66   TSIRLSSQSLSGTLSGDIQSLSELQYLDLSYNKDLGGSLPSSIGSLSNLQNLILVGCSFA  125

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP  IG LSKL +LSLN N+F G IP SLG LS+LYW DLADN+LTG +P+
Sbjct  126  GEIPKEIGQLSKLIFLSLNSNRFTGRIPPSLGGLSKLYWFDLADNKLTGGLPI  178



>dbj|BAJ94480.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=957

 Score =   164 bits (416),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 118/173 (68%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            L+L  + +Q   ++A T+  D   +  +   W   P +W +G+DPCGD W G+ C   RV
Sbjct  7    LVLFGILVQASVVLADTNAQDTAGLTGIAASWDTRPSNW-DGNDPCGDKWIGIICTQDRV  65

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
             S+ LSS  L+G LSGDI+ LSELQ LDLSYNKDL GSLP  IG+L  L NLILVGC F 
Sbjct  66   TSIRLSSQSLSGTLSGDIQSLSELQYLDLSYNKDLGGSLPSSIGSLSNLQNLILVGCSFA  125

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP  IG LSKL +LSLN N+F G IP SLG LS+LYW DLADN+LTG +P+
Sbjct  126  GEIPKEIGQLSKLIFLSLNSNRFTGRIPPSLGGLSKLYWFDLADNKLTGGLPI  178



>ref|NP_199786.2| Leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
 gb|AED95853.1| Leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
Length=493

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 125/182 (69%), Gaps = 3/182 (2%)
 Frame = +1

Query  82   TMIPRIQ--LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWE  255
            TM  RI+  +LL+  F Q   + A T+  D  A++ +++ W   P  W EGSDPCG +W 
Sbjct  57   TMSSRIRTCMLLILFFFQKCYVSALTNVFDASALRGMKNEWTRSPKGW-EGSDPCGTNWV  115

Query  256  GVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN  435
            G+ C   RVVS++L + +L G LS  I  LSEL+ILDLS+N  LTG LP  IG+LKKL N
Sbjct  116  GITCTNDRVVSISLVNHNLEGTLSEYILALSELEILDLSFNIGLTGPLPSNIGDLKKLKN  175

Query  436  LILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSI  615
            LILVGCG  G IPDSIGSL ++  LSLNLNKF G IP S+G+LS+L W D+A+NQ+ G +
Sbjct  176  LILVGCGLSGQIPDSIGSLEQIINLSLNLNKFSGTIPASIGRLSKLDWFDIAENQIEGEL  235

Query  616  PV  621
            P+
Sbjct  236  PI  237



>gb|EYU33251.1| hypothetical protein MIMGU_mgv1a021972mg, partial [Erythranthe 
guttata]
Length=945

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 120/179 (67%), Gaps = 1/179 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            M  R  + ++ + ++ L + A TD+ D  A+ A+R  W N+PP+W  G DPCG++W+G+ 
Sbjct  12   MSSRFVVCVLLVSVRILDVSALTDSGDLAALNAIRSSWTNLPPNWI-GPDPCGNNWDGIS  70

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            C  +RV SL L+ MD+ G    DI  L+ L  LDLS N  L G LP  IGNLK L  LIL
Sbjct  71   CTATRVTSLMLAGMDVQGSQFSDISSLTGLTFLDLSNNIGLKGILPPSIGNLKNLSTLIL  130

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            VGC FFG IPDSIGSL +L Y+SLN N F GPIP S+G LS+L WLDL+ N+L GSIPV
Sbjct  131  VGCSFFGPIPDSIGSLQQLIYISLNSNGFSGPIPPSIGNLSKLSWLDLSVNRLNGSIPV  189



>ref|XP_009761610.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770, partial [Nicotiana sylvestris]
Length=934

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 109/151 (72%), Gaps = 1/151 (1%)
 Frame = +1

Query  169  VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELS  348
             A+ A++  W N+PP+W EGSDPCG  WEG+ CN SRV S+ LS M L G   GD+  L+
Sbjct  15   TALFAIKSSWNNLPPNW-EGSDPCGSSWEGIICNDSRVTSIKLSGMGLEGNQFGDLSSLT  73

Query  349  ELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnk  528
             LQILDLS N  L G+LP  IGNLK L  LILVGC FFG IP+SIGSL +L ++SL  N 
Sbjct  74   ALQILDLSNNVGLKGTLPSSIGNLKNLTTLILVGCSFFGQIPESIGSLQQLVFISLTSNS  133

Query  529  FIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            F G IP S+G LS+L WLDL+DN+L+G+IPV
Sbjct  134  FTGSIPPSIGNLSKLSWLDLSDNKLSGTIPV  164



>ref|XP_009365992.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=997

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 112/161 (70%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            I + T  +D  A+++LR  W N+PPSW + +DPCG+HWEG+ CNGSRV +L LS M++ G
Sbjct  59   ISSSTHPDDANALQSLRQTWSNIPPSWDKSNDPCGEHWEGITCNGSRVTALELSGMNVKG  118

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            +  GDI  LSEL+ L LS+NK L GSL   +G+L  L  L+L GC F G IP  +G L +
Sbjct  119  KFEGDIGGLSELRSLVLSFNKGLAGSLSPRLGDLSNLNILVLAGCSFSGTIPSELGKLGE  178

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +L+LN N F G IP SLG LS LYWLDLA NQLTG +PV
Sbjct  179  LTFLALNTNSFTGSIPASLGNLSNLYWLDLAYNQLTGPLPV  219



>ref|XP_010441071.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=953

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 122/173 (71%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +LL+ LF     + A T+  D  A+  L+  W + P  W EGSDPCG +W G+ C   RV
Sbjct  9    MLLILLFFYICSVSALTNTLDSSALSGLKSEWTSSPDGW-EGSDPCGTNWVGIKCRNDRV  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            +S++L +++L G+L  DI  LSEL+ILDLSYN  L+G LP  IGNLK L +LILVGC F 
Sbjct  68   ISISLGNLNLEGKLPADISFLSELEILDLSYNTGLSGPLPPNIGNLKNLKSLILVGCSFS  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP+SIGSL +L YLSLNLNKF G IP S+G+LS+LYW D+ADNQ+ G +PV
Sbjct  128  GEIPESIGSLKELIYLSLNLNKFSGTIPASIGRLSKLYWFDIADNQIEGELPV  180



>emb|CDY12940.1| BnaA09g13340D [Brassica napus]
Length=931

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 127/182 (70%), Gaps = 4/182 (2%)
 Frame = +1

Query  85   MIPRIQ--LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  258
            M  RIQ  +LL+  F Q   + A T+  D  A++AL+  W   P +W +GSDPCG +W G
Sbjct  5    MRSRIQVCMLLILTFCQICSVSALTNGLDASALQALKSEWTRFPENW-KGSDPCGTNWVG  63

Query  259  VGCNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN  435
            + CN +  V+S++L +++L G+LS DI  L+ELQILDL+ N  L+GSLP  IGNL+KL  
Sbjct  64   ITCNNNNHVISISLGNLNLEGKLSADISSLAELQILDLTSNSKLSGSLPSNIGNLRKLTT  123

Query  436  LILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSI  615
            L L+ CGF G IP+SIGSL +L  LSLN NKF G IP S+G+LS+L W D+ADNQ+ G+I
Sbjct  124  LNLMECGFSGEIPESIGSLEQLITLSLNSNKFSGTIPASIGRLSKLNWFDIADNQIEGTI  183

