BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS035H02

Length=598
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009763791.1|  PREDICTED: metal-nicotianamine transporter Y...    215   3e-62   Nicotiana sylvestris
ref|XP_009763789.1|  PREDICTED: metal-nicotianamine transporter Y...    215   4e-62   Nicotiana sylvestris
ref|XP_009763790.1|  PREDICTED: metal-nicotianamine transporter Y...    215   4e-62   Nicotiana sylvestris
gb|KHN19530.1|  Metal-nicotianamine transporter YSL3                    215   5e-62   Glycine soja [wild soybean]
ref|XP_003523338.2|  PREDICTED: metal-nicotianamine transporter Y...    215   5e-62   Glycine max [soybeans]
gb|AFU82909.1|  yellow stripe-like transporter 3.2                      205   5e-62   Arachis hypogaea [goober]
ref|XP_006578879.1|  PREDICTED: metal-nicotianamine transporter Y...    215   5e-62   Glycine max [soybeans]
emb|CDP05015.1|  unnamed protein product                                214   8e-62   Coffea canephora [robusta coffee]
gb|KDO59687.1|  hypothetical protein CISIN_1g0442261mg                  208   9e-62   Citrus sinensis [apfelsine]
gb|KDP30688.1|  hypothetical protein JCGZ_16395                         214   1e-61   Jatropha curcas
ref|XP_011075924.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    213   2e-61   Sesamum indicum [beniseed]
ref|XP_007136481.1|  hypothetical protein PHAVU_009G048800g             213   2e-61   Phaseolus vulgaris [French bean]
gb|KJB37388.1|  hypothetical protein B456_006G203200                    208   3e-61   Gossypium raimondii
ref|XP_008456007.1|  PREDICTED: metal-nicotianamine transporter Y...    211   4e-61   Cucumis melo [Oriental melon]
gb|KGN57644.1|  hypothetical protein Csa_3G238100                       212   4e-61   Cucumis sativus [cucumbers]
ref|XP_004146239.1|  PREDICTED: metal-nicotianamine transporter Y...    212   5e-61   
ref|XP_008456005.1|  PREDICTED: metal-nicotianamine transporter Y...    212   5e-61   Cucumis melo [Oriental melon]
gb|KHG05098.1|  Metal-nicotianamine transporter YSL3 -like protein      212   5e-61   Gossypium arboreum [tree cotton]
ref|XP_002515673.1|  oligopeptide transporter, putative                 212   6e-61   Ricinus communis
ref|XP_002318472.2|  hypothetical protein POPTR_0012s03180g             211   1e-60   
ref|XP_006581667.1|  PREDICTED: metal-nicotianamine transporter Y...    211   1e-60   Glycine max [soybeans]
ref|XP_004165023.1|  PREDICTED: metal-nicotianamine transporter Y...    211   2e-60   
gb|KJB37389.1|  hypothetical protein B456_006G203200                    210   2e-60   Gossypium raimondii
ref|XP_011043727.1|  PREDICTED: metal-nicotianamine transporter Y...    209   4e-60   Populus euphratica
ref|XP_006441189.1|  hypothetical protein CICLE_v10019170mg             209   5e-60   
ref|XP_006491954.1|  PREDICTED: metal-nicotianamine transporter Y...    209   5e-60   
ref|XP_006491948.1|  PREDICTED: metal-nicotianamine transporter Y...    209   5e-60   
ref|XP_011043724.1|  PREDICTED: metal-nicotianamine transporter Y...    209   5e-60   Populus euphratica
ref|XP_006441190.1|  hypothetical protein CICLE_v10019170mg             209   5e-60   Citrus clementina [clementine]
ref|XP_009361313.1|  PREDICTED: metal-nicotianamine transporter YSL2    209   6e-60   
gb|KJB37386.1|  hypothetical protein B456_006G203200                    209   7e-60   Gossypium raimondii
ref|XP_006431856.1|  hypothetical protein CICLE_v10003961mg             209   8e-60   
gb|KDO53476.1|  hypothetical protein CISIN_1g047730mg                   209   1e-59   Citrus sinensis [apfelsine]
ref|XP_006471126.1|  PREDICTED: metal-nicotianamine transporter Y...    209   1e-59   Citrus sinensis [apfelsine]
ref|XP_008381368.1|  PREDICTED: metal-nicotianamine transporter Y...    208   1e-59   
ref|XP_009765494.1|  PREDICTED: metal-nicotianamine transporter Y...    208   2e-59   Nicotiana sylvestris
ref|XP_009765519.1|  PREDICTED: metal-nicotianamine transporter Y...    208   2e-59   Nicotiana sylvestris
gb|KJB19873.1|  hypothetical protein B456_003G122700                    208   2e-59   Gossypium raimondii
ref|XP_008376798.1|  PREDICTED: metal-nicotianamine transporter YSL3    208   2e-59   
ref|XP_011084545.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    207   2e-59   
ref|XP_010482756.1|  PREDICTED: metal-nicotianamine transporter Y...    202   2e-59   
emb|CBI23058.3|  unnamed protein product                                207   3e-59   Vitis vinifera
ref|XP_010671369.1|  PREDICTED: metal-nicotianamine transporter Y...    207   3e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007039161.1|  YELLOW STRIPE like 3 isoform 2                     207   3e-59   
ref|XP_002274166.1|  PREDICTED: metal-nicotianamine transporter YSL3    207   3e-59   Vitis vinifera
ref|XP_010671364.1|  PREDICTED: metal-nicotianamine transporter Y...    207   3e-59   Beta vulgaris subsp. vulgaris [field beet]
gb|ADN33766.1|  YSL transporter                                         205   4e-59   Cucumis melo subsp. melo
ref|XP_010034897.1|  PREDICTED: metal-nicotianamine transporter Y...    207   4e-59   Eucalyptus grandis [rose gum]
gb|KGN65329.1|  hypothetical protein Csa_1G329900                       206   4e-59   Cucumis sativus [cucumbers]
ref|XP_004172903.1|  PREDICTED: metal-nicotianamine transporter Y...    207   5e-59   
emb|CAN77891.1|  hypothetical protein VITISV_016271                     207   6e-59   Vitis vinifera
ref|XP_004150025.1|  PREDICTED: metal-nicotianamine transporter Y...    207   6e-59   
ref|XP_010445924.1|  PREDICTED: metal-nicotianamine transporter Y...    201   6e-59   
ref|XP_009351940.1|  PREDICTED: metal-nicotianamine transporter Y...    206   7e-59   Pyrus x bretschneideri [bai li]
ref|XP_007220212.1|  hypothetical protein PRUPE_ppa002475mg             206   8e-59   Prunus persica
gb|AEQ28192.1|  yellow stripe-like protein 3                            206   1e-58   Malus baccata var. xiaojinensis
ref|XP_009119903.1|  PREDICTED: metal-nicotianamine transporter YSL3    206   1e-58   Brassica rapa
emb|CDY20248.1|  BnaC09g29910D                                          206   1e-58   Brassica napus [oilseed rape]
emb|CDY14371.1|  BnaA10g06840D                                          206   2e-58   Brassica napus [oilseed rape]
gb|KHG10996.1|  Metal-nicotianamine transporter YSL3 -like protein      205   2e-58   Gossypium arboreum [tree cotton]
gb|AES72566.2|  OPT family oligopeptide transporter                     205   2e-58   Medicago truncatula
ref|XP_003602315.1|  YSL transporter                                    206   3e-58   
ref|XP_008234683.1|  PREDICTED: metal-nicotianamine transporter YSL3    204   4e-58   Prunus mume [ume]
dbj|BAF48331.1|  putative yellow stripe-like protein                    204   5e-58   Nicotiana tabacum [American tobacco]
ref|XP_010035301.1|  PREDICTED: metal-nicotianamine transporter Y...    204   8e-58   Eucalyptus grandis [rose gum]
ref|XP_009588595.1|  PREDICTED: metal-nicotianamine transporter Y...    204   9e-58   Nicotiana tomentosiformis
ref|XP_009588601.1|  PREDICTED: metal-nicotianamine transporter Y...    203   9e-58   Nicotiana tomentosiformis
ref|XP_002864249.1|  predicted protein                                  203   9e-58   Arabidopsis lyrata subsp. lyrata
gb|EYU19676.1|  hypothetical protein MIMGU_mgv1a002464mg                203   1e-57   Erythranthe guttata [common monkey flower]
ref|XP_008653898.1|  PREDICTED: probable metal-nicotianamine tran...    189   1e-57   Zea mays [maize]
ref|XP_010482755.1|  PREDICTED: metal-nicotianamine transporter Y...    203   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008649050.1|  PREDICTED: probable metal-nicotianamine tran...    189   2e-57   Zea mays [maize]
ref|XP_008444004.1|  PREDICTED: metal-nicotianamine transporter Y...    203   2e-57   Cucumis melo [Oriental melon]
gb|AFU82908.1|  yellow stripe-like transporter 3.1                      202   2e-57   Arachis hypogaea [goober]
emb|CDX96232.1|  BnaC02g14190D                                          202   3e-57   
ref|XP_010445905.1|  PREDICTED: metal-nicotianamine transporter Y...    202   4e-57   Camelina sativa [gold-of-pleasure]
ref|XP_006401691.1|  hypothetical protein EUTSA_v10012886mg             201   5e-57   Eutrema salsugineum [saltwater cress]
gb|KCW77323.1|  hypothetical protein EUGRSUZ_D01684                     198   6e-57   Eucalyptus grandis [rose gum]
ref|XP_008367110.1|  PREDICTED: metal-nicotianamine transporter Y...    192   6e-57   
ref|XP_004976408.1|  PREDICTED: probable metal-nicotianamine tran...    201   8e-57   
ref|XP_009398090.1|  PREDICTED: probable metal-nicotianamine tran...    201   8e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004976407.1|  PREDICTED: probable metal-nicotianamine tran...    201   9e-57   Setaria italica
gb|EYU45295.1|  hypothetical protein MIMGU_mgv1a002502mg                201   9e-57   Erythranthe guttata [common monkey flower]
gb|KHN05985.1|  Metal-nicotianamine transporter YSL3-like protein       199   1e-56   Glycine soja [wild soybean]
ref|XP_010442924.1|  PREDICTED: metal-nicotianamine transporter Y...    195   1e-56   
emb|CDY70890.1|  BnaCnng70180D                                          194   1e-56   Brassica napus [oilseed rape]
ref|XP_010537056.1|  PREDICTED: metal-nicotianamine transporter Y...    200   2e-56   Tarenaya hassleriana [spider flower]
ref|XP_010537055.1|  PREDICTED: metal-nicotianamine transporter Y...    200   2e-56   Tarenaya hassleriana [spider flower]
ref|XP_010919337.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    199   2e-56   Elaeis guineensis
ref|XP_006281523.1|  hypothetical protein CARUB_v10027623mg             200   2e-56   Capsella rubella
ref|XP_006653627.1|  PREDICTED: probable metal-nicotianamine tran...    199   2e-56   Oryza brachyantha
gb|KHN46380.1|  Metal-nicotianamine transporter YSL1                    198   2e-56   Glycine soja [wild soybean]
dbj|BAE98794.1|  EspB-like protein                                      196   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003551122.2|  PREDICTED: metal-nicotianamine transporter Y...    199   4e-56   
ref|XP_006601048.1|  PREDICTED: metal-nicotianamine transporter Y...    199   4e-56   Glycine max [soybeans]
ref|XP_010053070.1|  PREDICTED: metal-nicotianamine transporter YSL1    199   5e-56   Eucalyptus grandis [rose gum]
ref|XP_008803948.1|  PREDICTED: probable metal-nicotianamine tran...    199   5e-56   Phoenix dactylifera
gb|AAM98073.1|  AT5g24380/K16H17_9                                      194   5e-56   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57276.1|  AT5G24380                                              194   5e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010252366.1|  PREDICTED: metal-nicotianamine transporter YSL2    199   5e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010267463.1|  PREDICTED: metal-nicotianamine transporter Y...    198   7e-56   Nelumbo nucifera [Indian lotus]
ref|XP_004245462.1|  PREDICTED: metal-nicotianamine transporter YSL1    198   8e-56   Solanum lycopersicum
ref|XP_010493592.1|  PREDICTED: metal-nicotianamine transporter Y...    198   8e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010493593.1|  PREDICTED: metal-nicotianamine transporter Y...    198   8e-56   Camelina sativa [gold-of-pleasure]
ref|XP_008456006.1|  PREDICTED: metal-nicotianamine transporter Y...    198   8e-56   Cucumis melo [Oriental melon]
ref|XP_003556858.1|  PREDICTED: metal-nicotianamine transporter Y...    198   8e-56   Glycine max [soybeans]
ref|XP_010034899.1|  PREDICTED: metal-nicotianamine transporter Y...    198   1e-55   Eucalyptus grandis [rose gum]
ref|XP_002872112.1|  hypothetical protein ARALYDRAFT_489303             198   1e-55   
ref|XP_011470188.1|  PREDICTED: metal-nicotianamine transporter Y...    198   1e-55   Fragaria vesca subsp. vesca
gb|KCW46096.1|  hypothetical protein EUGRSUZ_K00012                     198   1e-55   Eucalyptus grandis [rose gum]
gb|KJB18947.1|  hypothetical protein B456_003G076700                    197   1e-55   Gossypium raimondii
ref|XP_010240192.1|  PREDICTED: probable metal-nicotianamine tran...    186   1e-55   
ref|XP_009762636.1|  PREDICTED: metal-nicotianamine transporter Y...    198   2e-55   Nicotiana sylvestris
ref|XP_009762638.1|  PREDICTED: metal-nicotianamine transporter Y...    197   2e-55   Nicotiana sylvestris
ref|XP_009762637.1|  PREDICTED: metal-nicotianamine transporter Y...    198   2e-55   Nicotiana sylvestris
dbj|BAB09731.1|  EspB-like protein                                      197   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200167.2|  metal-nicotianamine transporter YSL3                  197   2e-55   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE99250.1|  hypothetical protein                                   194   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454748.1|  PREDICTED: metal-nicotianamine transporter Y...    196   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010454747.1|  PREDICTED: metal-nicotianamine transporter Y...    196   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_007211288.1|  hypothetical protein PRUPE_ppa002524mg             196   3e-55   Prunus persica
ref|XP_008374112.1|  PREDICTED: metal-nicotianamine transporter Y...    196   3e-55   
ref|XP_010454749.1|  PREDICTED: metal-nicotianamine transporter Y...    196   3e-55   Camelina sativa [gold-of-pleasure]
ref|NP_001141294.1|  uncharacterized protein LOC100273385               189   3e-55   
ref|XP_009358702.1|  PREDICTED: metal-nicotianamine transporter Y...    196   4e-55   Pyrus x bretschneideri [bai li]
ref|XP_009150965.1|  PREDICTED: metal-nicotianamine transporter YSL2    196   5e-55   Brassica rapa
ref|XP_010442922.1|  PREDICTED: metal-nicotianamine transporter Y...    196   7e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010318047.1|  PREDICTED: metal-nicotianamine transporter Y...    196   7e-55   Solanum lycopersicum
gb|KHN44642.1|  Metal-nicotianamine transporter YSL1                    195   7e-55   Glycine soja [wild soybean]