Query  616  PV  621
            PV
Sbjct  184  PV  185



>ref|XP_008643850.1| PREDICTED: uncharacterized protein LOC100382229 isoform X2 [Zea 
mays]
 ref|XP_008643856.1| PREDICTED: uncharacterized protein LOC100382229 isoform X2 [Zea 
mays]
 tpg|DAA45171.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=984

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 113/158 (72%), Gaps = 1/158 (1%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WEGVGCNGSRVVSLTLSSMDLTGELS  327
            TD+ D   ++AL D W+N PPSW +  DPCG+  WEGV C G +V+S+ LS+M + G L+
Sbjct  41   TDSQDTSVLRALMDQWQNAPPSWGQSDDPCGESPWEGVTCGGDKVISIKLSTMGIQGSLA  100

Query  328  GDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklky  507
             DI +LS+LQ +DLS+N +L G L   IGNLK+L  LIL GC F G IPD +GSL KL Y
Sbjct  101  ADIGQLSDLQSMDLSFNNELGGVLTPTIGNLKQLTTLILSGCSFHGTIPDELGSLPKLSY  160

Query  508  lslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            ++LN N+F G IP SLG LS LYW D+ADNQL+G +PV
Sbjct  161  MALNSNQFSGKIPASLGNLSSLYWFDIADNQLSGPLPV  198



>ref|XP_008804684.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
Length=562

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 111/157 (71%), Gaps = 0/157 (0%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            TD  D  A+++L + W+  PPSW +  DPCG  W GV C+ SRV  L LS+M + G LSG
Sbjct  24   TDPQDAAALRSLMNQWQAAPPSWGQSDDPCGMPWNGVICSKSRVTILRLSTMGIKGTLSG  83

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI +L++LQ LDLSYN DL G L   IGNLK+L  LILVGC F G IP  +G+L++L +L
Sbjct  84   DIGQLTKLQSLDLSYNSDLGGPLTPNIGNLKELTTLILVGCNFSGTIPSELGNLAELSFL  143

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             LN N+F G IP SLG LS LYWLDLA+N+LTG +P+
Sbjct  144  DLNSNQFTGNIPASLGNLSNLYWLDLANNKLTGMLPI  180



>ref|XP_008643846.1| PREDICTED: uncharacterized protein LOC100382229 isoform X1 [Zea 
mays]
 tpg|DAA45172.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1029

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 113/158 (72%), Gaps = 1/158 (1%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WEGVGCNGSRVVSLTLSSMDLTGELS  327
            TD+ D   ++AL D W+N PPSW +  DPCG+  WEGV C G +V+S+ LS+M + G L+
Sbjct  86   TDSQDTSVLRALMDQWQNAPPSWGQSDDPCGESPWEGVTCGGDKVISIKLSTMGIQGSLA  145

Query  328  GDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklky  507
             DI +LS+LQ +DLS+N +L G L   IGNLK+L  LIL GC F G IPD +GSL KL Y
Sbjct  146  ADIGQLSDLQSMDLSFNNELGGVLTPTIGNLKQLTTLILSGCSFHGTIPDELGSLPKLSY  205

Query  508  lslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            ++LN N+F G IP SLG LS LYW D+ADNQL+G +PV
Sbjct  206  MALNSNQFSGKIPASLGNLSSLYWFDIADNQLSGPLPV  243



>gb|KHN48167.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=931

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 113/157 (72%), Gaps = 1/157 (1%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            TD+ DY  + +L + W N P +W  G DPCG  W+G+ C+ SR+  L L  ++L G+LS 
Sbjct  24   TDSQDYSGLNSLTESWSNKPQNWV-GPDPCGSGWDGIRCSNSRITQLRLPGLNLGGQLSS  82

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
             I+ LSEL  LDLSYN  LTG++P+EIGNLKKL +L LVGCGF G IPDSIGSL +L +L
Sbjct  83   AIQSLSELDTLDLSYNTGLTGTVPQEIGNLKKLKSLSLVGCGFSGRIPDSIGSLKQLTFL  142

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LN N F G IP SLG LS + WLDLA+NQL G+IPV
Sbjct  143  ALNSNNFSGTIPRSLGNLSNVDWLDLAENQLEGTIPV  179



>ref|XP_010442444.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=953

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 121/173 (70%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +LL+ LF     + A T+  D  A+  L+  W + P  W EGSDPCG +W G+ C   RV
Sbjct  9    MLLILLFFHICSVSALTNTLDSSALSGLKSEWTSSPDGW-EGSDPCGTNWVGIKCRNDRV  67

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            +S++L +++L  +L  DI  LSEL+ILDLSYN  L+G LP  IGNLK L +LILVGC F 
Sbjct  68   ISISLGNLNLEAKLPADISFLSELEILDLSYNTGLSGPLPPNIGNLKNLKSLILVGCSFS  127

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP+SIGSL +L YLSLNLNKF G IP S+G+LS+LYW D+ADNQ+ G +PV
Sbjct  128  GEIPESIGSLKELIYLSLNLNKFSGTIPASIGRLSKLYWFDIADNQIEGELPV  180



>gb|EEC75182.1| hypothetical protein OsI_11410 [Oryza sativa Indica Group]
Length=975

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 115/160 (72%), Gaps = 1/160 (1%)
 Frame = +1

Query  145  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WEGVGCNGSRVVSLTLSSMDLTGE  321
            A TD+ D   ++AL D W+N PP+W +  DPC D  W+GV C+ +RV+S+ +S+M + G 
Sbjct  32   AVTDSQDTSVLRALMDQWQNAPPTWGQSDDPCSDSPWDGVVCSNNRVISIKISTMGIKGV  91

Query  322  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  501
            L+ DI +L+ELQ LD+S+NKDL G L   IGNLK+L  LIL GC F G IPD +GSL KL
Sbjct  92   LAADIGQLTELQSLDMSFNKDLGGVLTPNIGNLKQLTTLILAGCSFHGNIPDELGSLPKL  151

Query  502  kylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             Y++LN N+F G IP S+G LS LYW D+ADNQL+G +P+
Sbjct  152  SYMALNSNQFSGKIPASMGNLSNLYWFDIADNQLSGPLPI  191



>gb|ABF95747.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 gb|EEE58993.1| hypothetical protein OsJ_10704 [Oryza sativa Japonica Group]
Length=975

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 115/160 (72%), Gaps = 1/160 (1%)
 Frame = +1

Query  145  AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WEGVGCNGSRVVSLTLSSMDLTGE  321
            A TD+ D   ++AL D W+N PP+W +  DPC D  W+GV C+ +RV+S+ +S+M + G 
Sbjct  32   AVTDSQDTSVLRALMDQWQNAPPTWGQSDDPCSDSPWDGVVCSNNRVISIKISTMGIKGV  91

Query  322  LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslskl  501
            L+ DI +L+ELQ LD+S+NKDL G L   IGNLK+L  LIL GC F G IPD +GSL KL
Sbjct  92   LAADIGQLTELQSLDMSFNKDLGGVLTPNIGNLKQLTTLILAGCSFHGNIPDELGSLPKL  151

Query  502  kylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             Y++LN N+F G IP S+G LS LYW D+ADNQL+G +P+
Sbjct  152  SYMALNSNQFSGKIPASMGNLSNLYWFDIADNQLSGPLPI  191



>ref|XP_006588460.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Glycine max]
 gb|KHN32231.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=932