gb|ABB76763.1|  YSL transporter 3                                       195   8e-55   Noccaea caerulescens
gb|ABD04075.1|  YSL transporter 3                                       195   8e-55   Noccaea caerulescens
gb|EYU40692.1|  hypothetical protein MIMGU_mgv1a002430mg                195   9e-55   Erythranthe guttata [common monkey flower]
dbj|BAB11231.1|  unnamed protein product                                195   9e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006343788.1|  PREDICTED: metal-nicotianamine transporter Y...    195   1e-54   Solanum tuberosum [potatoes]
ref|XP_006593833.1|  PREDICTED: metal-nicotianamine transporter Y...    195   1e-54   
ref|NP_197826.2|  metal-nicotianamine transporter YSL2                  195   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006593836.1|  PREDICTED: metal-nicotianamine transporter Y...    195   1e-54   Glycine max [soybeans]
ref|XP_006593837.1|  PREDICTED: metal-nicotianamine transporter Y...    195   1e-54   
ref|NP_001053449.2|  Os04g0542200                                       194   1e-54   
ref|XP_008239220.1|  PREDICTED: metal-nicotianamine transporter YSL1    194   2e-54   Prunus mume [ume]
gb|EMT08573.1|  Putative metal-nicotianamine transporter YSL9           192   2e-54   
sp|Q7XUJ2.2|YSL9_ORYSJ  RecName: Full=Probable metal-nicotianamin...    194   2e-54   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67443.1|  H0501D11.7                                             194   2e-54   Oryza sativa [red rice]
ref|XP_008390279.1|  PREDICTED: metal-nicotianamine transporter Y...    194   2e-54   
ref|XP_009587674.1|  PREDICTED: metal-nicotianamine transporter Y...    194   2e-54   Nicotiana tomentosiformis
ref|XP_009587676.1|  PREDICTED: metal-nicotianamine transporter Y...    194   2e-54   
ref|XP_006394695.1|  hypothetical protein EUTSA_v10003781mg             194   3e-54   Eutrema salsugineum [saltwater cress]
ref|XP_006350625.1|  PREDICTED: metal-nicotianamine transporter Y...    195   3e-54   
gb|EAZ31500.1|  hypothetical protein OsJ_15637                          194   3e-54   Oryza sativa Japonica Group [Japonica rice]
gb|KJB37387.1|  hypothetical protein B456_006G203200                    194   3e-54   Gossypium raimondii
gb|KFK27715.1|  hypothetical protein AALP_AA8G420300                    194   3e-54   Arabis alpina [alpine rockcress]
ref|XP_009359553.1|  PREDICTED: metal-nicotianamine transporter Y...    194   3e-54   Pyrus x bretschneideri [bai li]
gb|EAY95020.1|  hypothetical protein OsI_16829                          194   3e-54   Oryza sativa Indica Group [Indian rice]
gb|AJP06486.1|  metal-nicotianamine transporter                         194   3e-54   Solanum nigrum
ref|XP_006838312.1|  hypothetical protein AMTR_s00103p00133560          186   4e-54   
ref|XP_011082337.1|  PREDICTED: metal-nicotianamine transporter Y...    193   4e-54   Sesamum indicum [beniseed]
ref|XP_011082339.1|  PREDICTED: metal-nicotianamine transporter Y...    193   4e-54   Sesamum indicum [beniseed]
ref|XP_011082340.1|  PREDICTED: metal-nicotianamine transporter Y...    193   4e-54   Sesamum indicum [beniseed]
ref|XP_009359552.1|  PREDICTED: metal-nicotianamine transporter Y...    194   4e-54   Pyrus x bretschneideri [bai li]
ref|XP_004495506.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    193   5e-54   
ref|XP_010048775.1|  PREDICTED: metal-nicotianamine transporter YSL3    193   5e-54   Eucalyptus grandis [rose gum]
ref|XP_007039405.1|  YELLOW STRIPE like 1 isoform 3                     191   7e-54   
ref|XP_007039160.1|  YELLOW STRIPE like 3 isoform 1                     193   7e-54   
ref|XP_002448252.1|  hypothetical protein SORBIDRAFT_06g024030          193   7e-54   
gb|EMT10300.1|  Putative metal-nicotianamine transporter YSL9           192   8e-54   
ref|XP_009397635.1|  PREDICTED: probable metal-nicotianamine tran...    193   9e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011026765.1|  PREDICTED: metal-nicotianamine transporter Y...    191   1e-53   Populus euphratica
ref|XP_011011616.1|  PREDICTED: metal-nicotianamine transporter Y...    192   1e-53   Populus euphratica
ref|XP_007140990.1|  hypothetical protein PHAVU_008G157800g             192   1e-53   Phaseolus vulgaris [French bean]
ref|XP_007140989.1|  hypothetical protein PHAVU_008G157800g             192   1e-53   Phaseolus vulgaris [French bean]
ref|XP_011026763.1|  PREDICTED: metal-nicotianamine transporter Y...    192   1e-53   Populus euphratica
ref|XP_004498494.1|  PREDICTED: metal-nicotianamine transporter Y...    192   2e-53   
ref|NP_001168540.1|  hypothetical protein                               191   2e-53   Zea mays [maize]
ref|XP_004498492.1|  PREDICTED: metal-nicotianamine transporter Y...    191   2e-53   Cicer arietinum [garbanzo]
ref|XP_008668329.1|  PREDICTED: hypothetical protein isoform X2         192   2e-53   Zea mays [maize]
gb|KEH16132.1|  OPT family oligopeptide transporter                     191   2e-53   Medicago truncatula
ref|XP_007039403.1|  YELLOW STRIPE like 1 isoform 1                     191   3e-53   
ref|XP_009359556.1|  PREDICTED: metal-nicotianamine transporter Y...    191   3e-53   
ref|XP_003588466.1|  Metal-nicotianamine transporter YSL3               191   3e-53   
gb|KDO76708.1|  hypothetical protein CISIN_1g037863mg                   191   4e-53   Citrus sinensis [apfelsine]
gb|EMS59689.1|  putative metal-nicotianamine transporter YSL9           188   4e-53   Triticum urartu
ref|XP_006287225.1|  hypothetical protein CARUB_v10000403mg             191   4e-53   Capsella rubella
ref|XP_010658081.1|  PREDICTED: YS1-like protein-like isoform X1        190   5e-53   Vitis vinifera
emb|CAN77515.1|  hypothetical protein VITISV_013366                     190   5e-53   Vitis vinifera
ref|XP_006476298.1|  PREDICTED: metal-nicotianamine transporter Y...    191   5e-53   Citrus sinensis [apfelsine]
ref|NP_001053450.2|  Os04g0542800                                       190   5e-53   
ref|XP_006653628.1|  PREDICTED: probable metal-nicotianamine tran...    189   5e-53   Oryza brachyantha
gb|EAY95023.1|  hypothetical protein OsI_16833                          191   6e-53   Oryza sativa Indica Group [Indian rice]
emb|CBI34579.3|  unnamed protein product                                190   6e-53   Vitis vinifera
ref|XP_008360215.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    190   7e-53   
emb|CDO99601.1|  unnamed protein product                                190   8e-53   Coffea canephora [robusta coffee]
ref|XP_008367109.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    190   8e-53   
ref|XP_010100194.1|  Metal-nicotianamine transporter YSL1               190   8e-53   Morus notabilis
gb|EMS63506.1|  putative metal-nicotianamine transporter YSL9           189   1e-52   Triticum urartu
ref|XP_011026790.1|  PREDICTED: metal-nicotianamine transporter Y...    189   1e-52   Populus euphratica
ref|XP_006439232.1|  hypothetical protein CICLE_v10019189mg             189   1e-52   