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 114/157 (73%), Gaps = 1/157 (1%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            TD+ DY  + +L + W N P +W  G DPCG  W+G+ C+ S++  L L  ++L G+LS 
Sbjct  24   TDSQDYSGLNSLTESWSNKPQNWV-GPDPCGSGWDGIRCSNSKITQLRLPGLNLAGQLSS  82

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
             I+ LSEL  LDLSYN  LTG++P+EIGNLKKL +L LVGCGF G IPDSIGSL +L +L
Sbjct  83   AIQSLSELDTLDLSYNTGLTGTIPQEIGNLKKLKSLSLVGCGFSGPIPDSIGSLKQLTFL  142

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LN N+F G IP SLG LS + WLDLA+NQL G+IPV
Sbjct  143  ALNSNRFSGTIPRSLGNLSNIDWLDLAENQLEGTIPV  179



>ref|XP_008804670.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
 ref|XP_008804671.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
Length=951

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 113/157 (72%), Gaps = 0/157 (0%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            TD  D  A+++L + W+  PPSW +  DPCG  W+GV C+ SRV  L LS+M + G LSG
Sbjct  13   TDPQDAAALRSLMNQWQAAPPSWGQSDDPCGMPWDGVVCSKSRVTVLRLSTMGIKGTLSG  72

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI +L++LQ LDLSYN DL G L   IGNLK+L  LILVGC F G +P  +G+L++L +L
Sbjct  73   DIGQLTKLQSLDLSYNNDLRGPLAPNIGNLKELTTLILVGCSFSGTLPSELGNLAELSFL  132

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             LN N+F G IP SLG LS LYWLDLA+N+LTG++P+
Sbjct  133  DLNSNQFTGKIPGSLGSLSNLYWLDLANNKLTGTLPI  169



>ref|XP_010922852.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=962

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 113/157 (72%), Gaps = 0/157 (0%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            TD  D  A+++L + W+  PPSW + +DPCG  W+GV C+ SRV  L LS+M + G LSG
Sbjct  24   TDQQDAAALRSLMNQWQAAPPSWGQSNDPCGVPWDGVVCSNSRVTVLRLSTMGIKGTLSG  83

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI +L++LQ LDLSYN +L G     IGNLK+L  LILVGC F G IP  +G+L++L +L
Sbjct  84   DIAQLTKLQSLDLSYNGELGGPFTPNIGNLKELTTLILVGCSFSGTIPSELGNLAELSFL  143

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             LN N+F G IP SLG LS LYWLDLA+N+LTG++P+
Sbjct  144  DLNSNQFTGNIPASLGNLSNLYWLDLANNKLTGTLPI  180



>ref|XP_006279556.1| hypothetical protein CARUB_v10025735mg [Capsella rubella]
 gb|EOA12454.1| hypothetical protein CARUB_v10025735mg [Capsella rubella]
Length=1844

 Score =   163 bits (413),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 114/159 (72%), Gaps = 1/159 (1%)
 Frame = +1

Query  145   AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL  324
             A  D     A++AL+  W   P +W EGSDPCG +W G+ C   R++S++L ++DL G+L
Sbjct  916   ATFDEASAAALQALKSEWTKFPKNW-EGSDPCGTNWVGITCTNDRIISISLGNLDLEGKL  974

Query  325   SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  504
             S DI  LSELQILDL+ N  LTG LP  IGNLKKL  L L+GCGF G IP+SIGSL +L 
Sbjct  975   SADIAALSELQILDLTSNPKLTGPLPSNIGNLKKLNALNLMGCGFSGQIPESIGSLEQLT  1034

Query  505   ylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
              LSLN NKFIG IP S+G+LS+L+W D+ADNQ+ G +PV
Sbjct  1035  TLSLNSNKFIGTIPASIGRLSKLFWFDIADNQIEGKLPV  1073


 Score =   159 bits (403),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 117/161 (73%), Gaps = 1/161 (1%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            + AFTD +D+  ++ L+  WK +   W +GSDPCG  W G+ CN +RVV+++L +++L G
Sbjct  21   VSAFTDGSDFTVLETLKGEWKTLSEKW-KGSDPCGAEWVGISCNNNRVVNISLGNLNLQG  79

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            +L  DI  L ELQILDL+ N +LTG LP  IGNLKKL  L L+GC F G IPDSIGSL +
Sbjct  80   KLHEDISNLFELQILDLTSNPNLTGQLPLNIGNLKKLTILNLMGCNFTGQIPDSIGSLEQ  139

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            LK LSLNLN F G IP S+G+LS+LYW D+ADN++ G +PV
Sbjct  140  LKTLSLNLNNFTGDIPPSIGRLSKLYWFDIADNKIEGGLPV  180



>emb|CAQ58615.1| ATP binding / kinase/ protein serine / threonine kinase [Vitis 
vinifera]
Length=946

 Score =   162 bits (410),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 120/162 (74%), Gaps = 1/162 (1%)
 Frame = +1

Query  136  GIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLT  315
            GI+ FT+++D   +++L+  W+N PPSW E SDPCG  WEG+ CN SRV++L LS+M L 
Sbjct  3    GILCFTNSDDAGVLQSLKGQWENTPPSW-EKSDPCGVPWEGITCNNSRVIALGLSTMGLK  61

Query  316  GELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGsls  495
            G+L GDI  L+EL+ LDLS+N  LTGSL  ++GNL+ L  LIL GCGF G IPD +G+L+
Sbjct  62   GKLEGDIGGLTELRSLDLSFNLGLTGSLTPKLGNLENLNILILAGCGFTGQIPDELGNLA  121

Query  496  klkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +L +L+LN N   G IP SLG+LS LYWLDLA+N+L+G  P 
Sbjct  122  QLTFLALNSNNLTGQIPPSLGRLSNLYWLDLAENKLSGPFPT  163



>ref|XP_010653092.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Vitis vinifera]
 ref|XP_010653093.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Vitis vinifera]
 ref|XP_010653094.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Vitis vinifera]
Length=961

 Score =   162 bits (410),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 120/162 (74%), Gaps = 1/162 (1%)
 Frame = +1

Query  136  GIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLT  315
            GI+ FT+++D   +++L+  W+N PPSW E SDPCG  WEG+ CN SRV++L LS+M L 
Sbjct  18   GILCFTNSDDAGVLQSLKGQWENTPPSW-EKSDPCGVPWEGITCNNSRVIALGLSTMGLK  76

Query  316  GELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGsls  495
            G+L GDI  L+EL+ LDLS+N  LTGSL  ++GNL+ L  LIL GCGF G IPD +G+L+
Sbjct  77   GKLEGDIGGLTELRSLDLSFNLGLTGSLTPKLGNLENLNILILAGCGFTGQIPDELGNLA  136

Query  496  klkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +L +L+LN N   G IP SLG+LS LYWLDLA+N+L+G  P 
Sbjct  137  QLTFLALNSNNLTGQIPPSLGRLSNLYWLDLAENKLSGPFPT  178



>ref|XP_003561670.2| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brachypodium distachyon]
Length=978

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 121/182 (66%), Gaps = 3/182 (2%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIV--AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDH-WE  255
            M PR   LL  L +     V  A T++ D   ++AL D W++ PP+W +  DPCGD  WE
Sbjct  11   MRPRAVFLLAALVLSVCLRVSHAVTNSQDTSVLRALMDQWQDAPPTWGQSDDPCGDSPWE  70

Query  256  GVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN  435
            GV C+  RV+ + +S+M + G L+ DI +LSELQ LDLS+N DL G L   IGNLK+L  
Sbjct  71   GVTCSNDRVIFIKVSTMGIKGVLAADIGQLSELQSLDLSFNHDLGGVLTPTIGNLKQLTT  130

Query  436  LILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSI  615
            LIL GC F G IPD +GS+ KL Y++LN N+F G IP SLG LS+LYW D+ADN LTG +
Sbjct  131  LILAGCSFHGNIPDELGSVPKLSYMALNSNRFSGNIPASLGNLSDLYWFDIADNLLTGPL  190

Query  616  PV  621
            P+
Sbjct  191  PI  192



>gb|EMT31021.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=943

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 113/159 (71%), Gaps = 1/159 (1%)
 Frame = +1

Query  148  FTDNNDYVAIKALRDGWKNVPPSWAEGSDPCG-DHWEGVGCNGSRVVSLTLSSMDLTGEL  324
             TD+ D   ++AL D W+N PP+W +  DPCG   W+GV C+  RV+S+ +S+M + G L
Sbjct  24   LTDSQDTSVLRALMDQWQNSPPTWGQSDDPCGVSPWDGVTCSNDRVISIKVSTMGIKGLL  83

Query  325  SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklk  504
            + DI +L+ELQ LDLS+NKDL G L   IGNLK+L  LIL GC F G IPD +GSL KL 
Sbjct  84   AADIGQLTELQSLDLSFNKDLGGVLTPTIGNLKQLATLILAGCSFHGNIPDELGSLPKLS  143

Query  505  ylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            Y++LN N+F G IP SLG LS LYW D+ADNQLTG +P+
Sbjct  144  YMALNSNQFSGKIPASLGNLSSLYWFDVADNQLTGPLPI  182



>ref|XP_002311479.2| hypothetical protein POPTR_0008s12450g, partial [Populus trichocarpa]
 gb|EEE88846.2| hypothetical protein POPTR_0008s12450g, partial [Populus trichocarpa]
Length=433

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 111/157 (71%), Gaps = 0/157 (0%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            TD  D   +++L+  W+N PPSW +  DPCG  W GV CN SR+ SL L  M L G LS 
Sbjct  27   TDPGDAAELQSLKSHWQNTPPSWDQTDDPCGAPWVGVTCNNSRITSLKLPCMSLAGNLSD  86

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
             I  L+EL+ LDLS+N ++TGSL   +G+LK L  LIL GCGF G IPD +G+L++L +L
Sbjct  87   RIGGLTELRSLDLSFNPNVTGSLTPRLGDLKNLKILILAGCGFSGSIPDELGNLAELSFL  146

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LN N   G IP SLG+LS+LYWLDLA+NQLTG+IP+
Sbjct  147  ALNSNILSGRIPASLGKLSKLYWLDLAENQLTGTIPI  183



>ref|XP_002519985.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF42309.1| receptor protein kinase, putative [Ricinus communis]
Length=988

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 115/161 (71%), Gaps = 1/161 (1%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            I + TD  D   +++L+D W N PPSW  G DPCG  WEGV C  SRV +L LS+M L G
Sbjct  30   IFSVTDPRDAATLQSLKDSWLNTPPSWGSG-DPCGTPWEGVTCKDSRVTALGLSTMSLAG  88

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            +L+GDI  L+EL  LDLSYN +LTGSL   +G+L+ L  LIL GCGF G IP+ +G+L++
Sbjct  89   KLTGDIGGLTELISLDLSYNPELTGSLTPRLGDLRNLNILILAGCGFTGSIPNELGNLAE  148

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L +L+LN N   G IP SLG+LS +YWLDLADN+LTG IP+
Sbjct  149  LSFLALNSNNLTGIIPPSLGKLSNVYWLDLADNELTGPIPI  189



>ref|XP_011077100.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Sesamum indicum]
Length=963

 Score =   161 bits (408),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 115/166 (69%), Gaps = 1/166 (1%)
 Frame = +1

Query  124  IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSS  303
            I F  I A T+  D   +++L+D W N PPSW   +DPC   WEGV CN SRV SL LS+
Sbjct  17   ICFHVIYAETNAQDAAVLRSLKDEWGNTPPSWDRSNDPCA-AWEGVTCNNSRVTSLGLST  75

Query  304  MDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSI  483
            M LTG++SGDI  LSEL  LDLSYN  LTGSL   +G+L+KL  LIL GC F   IP  +
Sbjct  76   MGLTGKMSGDIGGLSELVSLDLSYNPGLTGSLSPRLGDLQKLTILILAGCSFTNSIPSEL  135

Query  484  GslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G+LS+L +L+LN N   G IP SLG+LS+LYWLDLADNQL G IP+
Sbjct  136  GNLSELTFLALNSNNLSGDIPPSLGKLSKLYWLDLADNQLKGQIPI  181



>ref|XP_011018905.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Populus euphratica]
Length=967

 Score =   161 bits (408),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 119/157 (76%), Gaps = 0/157 (0%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            TD  D  A+++L+  W+N PPSW +  DPCG  WEGV C+ SR+ +L LS+M+L G+LSG
Sbjct  28   TDPRDAAALRSLKSQWQNTPPSWGQSDDPCGAPWEGVTCSNSRITALGLSTMNLVGKLSG  87

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI  L+EL+ LDLS+N +LTG L   +G+L  L  LIL GCGF G IPD +G+L+KL +L
Sbjct  88   DIGGLAELRSLDLSFNSNLTGPLSPRLGDLLNLNILILAGCGFSGSIPDELGNLAKLSFL  147

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LN NKF G IP SLG+LS+LYWLDLADNQLTG+IP+
Sbjct  148  ALNSNKFSGGIPPSLGKLSKLYWLDLADNQLTGTIPI  184



>ref|XP_009391655.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=960

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 110/157 (70%), Gaps = 0/157 (0%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            TD  D  A+ +L   W+N PPSW +  DPCG  WEGV C+ SRV SLTLS+M + G L  
Sbjct  22   TDAQDAAALLSLMTQWQNTPPSWGKTDDPCGTPWEGVRCSNSRVTSLTLSTMGIKGTLGD  81

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI +LSEL+ILDLSYN  L G+L   IGNL +L  LILVGC F G IPD +GSL  L YL
Sbjct  82   DIGQLSELKILDLSYNTMLGGTLTPNIGNLMELTILILVGCSFNGNIPDELGSLGNLSYL  141

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LN N+F G IP SLG+LS L W D+ADNQLTG +P+
Sbjct  142  ALNSNQFTGSIPASLGKLSNLNWFDIADNQLTGPLPI  178



>emb|CDO97683.1| unnamed protein product [Coffea canephora]
Length=946

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 118/171 (69%), Gaps = 1/171 (1%)
 Frame = +1

Query  109  LVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVS  288
            L+ L IQ L  +A TD+ND  A+ A++  W N+PP+W +G+DPCG  W+G+ CN S    
Sbjct  9    LLILSIQILHTLAQTDSNDSAALNAIKSSWNNLPPNW-KGADPCGSGWDGITCNVSDFQC  67

Query  289  LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL  468
              L  M LTG   GDI  L+ELQ LDLS N  L G++P  IGNLKKL  LILVGC F G 
Sbjct  68   RMLGGMLLTGSGLGDITMLTELQTLDLSNNIGLKGTIPSSIGNLKKLSTLILVGCSFSGP  127