ref|XP_011026792.1|  PREDICTED: metal-nicotianamine transporter Y...    189   1e-52   Populus euphratica
ref|XP_008661601.1|  PREDICTED: uncharacterized protein LOC100273...    189   1e-52   
ref|XP_008661599.1|  PREDICTED: uncharacterized protein LOC100273...    189   2e-52   
ref|XP_003588469.1|  Metal-nicotianamine transporter YSL2               188   3e-52   Medicago truncatula
gb|KEH42903.1|  OPT family oligopeptide transporter                     188   3e-52   Medicago truncatula
ref|XP_007151963.1|  hypothetical protein PHAVU_004G090100g             188   3e-52   Phaseolus vulgaris [French bean]
ref|XP_002299431.1|  hypothetical protein POPTR_0001s11310g             188   4e-52   
ref|XP_010541874.1|  PREDICTED: metal-nicotianamine transporter YSL1    187   5e-52   Tarenaya hassleriana [spider flower]
ref|NP_001266881.1|  probable metal-nicotianamine transporter YSL...    187   5e-52   Brachypodium distachyon [annual false brome]
ref|XP_003588462.1|  Metal-nicotianamine transporter YSL2               191   5e-52   
ref|NP_001268107.1|  YS1-like protein-like                              187   6e-52   Vitis vinifera
gb|AFP55583.1|  yellow stripe-like protein                              188   7e-52   Rosa rugosa [Japanese rose]
ref|XP_010676897.1|  PREDICTED: metal-nicotianamine transporter Y...    187   1e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011470899.1|  PREDICTED: metal-nicotianamine transporter YSL1    187   1e-51   Fragaria vesca subsp. vesca
gb|KEH35475.1|  OPT family oligopeptide transporter                     186   2e-51   Medicago truncatula
ref|XP_002518903.1|  oligopeptide transporter, putative                 186   2e-51   Ricinus communis
ref|XP_007161580.1|  hypothetical protein PHAVU_001G081600g             185   4e-51   Phaseolus vulgaris [French bean]
ref|XP_002299420.2|  hypothetical protein POPTR_0001s11510g             185   5e-51   
ref|XP_006413472.1|  hypothetical protein EUTSA_v10024600mg             184   7e-51   Eutrema salsugineum [saltwater cress]
ref|XP_010433812.1|  PREDICTED: metal-nicotianamine transporter Y...    184   1e-50   Camelina sativa [gold-of-pleasure]
emb|CAB51655.1|  putative protein                                       184   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439083.1|  PREDICTED: metal-nicotianamine transporter YSL1    184   1e-50   Camelina sativa [gold-of-pleasure]
gb|AFU82907.1|  yellow stripe-like transporter 1                        184   1e-50   Arachis hypogaea [goober]
ref|XP_010448607.1|  PREDICTED: metal-nicotianamine transporter Y...    184   1e-50   
ref|XP_006606419.1|  PREDICTED: metal-nicotianamine transporter Y...    184   1e-50   Glycine max [soybeans]
ref|XP_003556427.1|  PREDICTED: metal-nicotianamine transporter Y...    184   1e-50   Glycine max [soybeans]
gb|KHN04996.1|  Metal-nicotianamine transporter YSL1                    183   2e-50   Glycine soja [wild soybean]
ref|XP_006283265.1|  hypothetical protein CARUB_v10004301mg             183   2e-50   Capsella rubella
ref|XP_002869737.1|  hypothetical protein ARALYDRAFT_492451             183   2e-50   
emb|CDX76329.1|  BnaA08g10710D                                          183   2e-50   
emb|CDY03488.1|  BnaC01g15940D                                          183   2e-50   
ref|XP_009137708.1|  PREDICTED: metal-nicotianamine transporter Y...    183   2e-50   Brassica rapa
ref|NP_567694.2|  metal-nicotianamine transporter YSL1                  183   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AAB63613.1|  unknown protein                                         183   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011470187.1|  PREDICTED: metal-nicotianamine transporter Y...    183   2e-50   Fragaria vesca subsp. vesca
ref|XP_009137713.1|  PREDICTED: metal-nicotianamine transporter Y...    183   2e-50   Brassica rapa
gb|AAS00691.1|  metal-nicotianamine transporter YSL1                    183   3e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CDY35455.1|  BnaC03g62050D                                          182   3e-50   Brassica napus [oilseed rape]
gb|ADE77032.1|  unknown                                                 173   4e-50   Picea sitchensis
gb|AAK62460.1|AF387015_1  putative protein                              182   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006849121.1|  hypothetical protein AMTR_s00027p00045420          182   5e-50   
ref|XP_008437732.1|  PREDICTED: metal-nicotianamine transporter YSL1    179   6e-50   Cucumis melo [Oriental melon]
gb|KFK28976.1|  hypothetical protein AALP_AA7G072600                    181   8e-50   Arabis alpina [alpine rockcress]
gb|KDP25199.1|  hypothetical protein JCGZ_20355                         181   1e-49   Jatropha curcas
ref|XP_004143842.1|  PREDICTED: metal-nicotianamine transporter Y...    181   1e-49   Cucumis sativus [cucumbers]
emb|CDX92615.1|  BnaC07g38730D                                          180   3e-49   
ref|XP_010541500.1|  PREDICTED: metal-nicotianamine transporter Y...    179   5e-49   Tarenaya hassleriana [spider flower]
ref|XP_010541499.1|  PREDICTED: metal-nicotianamine transporter Y...    179   6e-49   
ref|XP_009109308.1|  PREDICTED: metal-nicotianamine transporter Y...    179   6e-49   Brassica rapa
emb|CDY24797.1|  BnaA08g15130D                                          179   7e-49   Brassica napus [oilseed rape]
gb|KHN14758.1|  Metal-nicotianamine transporter YSL1                    179   9e-49   Glycine soja [wild soybean]
ref|XP_010240193.1|  PREDICTED: probable metal-nicotianamine tran...    179   1e-48   Brachypodium distachyon [annual false brome]
ref|XP_003536174.2|  PREDICTED: metal-nicotianamine transporter Y...    179   1e-48   Glycine max [soybeans]
ref|XP_009137417.1|  PREDICTED: metal-nicotianamine transporter Y...    178   1e-48   Brassica rapa
ref|XP_008801346.1|  PREDICTED: probable metal-nicotianamine tran...    176   1e-48   Phoenix dactylifera
ref|XP_003580253.1|  PREDICTED: probable metal-nicotianamine tran...    178   1e-48   Brachypodium distachyon [annual false brome]
gb|EMS50094.1|  putative metal-nicotianamine transporter YSL16          177   1e-48   Triticum urartu
gb|EMT14696.1|  hypothetical protein F775_52546                         178   2e-48   
dbj|BAL02122.1|  putative iron-phytosiderophore transporter             177   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004976411.1|  PREDICTED: probable metal-nicotianamine tran...    177   2e-48   Setaria italica
ref|XP_004976410.1|  PREDICTED: probable metal-nicotianamine tran...    177   3e-48   
ref|XP_008801345.1|  PREDICTED: probable metal-nicotianamine tran...    177   3e-48   Phoenix dactylifera
ref|XP_010676898.1|  PREDICTED: metal-nicotianamine transporter Y...    176   5e-48   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAG88718.1|  unnamed protein product                                170   7e-48   Oryza sativa Japonica Group [Japonica rice]
gb|EEE57481.1|  hypothetical protein OsJ_07730                          176   9e-48   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD26553.1|  putative iron-phytosiderophore transporter prote...    176   9e-48   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001047586.2|  Os02g0649900                                       176   1e-47   
dbj|BAD72770.1|  YS1-like metal-nicotianamine transporter               175   1e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003572763.1|  PREDICTED: metal-nicotianamine transporter YSL2    175   1e-47   Brachypodium distachyon [annual false brome]
ref|XP_006847869.1|  hypothetical protein AMTR_s00029p00088690          171   2e-47   
ref|XP_004138807.1|  PREDICTED: probable metal-nicotianamine tran...    175   2e-47   Cucumis sativus [cucumbers]
ref|XP_004158540.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    175   2e-47   
gb|EMS67667.1|  Metal-nicotianamine transporter YSL2                    173   2e-47   Triticum urartu
ref|NP_001266844.1|  iron-phytosiderophore transporter YSL15-like       174   3e-47   Brachypodium distachyon [annual false brome]
ref|XP_006648886.1|  PREDICTED: metal-nicotianamine transporter Y...    174   3e-47   
ref|XP_009384580.1|  PREDICTED: probable metal-nicotianamine tran...    174   3e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001232821.1|  uncharacterized protein LOC100272237               164   5e-47   
ref|XP_010943908.1|  PREDICTED: probable metal-nicotianamine tran...    174   5e-47   Elaeis guineensis
ref|XP_006652534.1|  PREDICTED: probable metal-nicotianamine tran...    172   5e-47   Oryza brachyantha
ref|XP_006847871.1|  hypothetical protein AMTR_s00029p00090440          169   6e-47   
gb|EMT14354.1|  Iron-phytosiderophore transporter YSL15                 173   7e-47   
gb|ACK57536.1|  iron/phytosiderophore transporter                       172   1e-46   Avena sativa [cultivated oat]
gb|EPS62701.1|  hypothetical protein M569_12087                         172   1e-46   Genlisea aurea
ref|XP_002449540.1|  hypothetical protein SORBIDRAFT_05g018520          173   1e-46   
ref|XP_010069525.1|  PREDICTED: probable metal-nicotianamine tran...    172   2e-46   
dbj|BAH98158.1|  yellow stripe 1-like                                   172   2e-46   
gb|EAY86906.1|  hypothetical protein OsI_08289                          171   3e-46   
ref|XP_002512906.1|  hypothetical protein RCOM_1447130                  160   3e-46   
gb|EAZ24007.1|  hypothetical protein OsJ_07732                          169   3e-46   
gb|EMT32978.1|  Iron-phytosiderophore transporter YSL15                 171   3e-46   
gb|EMS57967.1|  putative metal-nicotianamine transporter YSL9           171   4e-46   
gb|EMT18668.1|  Iron-phytosiderophore transporter YSL15                 171   4e-46   
ref|XP_006648887.1|  PREDICTED: iron-phytosiderophore transporter...    171   4e-46   
dbj|BAE71187.1|  iron-phytosiderophore transporter                      171   4e-46   
gb|KCW57904.1|  hypothetical protein EUGRSUZ_H00651                     171   6e-46   
gb|EMS52213.1|  putative metal-nicotianamine transporter YSL13          170   6e-46   
ref|XP_008465519.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    170   8e-46   
gb|EMT24510.1|  Putative metal-nicotianamine transporter YSL13          171   8e-46   
sp|Q6H3Z3.1|YSL15_ORYSJ  RecName: Full=Iron-phytosiderophore tran...    170   9e-46   
ref|XP_010112079.1|  putative metal-nicotianamine transporter YSL8      164   9e-46   
ref|XP_002981992.1|  hypothetical protein SELMODRAFT_179245             170   1e-45   
ref|XP_010025985.1|  PREDICTED: probable metal-nicotianamine tran...    171   1e-45   
ref|XP_004978143.1|  PREDICTED: probable metal-nicotianamine tran...    170   1e-45   
ref|XP_008669136.1|  PREDICTED: probable metal-nicotianamine tran...    170   1e-45   
ref|NP_001266822.1|  iron-phytosiderophore transporter YSL15-like       170   1e-45   
ref|XP_006648859.1|  PREDICTED: probable metal-nicotianamine tran...    169   2e-45   
ref|XP_003575422.1|  PREDICTED: probable metal-nicotianamine tran...    169   2e-45   
ref|XP_009413131.1|  PREDICTED: probable metal-nicotianamine tran...    169   2e-45   
ref|XP_010933277.1|  PREDICTED: probable metal-nicotianamine tran...    169   2e-45   
ref|XP_003581442.1|  PREDICTED: probable metal-nicotianamine tran...    169   2e-45   
ref|XP_009383038.1|  PREDICTED: probable metal-nicotianamine tran...    168   4e-45   
ref|XP_002986072.1|  hypothetical protein SELMODRAFT_123451             168   4e-45   
sp|Q6H7J6.1|YSL14_ORYSJ  RecName: Full=Probable metal-nicotianami...    168   5e-45   
dbj|BAE44205.1|  hypothetical protein                                   168   5e-45   
ref|XP_002510093.1|  oligopeptide transporter, putative                 168   6e-45   
gb|EEE57430.1|  hypothetical protein OsJ_07631                          168   6e-45   
gb|EAY86805.1|  hypothetical protein OsI_08181                          168   7e-45   
gb|AFU82910.1|  yellow stripe-like transporter 6                        159   9e-45   
ref|XP_006653608.1|  PREDICTED: probable metal-nicotianamine tran...    167   9e-45   
ref|XP_010086691.1|  putative metal-nicotianamine transporter YSL8      164   1e-44   
ref|XP_009794095.1|  PREDICTED: probable metal-nicotianamine tran...    167   1e-44   
sp|Q7XKF4.2|YSL13_ORYSJ  RecName: Full=Probable metal-nicotianami...    167   1e-44   
emb|CAI44637.1|  OSJNBb0065J09.17                                       167   1e-44   
emb|CAH67885.1|  OSIGBa0153E02-OSIGBa0093I20.14                         167   1e-44   
emb|CDO98563.1|  unnamed protein product                                166   1e-44   
ref|XP_009794096.1|  PREDICTED: probable metal-nicotianamine tran...    166   1e-44   
gb|EAZ31384.1|  hypothetical protein OsJ_15512                          167   2e-44   
ref|NP_001185468.1|  yellow stripe-like transporter 12                  167   2e-44   
ref|NP_001053351.1|  Os04g0524600                                       166   2e-44   
gb|EEC77667.1|  hypothetical protein OsI_16700                          166   2e-44   
ref|XP_009415880.1|  PREDICTED: probable metal-nicotianamine tran...    166   2e-44   
ref|XP_008645969.1|  PREDICTED: probable metal-nicotianamine tran...    167   2e-44   
sp|Q5JQD7.2|YSL12_ORYSJ  RecName: Full=Probable metal-nicotianami...    167   2e-44   
ref|XP_008779403.1|  PREDICTED: probable metal-nicotianamine tran...    166   2e-44   
ref|XP_009415879.1|  PREDICTED: probable metal-nicotianamine tran...    167   2e-44   
ref|NP_001053350.1|  Os04g0524500                                       166   2e-44   
dbj|BAE91892.1|  hypothetical protein                                   166   2e-44   
ref|XP_009615008.1|  PREDICTED: probable metal-nicotianamine tran...    165   2e-44   
ref|XP_002452834.1|  hypothetical protein SORBIDRAFT_04g033340          166   2e-44   
ref|XP_009615007.1|  PREDICTED: probable metal-nicotianamine tran...    166   2e-44   
ref|XP_008466879.1|  PREDICTED: probable metal-nicotianamine tran...    154   3e-44   
ref|XP_002446809.1|  hypothetical protein SORBIDRAFT_06g023010          166   3e-44   