Query  469  IPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            IPDSIGSLS+L Y+SLN N F GPIP S+G LS L WLDL++N L G++PV
Sbjct  128  IPDSIGSLSRLVYISLNSNSFSGPIPPSIGNLSNLSWLDLSENNLNGTLPV  178



>ref|XP_006664421.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Oryza brachyantha]
Length=912

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 114/173 (66%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +    + ++     A T+  D   +  +   W + P +W  G DPCGD W G+ C G+RV
Sbjct  8    IFFFSVLVEAFVASADTNAQDTSGLNGIAGSWDSRPSNW-NGLDPCGDKWIGIICTGNRV  66

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
             S+ LSS  L+G LSGDI+ L+ELQ LDLSYNK+L G+LP  IG L KL NLILVGC F 
Sbjct  67   TSIRLSSFGLSGTLSGDIQSLTELQYLDLSYNKNLRGTLPSTIGTLSKLQNLILVGCSFT  126

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP  IG LS L +LSLN NKF G IP SLG LS+LYW DLADNQLTG +P+
Sbjct  127  GEIPKEIGQLSNLIFLSLNSNKFTGSIPPSLGGLSKLYWFDLADNQLTGGLPI  179



>ref|XP_006279961.1| hypothetical protein CARUB_v10025827mg [Capsella rubella]
 gb|EOA12859.1| hypothetical protein CARUB_v10025827mg [Capsella rubella]
Length=953

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 125/173 (72%), Gaps = 3/173 (2%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            +LL+ L  Q     A T+  D  A+KA++D W   P  W EGSDPCG +W GV C    V
Sbjct  9    MLLILLCFQICS--ALTNVFDTTALKAMKDEWTTPPDGW-EGSDPCGTNWVGVKCRNDSV  65

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
            +S++LS+++L G+L+ DI  LSEL+ILDLSYN  LTG LP +IG+LKKL +LI+V C F 
Sbjct  66   ISISLSNLNLEGKLAPDITILSELEILDLSYNTGLTGPLPVKIGDLKKLKSLIVVRCSFS  125

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP+SIGSL +L YLSLNLNKF G IP S+G+LS+LYW D+ADNQ+ G +PV
Sbjct  126  GEIPESIGSLKELVYLSLNLNKFTGMIPASIGRLSKLYWFDIADNQIEGELPV  178



>ref|XP_002308292.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE91815.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=974

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 118/157 (75%), Gaps = 0/157 (0%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            TD  D  A+K+L+  W+N PPSW +  DPCG  WEGV C+ SR+ +L LS+M L G+LSG
Sbjct  28   TDPRDAAALKSLKSQWQNTPPSWDQSDDPCGAPWEGVTCSNSRITALGLSTMSLVGKLSG  87

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
            DI  L+EL+ LDLS+N +LTG L   +G+L  L  LIL GCGF G IPD +G+L+KL +L
Sbjct  88   DIGGLAELRSLDLSFNSNLTGPLSPRLGDLLNLNILILAGCGFSGSIPDELGNLAKLSFL  147

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LN NKF G IP SLG+LS+LYWLDLADNQLTG+IP+
Sbjct  148  ALNSNKFSGGIPPSLGKLSKLYWLDLADNQLTGTIPI  184



>ref|XP_011028449.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Populus euphratica]
Length=808

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 117/179 (65%), Gaps = 2/179 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            M  RI + LV   IQ     A T+N+D+ A+KAL+D W+NVPPSW  GSDPCG  W+G+ 
Sbjct  1    MGSRILVFLVVALIQVCTTPAVTNNDDFNALKALKDIWENVPPSWV-GSDPCGSRWDGIL  59

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            C  SRV S+TL+SM L G LSGDI  LSELQILDLSYN +L+G LP  IG+LKKL +LIL
Sbjct  60   CTNSRVTSITLASMGLKGTLSGDISNLSELQILDLSYNPELSGPLPPAIGDLKKLTSLIL  119

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGP-IPXSLGQLSELYWLDLADNQLTGSIP  618
            V C F G IPD+IGSL +L YL ++ N F     P     L  L  L +   QL G IP
Sbjct  120  VSCRFSGPIPDTIGSLPQLTYLDMSNNSFEATDFPPWFSTLQSLTTLVMETTQLQGQIP  178



>ref|XP_003541454.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Glycine max]
Length=931

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 112/157 (71%), Gaps = 1/157 (1%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            TD+ DY  + +L + W   P +W  G DPCG  W+G+ C+ SR+  L L  ++L G+LS 
Sbjct  24   TDSQDYSGLNSLTESWSYKPQNWV-GPDPCGSGWDGIRCSNSRITQLRLPGLNLGGQLSS  82

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
             I+ LSEL  LDLSYN  LTG++P+EIGNLKKL +L LVGCGF G IPDSIGSL +L +L
Sbjct  83   AIQSLSELDTLDLSYNTGLTGTVPQEIGNLKKLKSLSLVGCGFSGRIPDSIGSLKQLTFL  142

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LN N F G IP SLG LS + WLDLA+NQL G+IPV
Sbjct  143  ALNSNNFSGTIPRSLGNLSNVDWLDLAENQLEGTIPV  179



>ref|XP_008345657.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like protein kinase At5g49770 [Malus domestica]
Length=1223

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 123/194 (63%), Gaps = 9/194 (5%)
 Frame = +1

Query  40   VVCFDCWSGMVI**TMIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSW  219
            V+C    SG       I  ++ L  P F + +  V F+      A+++LR  W NVPPSW
Sbjct  258  VICEPMISGQ----KAISVVKSLGFPCF-EIMDAVGFSA----XALQSLRQTWSNVPPSW  308

Query  220  AEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSL  399
             + +DPC + WEG+ CN SRV +L LS M++ GE+  DI  LSEL+ LDLS+NK LTGSL
Sbjct  309  DKSNDPCXERWEGITCNXSRVTALXLSGMNVKGEIEXDIAGLSELRSLDLSFNKGLTGSL  368

Query  400  PREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYW  579
               +G+L  L  LIL GC F G+IP  +G L  L +L+LN N F G IP SLG LS LYW
Sbjct  369  SPRLGDLSNLNXLILAGCXFSGIIPSELGKLGXLXFLALNTNNFTGSIPASLGNLSNLYW  428

Query  580  LDLADNQLTGSIPV  621
            LDLADNQLTG +PV
Sbjct  429  LDLADNQLTGPLPV  442



>ref|XP_004972229.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Setaria italica]
Length=961

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 114/175 (65%), Gaps = 0/175 (0%)
 Frame = +1

Query  97   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  276
            I LLLV            TD  D  A+++L  GW+N P SW   +DPCG  W+G+ CN  
Sbjct  6    IPLLLVMFSASLRAGFCDTDPQDVAALQSLMRGWQNFPSSWKASNDPCGAQWDGITCNNG  65

Query  277  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  456
            RV S+ LSS++L G LS  I +LSEL  LDLS N  L+G LP  IGNLK+L  LILVGC 
Sbjct  66   RVTSMRLSSINLQGTLSNSIGQLSELVYLDLSSNSGLSGPLPTSIGNLKQLTTLILVGCS  125

Query  457  FFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            F G IP  +G+L +L +L+LN N F G IP S+G L+ L+WLDLA+NQL+G IP+
Sbjct  126  FTGGIPQELGNLVQLSFLALNSNNFTGRIPASIGLLTNLFWLDLAENQLSGPIPI  180