ref|XP_006845873.1|  hypothetical protein AMTR_s00154p00064710          157   3e-44   
gb|EMS54492.1|  putative metal-nicotianamine transporter YSL14          165   4e-44   
ref|XP_008676713.1|  PREDICTED: uncharacterized protein LOC100272...    166   4e-44   
ref|XP_009111552.1|  PREDICTED: probable metal-nicotianamine tran...    165   5e-44   
emb|CDY00170.1|  BnaC09g01310D                                          165   5e-44   
ref|XP_004976283.1|  PREDICTED: probable metal-nicotianamine tran...    166   5e-44   
gb|ACL83357.2|  yellow stripe-like protein 6.4                          165   5e-44   
ref|XP_010514385.1|  PREDICTED: probable metal-nicotianamine tran...    165   6e-44   
ref|XP_010502660.1|  PREDICTED: probable metal-nicotianamine tran...    165   6e-44   
ref|XP_008780049.1|  PREDICTED: probable metal-nicotianamine tran...    160   6e-44   
ref|XP_010425438.1|  PREDICTED: probable metal-nicotianamine tran...    165   6e-44   
gb|KJB75155.1|  hypothetical protein B456_012G027400                    165   7e-44   
gb|EMT24509.1|  Putative metal-nicotianamine transporter YSL12          165   7e-44   
ref|XP_002452492.1|  hypothetical protein SORBIDRAFT_04g026840          165   7e-44   
tpg|DAA38140.1|  TPA: hypothetical protein ZEAMMB73_580403              160   9e-44   
ref|NP_001152285.1|  yellow stripe-like transporter 14A                 164   1e-43   
ref|XP_004953195.1|  PREDICTED: probable metal-nicotianamine tran...    165   1e-43   
ref|XP_010037026.1|  PREDICTED: probable metal-nicotianamine tran...    164   1e-43   
ref|XP_006845869.1|  hypothetical protein AMTR_s00154p00062710          157   1e-43   
ref|NP_001052640.2|  Os04g0390500                                       157   1e-43   
ref|XP_009420946.1|  PREDICTED: probable metal-nicotianamine tran...    164   2e-43   
gb|KFK33623.1|  hypothetical protein AALP_AA5G037700                    163   2e-43   
ref|XP_006653335.1|  PREDICTED: probable metal-nicotianamine tran...    166   2e-43   
gb|AEX10900.1|  hypothetical protein 0_1078_01                          153   2e-43   
ref|XP_003580167.1|  PREDICTED: probable metal-nicotianamine tran...    164   2e-43   
ref|XP_009402082.1|  PREDICTED: probable metal-nicotianamine tran...    164   2e-43   
gb|ACE77055.2|  yellow stripe-like protein 6.1                          163   3e-43   
ref|XP_002877011.1|  hypothetical protein ARALYDRAFT_904909             163   3e-43   
gb|AAS00695.1|  metal-nicotianamine transporter YSL6                    163   3e-43   
ref|XP_008231092.1|  PREDICTED: probable metal-nicotianamine tran...    163   3e-43   
ref|XP_010913001.1|  PREDICTED: probable metal-nicotianamine tran...    163   3e-43   
ref|XP_007152542.1|  hypothetical protein PHAVU_004G138900g             163   3e-43   
gb|AAM64930.1|  unknown                                                 163   3e-43   
ref|XP_006395492.1|  hypothetical protein EUTSA_v10003758mg             163   3e-43   
ref|XP_006363210.1|  PREDICTED: probable metal-nicotianamine tran...    163   3e-43   
gb|AAM53283.1|  unknown protein                                         163   3e-43   
ref|NP_566806.1|  putative metal-nicotianamine transporter YSL6         163   3e-43   
gb|EMT06635.1|  Putative metal-nicotianamine transporter YSL14          163   3e-43   
ref|XP_006290684.1|  hypothetical protein CARUB_v10016778mg             163   3e-43   
gb|ACU22673.1|  unknown                                                 158   3e-43   
ref|XP_004163579.1|  PREDICTED: metal-nicotianamine transporter Y...    163   3e-43   
ref|XP_004143944.1|  PREDICTED: metal-nicotianamine transporter Y...    163   4e-43   
ref|XP_010940334.1|  PREDICTED: probable metal-nicotianamine tran...    163   4e-43   
gb|EMT18669.1|  hypothetical protein F775_42295                         159   4e-43   
emb|CDY20064.1|  BnaA09g01870D                                          165   4e-43   
ref|XP_002525883.1|  oligopeptide transporter, putative                 163   5e-43   
ref|XP_004306307.1|  PREDICTED: probable metal-nicotianamine tran...    162   5e-43   
ref|XP_011468195.1|  PREDICTED: probable metal-nicotianamine tran...    162   5e-43   
gb|AEX10894.1|  hypothetical protein 0_1078_01                          152   5e-43   
gb|EMT14396.1|  Putative metal-nicotianamine transporter YSL13          162   5e-43   
ref|XP_002298639.1|  oligopeptide transporter OPT family protein        162   6e-43   
ref|XP_008436975.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    162   6e-43   
gb|KHG22766.1|  putative metal-nicotianamine transporter YSL6 -li...    162   6e-43   
ref|XP_007031922.1|  YELLOW STRIPE like 6                               162   6e-43   
ref|XP_010248248.1|  PREDICTED: probable metal-nicotianamine tran...    151   7e-43   
emb|CBI34580.3|  unnamed protein product                                161   8e-43   
ref|XP_010659999.1|  PREDICTED: metal-nicotianamine transporter Y...    162   9e-43   
ref|XP_011098916.1|  PREDICTED: probable metal-nicotianamine tran...    162   9e-43   
ref|XP_011098915.1|  PREDICTED: probable metal-nicotianamine tran...    162   9e-43   
dbj|BAJ92335.1|  predicted protein                                      162   9e-43   
gb|AEX10893.1|  hypothetical protein 0_1078_01                          151   9e-43   
dbj|BAJ89062.1|  predicted protein                                      162   9e-43   
gb|KJB70679.1|  hypothetical protein B456_011G086700                    161   1e-42   
ref|XP_010556294.1|  PREDICTED: probable metal-nicotianamine tran...    161   1e-42   
ref|XP_002305689.1|  hypothetical protein POPTR_0004s06790g             161   1e-42   
gb|KDP41617.1|  hypothetical protein JCGZ_16024                         161   1e-42   
ref|XP_008798980.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    160   1e-42   
ref|XP_004975420.1|  PREDICTED: probable metal-nicotianamine tran...    161   1e-42   
gb|KDP41791.1|  hypothetical protein JCGZ_26809                         161   1e-42   
gb|AFK38640.1|  unknown                                                 152   1e-42   
ref|XP_011035385.1|  PREDICTED: probable metal-nicotianamine tran...    161   2e-42   
ref|XP_004234495.1|  PREDICTED: probable metal-nicotianamine tran...    161   2e-42   
ref|XP_010112394.1|  putative metal-nicotianamine transporter YSL6      160   2e-42   
ref|XP_006405407.1|  hypothetical protein EUTSA_v10027673mg             160   2e-42   
emb|CBI27128.3|  unnamed protein product                                160   2e-42   
gb|KGN63126.1|  hypothetical protein Csa_2G404780                       160   2e-42   
ref|XP_004138639.1|  PREDICTED: probable metal-nicotianamine tran...    160   2e-42   
ref|XP_011000961.1|  PREDICTED: probable metal-nicotianamine tran...    160   3e-42   
ref|XP_011035386.1|  PREDICTED: probable metal-nicotianamine tran...    160   3e-42   
ref|XP_002446309.1|  hypothetical protein SORBIDRAFT_06g013960          160   3e-42   
ref|XP_010249085.1|  PREDICTED: probable metal-nicotianamine tran...    160   3e-42   
gb|KHN13497.1|  Putative metal-nicotianamine transporter YSL6           159   3e-42   
ref|XP_010028979.1|  PREDICTED: probable metal-nicotianamine tran...    160   4e-42   
ref|XP_007215002.1|  hypothetical protein PRUPE_ppa002401mg             160   4e-42   
ref|XP_004158539.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    160   4e-42   
gb|EYU31834.1|  hypothetical protein MIMGU_mgv1a002047mg                160   4e-42   
emb|CAN72423.1|  hypothetical protein VITISV_014262                     160   4e-42   
ref|XP_002279707.1|  PREDICTED: probable metal-nicotianamine tran...    160   4e-42   
ref|XP_010112419.1|  putative metal-nicotianamine transporter YSL7      160   4e-42   
ref|XP_003533289.1|  PREDICTED: probable metal-nicotianamine tran...    160   4e-42   
ref|XP_006343309.1|  PREDICTED: probable metal-nicotianamine tran...    160   4e-42   
gb|KHM99726.1|  Putative metal-nicotianamine transporter YSL7           159   4e-42   
ref|NP_001131175.1|  hypothetical protein                               160   4e-42   
ref|XP_009346778.1|  PREDICTED: probable metal-nicotianamine tran...    160   4e-42   
ref|XP_009346777.1|  PREDICTED: probable metal-nicotianamine tran...    160   5e-42   
ref|XP_004953295.1|  PREDICTED: iron-phytosiderophore transporter...    159   5e-42   
ref|XP_006604157.1|  PREDICTED: probable metal-nicotianamine tran...    159   5e-42   
ref|XP_003553947.1|  PREDICTED: probable metal-nicotianamine tran...    159   5e-42   
ref|XP_009344229.1|  PREDICTED: probable metal-nicotianamine tran...    159   5e-42   
ref|XP_009344228.1|  PREDICTED: probable metal-nicotianamine tran...    159   5e-42   
ref|XP_006844631.1|  hypothetical protein AMTR_s00016p00228960          159   6e-42   
ref|XP_008240337.1|  PREDICTED: probable metal-nicotianamine tran...    160   6e-42   
gb|KEH34580.1|  OPT family oligopeptide transporter                     159   6e-42   
gb|KCW48661.1|  hypothetical protein EUGRSUZ_K02316                     159   6e-42   
ref|NP_001104952.1|  iron-phytosiderophore transporter yellow str...    159   7e-42   
ref|XP_003548294.1|  PREDICTED: probable metal-nicotianamine tran...    159   7e-42   
ref|XP_010037025.1|  PREDICTED: probable metal-nicotianamine tran...    159   7e-42   
ref|XP_008646002.1|  PREDICTED: probable metal-nicotianamine tran...    159   8e-42   
ref|XP_008362099.1|  PREDICTED: probable metal-nicotianamine tran...    159   8e-42   
ref|XP_006372618.1|  hypothetical protein POPTR_0017s03290g             158   8e-42   
ref|XP_008644257.1|  PREDICTED: iron-phytosiderophore transporter...    159   8e-42   
ref|XP_008646003.1|  PREDICTED: probable metal-nicotianamine tran...    159   8e-42   
ref|XP_011046070.1|  PREDICTED: probable metal-nicotianamine tran...    159   8e-42   
gb|KDP27275.1|  hypothetical protein JCGZ_21006                         159   9e-42   
gb|AFW72573.1|  hypothetical protein ZEAMMB73_694561                    159   9e-42   
emb|CDP01724.1|  unnamed protein product                                157   9e-42   
ref|XP_002452833.1|  hypothetical protein SORBIDRAFT_04g033330          159   9e-42   
ref|XP_010037024.1|  PREDICTED: probable metal-nicotianamine tran...    159   1e-41   
ref|XP_008450132.1|  PREDICTED: probable metal-nicotianamine tran...    159   1e-41   
ref|XP_006372621.1|  hypothetical protein POPTR_0017s03320g             159   1e-41   
ref|XP_004148009.1|  PREDICTED: probable metal-nicotianamine tran...    159   1e-41   
ref|XP_009405479.1|  PREDICTED: probable metal-nicotianamine tran...    159   1e-41   
ref|XP_007210334.1|  hypothetical protein PRUPE_ppa002002mg             159   1e-41   
ref|XP_009593058.1|  PREDICTED: probable metal-nicotianamine tran...    159   1e-41   
emb|CAH66436.1|  OSIGBa0132D06.2                                        158   1e-41   
dbj|BAE91886.1|  hypothetical protein                                   158   1e-41   
gb|AEQ28191.1|  yellow stripe-like protein 6                            158   1e-41   
ref|XP_009798435.1|  PREDICTED: probable metal-nicotianamine tran...    159   1e-41   
ref|XP_008379097.1|  PREDICTED: probable metal-nicotianamine tran...    158   2e-41   
gb|KGN64213.1|  hypothetical protein Csa_1G043160                       158   2e-41   
ref|XP_007211297.1|  hypothetical protein PRUPE_ppa001999mg             159   2e-41   
gb|KHN28282.1|  Putative metal-nicotianamine transporter YSL6           157   2e-41   
ref|XP_006384094.1|  hypothetical protein POPTR_0004s06780g             157   2e-41   
gb|EYU25678.1|  hypothetical protein MIMGU_mgv1a002252mg                158   2e-41   
ref|XP_004137637.1|  PREDICTED: probable metal-nicotianamine tran...    158   2e-41   
sp|Q7XRV2.1|YSL6_ORYSJ  RecName: Full=Probable metal-nicotianamin...    158   2e-41   
ref|XP_003549112.1|  PREDICTED: probable metal-nicotianamine tran...    158   2e-41   
gb|EAZ30539.1|  hypothetical protein OsJ_14587                          158   2e-41   
ref|XP_011097988.1|  PREDICTED: probable metal-nicotianamine tran...    158   2e-41   
ref|XP_004233770.1|  PREDICTED: probable metal-nicotianamine tran...    158   2e-41   
ref|XP_006372356.1|  hypothetical protein POPTR_0017s00820g             157   2e-41   
ref|XP_002452832.1|  hypothetical protein SORBIDRAFT_04g033320          157   3e-41   
ref|XP_007029356.1|  YELLOW STRIPE like 5                               157   3e-41   
gb|KDP22031.1|  hypothetical protein JCGZ_03001                         157   3e-41   
emb|CDP18194.1|  unnamed protein product                                157   3e-41   
ref|XP_006372357.1|  hypothetical protein POPTR_0017s00830g             152   4e-41   
ref|XP_011046069.1|  PREDICTED: probable metal-nicotianamine tran...    157   4e-41   
emb|CBG76262.1|  OO_Ba0005L10-OO_Ba0081K17.13                           157   4e-41   
ref|XP_011046072.1|  PREDICTED: probable metal-nicotianamine tran...    157   4e-41   
ref|XP_006372622.1|  iron transporter-related family protein            157   4e-41   
ref|XP_011046074.1|  PREDICTED: probable metal-nicotianamine tran...    157   4e-41   
ref|XP_011046073.1|  PREDICTED: probable metal-nicotianamine tran...    157   5e-41   
ref|XP_004165464.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    157   5e-41   
sp|Q0J932.2|YSL10_ORYSJ  RecName: Full=Probable metal-nicotianami...    157   6e-41   
emb|CAE03239.2|  OSJNBa0018M05.14                                       157   6e-41   
gb|KCW83950.1|  hypothetical protein EUGRSUZ_B00835                     156   6e-41   
gb|EPS61530.1|  hypothetical protein M569_13263                         156   6e-41   
ref|NP_001054241.1|  Os04g0674600                                       157   7e-41   
ref|XP_006372355.1|  hypothetical protein POPTR_0017s00810g             155   7e-41   
gb|AFG69714.1|  hypothetical protein 2_2304_01                          147   8e-41   
ref|XP_010032362.1|  PREDICTED: probable metal-nicotianamine tran...    156   8e-41   
gb|KEH26876.1|  OPT family oligopeptide transporter                     155   8e-41   