>ref|NP_001176022.1| Os10g0145700 [Oryza sativa Japonica Group]
 dbj|BAH94750.1| Os10g0145700 [Oryza sativa Japonica Group]
Length=309

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 101/138 (73%), Gaps = 0/138 (0%)
 Frame = +1

Query  208  PPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDL  387
            P +W  G+DPCGD W G+ C G+RV S+ LSS  L+G LSGDI+ LSELQ LDLSYNK+L
Sbjct  29   PSNWGNGNDPCGDKWIGIICTGNRVTSIRLSSFGLSGTLSGDIQSLSELQYLDLSYNKNL  88

Query  388  TGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLS  567
             G LP  IG L KL NLILVGC F G IP  IG LS L +LSLN NKF G IP SL  LS
Sbjct  89   RGPLPSTIGTLSKLQNLILVGCSFTGEIPKEIGQLSNLIFLSLNSNKFNGSIPPSLCCLS  148

Query  568  ELYWLDLADNQLTGSIPV  621
            +LYW DL+DNQLTG +P+
Sbjct  149  KLYWFDLSDNQLTGGLPI  166



>emb|CDY19539.1| BnaC09g13640D [Brassica napus]
Length=938

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 126/182 (69%), Gaps = 4/182 (2%)
 Frame = +1

Query  85   MIPRIQ--LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEG  258
            M  R Q  +LL+  F Q   + A T+  D  A++AL+  W   P +W +GSDPCG +W G
Sbjct  5    MSSRYQVCMLLILTFCQICSVSALTNGLDASALQALKSEWTRFPENW-KGSDPCGTNWVG  63

Query  259  VGCNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN  435
            + CN +  V+S++L +++L G+LS DI  L+ELQILDL+ N  L+GSLP  IGNL+KL  
Sbjct  64   ITCNNNNHVISISLGNLNLEGKLSADISSLAELQILDLTSNSKLSGSLPSNIGNLRKLTT  123

Query  436  LILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSI  615
            L L+ CGF G IP+SIGSL +L  LSLN NKF G IP S+G+LS+L W D+ADN++ G+I
Sbjct  124  LNLMECGFSGEIPESIGSLEQLITLSLNSNKFSGTIPASIGRLSKLNWFDIADNKIEGTI  183

Query  616  PV  621
            PV
Sbjct  184  PV  185



>gb|EMT14100.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=902

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 117/173 (68%), Gaps = 1/173 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV  282
            L+L  + +Q   I+A T+  D   +  +   W   P +W +G+DPCGD W G+ C   RV
Sbjct  7    LILFGVLVQASVILADTNVQDTAGLTGIAASWDTKPSNW-DGNDPCGDKWIGIICIQDRV  65

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
             S+ LSS  L+G LSGDI+ LSELQ LDLSYNKDL GSLP  IG+L  L NLILVGC F 
Sbjct  66   TSIRLSSQSLSGTLSGDIQSLSELQYLDLSYNKDLGGSLPSSIGSLSNLQNLILVGCSFA  125

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IP  IG LSKL +LSLN N+F G IP SL  LS+LYW DLA+N+LTG +PV
Sbjct  126  GEIPKEIGQLSKLIFLSLNSNRFTGHIPPSLSGLSKLYWFDLAENKLTGGLPV  178



>ref|XP_003593677.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES63928.1| LRR receptor-like kinase family protein, putative [Medicago truncatula]
Length=503

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 109/157 (69%), Gaps = 1/157 (1%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            TD+ D+ A+ +L   WKN P +W  GSDPCG  W+G+ C+ SR+  L L S+ L G+LS 
Sbjct  25   TDSGDFTALSSLIQSWKNKPLNWV-GSDPCGSDWDGIRCSNSRITELKLPSLKLEGQLSS  83

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
             I+ LSEL+ LD+SYN  +TG +PREIGNLK L +L L GCGF G IPDSIGSL  L +L
Sbjct  84   AIQSLSELETLDISYNAGMTGIIPREIGNLKNLNSLALSGCGFSGPIPDSIGSLKNLTFL  143

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LN NK  G IP SLG L+ L WLDL  NQL G IPV
Sbjct  144  ALNSNKLTGNIPRSLGNLANLDWLDLDKNQLAGPIPV  180



>ref|NP_199788.1| putative leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 sp|Q9LT96.1|Y5977_ARATH RecName: Full=Probable leucine-rich repeat receptor-like protein 
kinase At5g49770; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA98165.1| receptor protein kinase-like [Arabidopsis thaliana]
 gb|ACN59389.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED95855.1| putative leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=946

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 120/166 (72%), Gaps = 2/166 (1%)
 Frame = +1

Query  127  QFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG-SRVVSLTLSS  303
            Q   + AFTD +D+ A++AL++ W  +  SW + SDPCG  W G+ CN  +RVVS++L++
Sbjct  19   QIYSVYAFTDGSDFTALQALKNEWDTLSKSW-KSSDPCGTEWVGITCNNDNRVVSISLTN  77

Query  304  MDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSI  483
             +L G+L  +I  LSELQ LDL+ N +L+G LP  IGNL+KL  L L+GC F G IPDSI
Sbjct  78   RNLKGKLPTEISTLSELQTLDLTGNPELSGPLPANIGNLRKLTFLSLMGCAFNGPIPDSI  137

Query  484  GslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G+L +L  LSLNLNKF G IP S+G+LS+LYW D+ADNQL G +PV
Sbjct  138  GNLEQLTRLSLNLNKFSGTIPASMGRLSKLYWFDIADNQLEGKLPV  183



>gb|KJB57522.1| hypothetical protein B456_009G167900 [Gossypium raimondii]
Length=925

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 103/142 (73%), Gaps = 1/142 (1%)
 Frame = +1

Query  196  WKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSY  375
            WKNVP +W  G DPC D W G+GC GSRV SL L +M L G L GDI  LSEL+ LDLSY
Sbjct  4    WKNVPSNWGRG-DPCDDKWVGIGCTGSRVTSLNLPNMKLEGRLVGDIFFLSELKELDLSY  62

Query  376  NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSL  555
            NK L G LP  + NLKKL NLILVGCGF G IPD+IGSL +L+ LSLN N F G IP S+
Sbjct  63   NKGLRGILPPAVQNLKKLENLILVGCGFSGQIPDTIGSLPQLRILSLNSNAFSGNIPPSI  122

Query  556  GQLSELYWLDLADNQLTGSIPV  621
            G LS L WLD+ADNQL G IPV
Sbjct  123  GNLSTLNWLDMADNQLEGEIPV  144



>ref|XP_009113087.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=934

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 123/174 (71%), Gaps = 2/174 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS-R  279
            +LL+  F Q   + A T+  D  A++AL+  W   P +W +GSDPCG +W G+ CN +  
Sbjct  9    MLLILAFCQICYVSALTNGLDASALQALKSEWTRFPENW-KGSDPCGTNWVGITCNNNNH  67

Query  280  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  459
            V+S++L +++L G+LS DI  L+ELQILDL+ N  L+GSLP  IGNL+KL  L L+ CGF
Sbjct  68   VISISLGNLNLEGKLSADISSLAELQILDLTSNSKLSGSLPSNIGNLRKLTTLNLMECGF  127

Query  460  FGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             G IP+SIGSL +L  LSLN NKF G IP S+G+LS+L W D+ADNQ+ G+IPV
Sbjct  128  SGEIPESIGSLDQLITLSLNSNKFSGTIPASIGRLSKLNWFDIADNQIEGTIPV  181



>ref|XP_006385115.1| hypothetical protein POPTR_0004s24060g [Populus trichocarpa]
 gb|ERP62912.1| hypothetical protein POPTR_0004s24060g [Populus trichocarpa]
Length=313

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 122/176 (69%), Gaps = 6/176 (3%)
 Frame = +1

Query  109  LVPLFIQFLGIVAF-----TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG  273
            + P  + FL + +F     T  +D+  +  L+D W+N P +W  G+DPCG  WEG+ C+ 
Sbjct  1    MCPKVLTFLLVASFQIYTETYGDDFTVMSILKDAWENTPRNWV-GADPCGGKWEGISCHN  59

Query  274  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC  453
            SRV S+TL+++ LTGELSGDI  LSEL+ LDLSYN  L+G+LP  I NLKKL  L LVGC
Sbjct  60   SRVTSITLAAVGLTGELSGDISSLSELESLDLSYNTGLSGTLPASIVNLKKLKILKLVGC  119

Query  454  GFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             F G IP+ IGSL  L+ L LN N+F GPIP S+G LS+L+ LDL++N L G+IPV
Sbjct  120  RFSGPIPELIGSLQLLESLDLNSNRFTGPIPHSIGNLSKLFLLDLSNNMLDGAIPV  175



>ref|XP_009364675.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=937

 Score =   159 bits (401),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 116/174 (67%), Gaps = 6/174 (3%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGD-HWEGVGCNGSR  279
            L+++P F+    I    +N +YV +K L D W   P SW  GSDPCGD  WEG+ C  S 
Sbjct  14   LVMIPFFV----IAVEANNQEYVPMKILMDEWNIRPTSWV-GSDPCGDGSWEGITCTNSH  68

Query  280  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  459
            V S+ L+ M LTG L  DIE LSEL++L+LS+N+ L G LP  IG L KL  L LVGC F
Sbjct  69   VTSIALADMALTGSLPSDIERLSELEVLNLSFNRGLKGLLPASIGKLTKLVYLNLVGCSF  128

Query  460  FGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            FG IPD++GSL +L YLSL  N F G IP S+G ++ L +LDL+DNQL GSIPV
Sbjct  129  FGRIPDTMGSLKQLSYLSLKNNSFSGRIPPSIGNMTNLSFLDLSDNQLQGSIPV  182



>emb|CDY12939.1| BnaA09g13350D [Brassica napus]
Length=938

 Score =   159 bits (401),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 123/174 (71%), Gaps = 2/174 (1%)
 Frame = +1

Query  103  LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS-R  279
            +LL+  F Q   + A T+  D  A++AL+  W   P +W +GSDPCG +W G+ CN +  
Sbjct  13   MLLILAFCQICYVSALTNGLDASALQALKSEWTRFPENW-KGSDPCGTNWVGITCNNNNH  71

Query  280  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF  459
            ++S++L +++L G+LS DI  L+ELQILDL+ N  L+GSLP  IGNL+KL  L L+ CGF
Sbjct  72   IISISLGNLNLEGKLSADISSLAELQILDLTSNSKLSGSLPSNIGNLRKLTTLNLMECGF  131

Query  460  FGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             G IP+SIGSL +L  LSLN NKF G IP S+G+LS+L W D+ADNQ+ G+IPV
Sbjct  132  SGEIPESIGSLDQLITLSLNSNKFSGTIPASIGRLSKLNWFDIADNQIEGTIPV  185



>ref|XP_007208219.1| hypothetical protein PRUPE_ppa018586mg, partial [Prunus persica]
 gb|EMJ09418.1| hypothetical protein PRUPE_ppa018586mg, partial [Prunus persica]
Length=934

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = +1

Query  181  ALRDGWKNVPPSWAEGS-DPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQ  357
            +L+  W N+PPSW + S DPCG +WEGV CN SRV +L LS+MDL G++ GDI  LSEL+
Sbjct  5    SLKGAWTNLPPSWNDKSNDPCGMNWEGVTCNNSRVTALGLSAMDLKGQIEGDIGGLSELR  64

Query  358  ILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIG  537
             LDLS+NK LTGSL   +G+L KL  LIL GCGF G IP+ +G+L +L +L+LN NKF G
Sbjct  65   SLDLSFNKGLTGSLSPRLGDLSKLNILILAGCGFSGNIPEELGNLGELTFLALNTNKFTG  124

Query  538  PIPXSLGQLSELYWLDLADNQLTGSIPV  621
             IP SLG+LS+L WLDL DNQLTG++P+
Sbjct  125  QIPPSLGKLSKLNWLDLVDNQLTGTLPI  152



>ref|XP_002864015.1| hypothetical protein ARALYDRAFT_495037 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40274.1| hypothetical protein ARALYDRAFT_495037 [Arabidopsis lyrata subsp. 
lyrata]
Length=944

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 118/161 (73%), Gaps = 1/161 (1%)
 Frame = +1

Query  139  IVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG  318
            + A TD++D  A++AL+  WK +  SW + SDPCG  W G+ CN +RVVS++L++ +L G
Sbjct  21   VYAITDDSDSTALQALKSEWKTLSKSW-KSSDPCGSGWVGITCNNNRVVSISLTNRNLNG  79

Query  319  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsk  498
            +L  +I  L+ELQ LDL+ N +L+G LP  IGNLKKL  L L+GC F G IPDSIG+L +
Sbjct  80   KLPTEISTLAELQTLDLTGNPELSGPLPANIGNLKKLIVLSLMGCDFNGEIPDSIGNLEQ  139

Query  499  lkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            L  LSLNLNKF G IP S+G+LS+LYW D+ADNQ+ G +PV
Sbjct  140  LTRLSLNLNKFTGTIPPSMGRLSKLYWFDIADNQIEGKLPV  180



>ref|XP_010682227.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770, partial [Beta vulgaris subsp. vulgaris]
Length=866

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = +1

Query  196  WKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSY  375
            W+N+PP+W+ G DPC + W G+ C+ SR+  + L +M+LTG+L+GD+  L ELQILDLSY
Sbjct  44   WRNLPPNWSIGGDPCVNEWLGIKCSDSRITEIKLLNMNLTGQLTGDLAVLRELQILDLSY  103

Query  376  NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSL  555
            N+ LTG LP+ IG L KL +LIL+ CGF G IPD IGSL +L  L LN N F GP+P ++
Sbjct  104  NRGLTGPLPQSIGQLLKLTSLILMDCGFSGRIPDYIGSLKQLDSLYLNGNNFTGPVPATI  163

Query  556  GQLSELYWLDLADNQLTGSIPV  621
            G L  LYWLDL  NQL+GSIPV
Sbjct  164  GNLLNLYWLDLGTNQLSGSIPV  185



>ref|XP_011461103.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
 ref|XP_011461104.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
 ref|XP_011461105.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
Length=939

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 119/170 (70%), Gaps = 2/170 (1%)
 Frame = +1

Query  112  VPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSL  291
            V + +Q L I A  +  +Y  ++ L D W   PPSW   +DPC D WEG+ C  SR+ +L
Sbjct  12   VLVLLQVLFIAAEANTQEYGYMQILMDEWNIKPPSWV-SADPC-DGWEGIKCTNSRITAL  69

Query  292  TLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLI  471
             L++M L G+LS DIE LSEL+IL+LS+NK L+G L   IG LKKL +L LVGC FFG I
Sbjct  70   VLANMGLKGQLSTDIELLSELRILNLSFNKGLSGQLRASIGKLKKLVHLNLVGCSFFGPI  129

Query  472  PDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            PD+IGSL+KL YLSL  N F GPIP S+G LS L ++DL+DN+L GSIPV
Sbjct  130  PDAIGSLTKLSYLSLKNNSFSGPIPPSIGNLSNLTFIDLSDNKLQGSIPV  179



>ref|XP_007148093.1| hypothetical protein PHAVU_006G180200g [Phaseolus vulgaris]
 gb|ESW20087.1| hypothetical protein PHAVU_006G180200g [Phaseolus vulgaris]
Length=930

 Score =   156 bits (395),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = +1

Query  151  TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG  330
            TD+ DY  + +L + W + P SW  G+DPC   W+G+ C+ +R+  L L S+ L G+LS 
Sbjct  25   TDSRDYSGLNSLAESWSSKPQSWV-GTDPCSS-WDGIRCSNTRITELRLPSLSLRGQLSS  82

Query  331  DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkyl  510
             IE LSEL  LDLSYN  LTG++P EIGNLK+L +L LVGCGF G IPDSIGSL +L +L
Sbjct  83   AIESLSELVTLDLSYNTGLTGTIPNEIGNLKRLKSLSLVGCGFSGPIPDSIGSLKQLTFL  142

Query  511  slnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +LN NKF G IP SLG L+ + WLDLA+N+L G+IPV
Sbjct  143  ALNSNKFSGTIPRSLGNLTNINWLDLAENELVGTIPV  179



>ref|XP_003593682.1| Somatic embryogenesis receptor-like kinase [Medicago truncatula]
Length=909

 Score =   156 bits (394),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 107/154 (69%), Gaps = 1/154 (1%)
 Frame = +1

Query  160  NDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIE  339
            + + A+ +L   W N P +W  GSDPCG +W G+GC+ SR+  L L  + L G+LS  I+
Sbjct  3    HSFTALSSLTQSWNNRPSNWV-GSDPCGSNWAGIGCDNSRITELKLLGLSLEGQLSSAIQ  61

Query  340  ELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylsln  519
             LSEL+ LDLS N  +TG++PREIGNLK L +L LVGCGF G IPDSIGSL KL +L+LN
Sbjct  62   SLSELETLDLSSNTGMTGTIPREIGNLKNLNSLALVGCGFSGPIPDSIGSLKKLTFLALN  121

Query  520  lnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
             N F G IP SLG LS L WLDL  NQL G IPV
Sbjct  122  SNNFTGNIPHSLGNLSNLDWLDLDQNQLEGPIPV  155



>ref|XP_011088110.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Sesamum indicum]
Length=954

 Score =   156 bits (394),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 116/179 (65%), Gaps = 1/179 (1%)
 Frame = +1

Query  85   MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVG  264
            M  R+ + L+ +  + L I A T + D  A+ AL+  WKN+PP+W  G DPCG  W+G+ 
Sbjct  12   MSSRVLVFLLLVSTRILAIFAVTYSGDLAALIALKATWKNLPPNWV-GGDPCGSKWDGIN  70

Query  265  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL  444
            C  +RV SL L+   L G    DI  L+ LQ LDLS N  L G LP  IGNLK L  LIL
Sbjct  71   CTDTRVTSLMLAGTGLEGSEFSDISSLTGLQFLDLSNNIGLKGVLPSSIGNLKNLTVLIL  130

Query  445  VGCGFFGLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            +GC FFG IPDSIGSL +L Y+SLN N F G IP S+G LS+L WLDL+ N+L G+IPV
Sbjct  131  IGCSFFGPIPDSIGSLQQLVYISLNSNSFSGSIPPSIGNLSQLSWLDLSMNKLNGTIPV  189



>ref|XP_008359275.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Malus domestica]
Length=272

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 111/173 (64%), Gaps = 6/173 (3%)
 Frame = +1

Query  106  LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGD-HWEGVGCNGSRV  282
            +L+P F+    I       +YV +K L D W   P SW  GSDPCG+  WEGV C  S V
Sbjct  15   VLIPFFV----IAVEASIQEYVPMKILMDEWNIRPTSWV-GSDPCGNGSWEGVTCTNSHV  69

Query  283  VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF  462
             S+ L+ M LTG +  DIE LSEL++L+LS+N+ L G LP  IG L KL  L LVGC FF
Sbjct  70   TSIALADMALTGSVPSDIELLSELEVLNLSFNRGLKGLLPASIGKLTKLVYLNLVGCSFF  129

Query  463  GLIPDSIGslsklkylslnlnkFIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            G IPD++GSL  L YLSL  N F G IP S+G ++ L +LDL+DNQL G IPV
Sbjct  130  GPIPDTMGSLKHLSYLSLKNNSFSGRIPPSIGNMTNLSFLDLSDNQLXGPIPV  182



>ref|XP_006371696.1| hypothetical protein POPTR_0018s002601g, partial [Populus trichocarpa]
 gb|ERP49493.1| hypothetical protein POPTR_0018s002601g, partial [Populus trichocarpa]
Length=204

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 110/151 (73%), Gaps = 1/151 (1%)
 Frame = +1

Query  169  VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELS  348
              +  L+D W+N P +W  G+DPCG  WEG+ C  SRV S+TL+++ LTGELSGDI  LS
Sbjct  15   TVMSILKDAWQNTPRNWV-GADPCGGKWEGISCYNSRVTSITLAAVGLTGELSGDISSLS  73

Query  349  ELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGslsklkylslnlnk  528
            EL++LDLSYN  L+G+LP  I NLKKL  L LVGC F G IP+ IGSL  L+ L LN N+
Sbjct  74   ELEVLDLSYNTGLSGTLPASIVNLKKLKILKLVGCSFSGPIPELIGSLQLLESLDLNSNR  133

Query  529  FIGPIPXSLGQLSELYWLDLADNQLTGSIPV  621
            F GPIP S+G LS+L+ LDL++N L G+IPV
Sbjct  134  FTGPIPHSIGNLSKLFLLDLSNNMLDGAIPV  164



>ref|XP_006429975.1| hypothetical protein CICLE_v100110352mg, partial [Citrus clementina]
 gb|ESR43215.1| hypothetical protein CICLE_v100110352mg, partial [Citrus clementina]
Length=173

 Score =   143 bits (361),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 107/153 (70%), Gaps = 3/153 (2%)
 Frame = +1

Query  97   IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS  276
            I + L    IQF  I + TD+ D  A+++L+D W+N PP+W    DPCG  WEGV CN S
Sbjct  8    IFIALFSFHIQF--ISSNTDSRDAAALQSLKDAWQNTPPTWKNSDDPCGS-WEGVTCNNS  64

Query  277  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG  456
            RV +L LS+M LTG+LSGDI  L+EL+ LDLSYN  LTGSL   IG+L+KL  LIL GCG
Sbjct  65   RVTALGLSTMGLTGKLSGDIGGLTELRSLDLSYNGGLTGSLSPRIGDLQKLNILILAGCG  124

Query  457  FFGLIPDSIGslsklkylslnlnkFIGPIPXSL  555
            F G IPD IG+L++L +L+LN N F G IP SL
Sbjct  125  FTGNIPDEIGNLAELSFLALNSNNFSGRIPPSL  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950