>ref|XP_009763791.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X3 [Nicotiana sylvestris]
Length=636

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA++ANL++D++PK++GKW+PLPMAMAVPFLVGASF
Sbjct  511  AILGVEGFSALPQHCLQLCYGFFAFAILANLVRDVAPKSIGKWVPLPMAMAVPFLVGASF  570

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY WH++N  KA+LMVPAVASGLICGDGLWILP SILALAKV  PICM F
Sbjct  571  AIDMCVGSLVVYLWHKVNSNKASLMVPAVASGLICGDGLWILPSSILALAKVNPPICMNF  630

Query  361  LPAKAS  378
            L  K S
Sbjct  631  LATKIS  636



>ref|XP_009763789.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Nicotiana sylvestris]
Length=668

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA++ANL++D++PK++GKW+PLPMAMAVPFLVGASF
Sbjct  543  AILGVEGFSALPQHCLQLCYGFFAFAILANLVRDVAPKSIGKWVPLPMAMAVPFLVGASF  602

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY WH++N  KA+LMVPAVASGLICGDGLWILP SILALAKV  PICM F
Sbjct  603  AIDMCVGSLVVYLWHKVNSNKASLMVPAVASGLICGDGLWILPSSILALAKVNPPICMNF  662

Query  361  LPAKAS  378
            L  K S
Sbjct  663  LATKIS  668



>ref|XP_009763790.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Nicotiana sylvestris]
Length=662

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA++ANL++D++PK++GKW+PLPMAMAVPFLVGASF
Sbjct  537  AILGVEGFSALPQHCLQLCYGFFAFAILANLVRDVAPKSIGKWVPLPMAMAVPFLVGASF  596

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY WH++N  KA+LMVPAVASGLICGDGLWILP SILALAKV  PICM F
Sbjct  597  AIDMCVGSLVVYLWHKVNSNKASLMVPAVASGLICGDGLWILPSSILALAKVNPPICMNF  656

Query  361  LPAKAS  378
            L  K S
Sbjct  657  LATKIS  662



>gb|KHN19530.1| Metal-nicotianamine transporter YSL3 [Glycine soja]
Length=687

 Score =   215 bits (548),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FA+ ANL++DL+PKN+GKWIPLPMAMAVPFLVG  F
Sbjct  562  AILGVEGFSALPHHCLQLCYGFFAFAIAANLVRDLAPKNIGKWIPLPMAMAVPFLVGGYF  621

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSLVV+ WH+LNR +A LMVPAVASGLICGDGLWILP SILAL K++ PICM+F
Sbjct  622  AIDMCMGSLVVFLWHKLNRNEAGLMVPAVASGLICGDGLWILPSSILALFKIRPPICMSF  681

Query  361  LPAKAS  378
            L A AS
Sbjct  682  LSASAS  687



>ref|XP_003523338.2| PREDICTED: metal-nicotianamine transporter YSL3-like isoformX1 
[Glycine max]
Length=687

 Score =   215 bits (548),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FA+ ANL++DL+PKN+GKWIPLPMAMAVPFLVG  F
Sbjct  562  AILGVEGFSALPHHCLQLCYGFFAFAIAANLVRDLAPKNIGKWIPLPMAMAVPFLVGGYF  621

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSLVV+ WH+LNR +A LMVPAVASGLICGDGLWILP SILAL K++ PICM+F
Sbjct  622  AIDMCMGSLVVFLWHKLNRNEAGLMVPAVASGLICGDGLWILPSSILALFKIRPPICMSF  681

Query  361  LPAKAS  378
            L A AS
Sbjct  682  LSASAS  687



>gb|AFU82909.1| yellow stripe-like transporter 3.2, partial [Arachis hypogaea]
Length=263

 Score =   205 bits (521),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFSTLPQHCLQLCYGFF FA+ ANL++DLSPK VG+WIPLPMAMAVPFLVG  F
Sbjct  140  AILGVEGFSTLPQHCLQLCYGFFAFAIAANLVRDLSPKKVGRWIPLPMAMAVPFLVGGYF  199

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY WH+L  ++A+LMVPAVASGLICGDGLWILP SILAL  V  P+CM+F
Sbjct  200  AIDMCVGSLVVYAWHKLKSEEASLMVPAVASGLICGDGLWILPSSILALFGVHPPMCMSF  259

Query  361  LPAK  372
              +K
Sbjct  260  FSSK  263



>ref|XP_006578879.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Glycine max]
 ref|XP_006578880.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X3 [Glycine max]
Length=676

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FA+ ANL++DL+PKN+GKWIPLPMAMAVPFLVG  F
Sbjct  551  AILGVEGFSALPHHCLQLCYGFFAFAIAANLVRDLAPKNIGKWIPLPMAMAVPFLVGGYF  610

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSLVV+ WH+LNR +A LMVPAVASGLICGDGLWILP SILAL K++ PICM+F
Sbjct  611  AIDMCMGSLVVFLWHKLNRNEAGLMVPAVASGLICGDGLWILPSSILALFKIRPPICMSF  670

Query  361  LPAKAS  378
            L A AS
Sbjct  671  LSASAS  676



>emb|CDP05015.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   214 bits (546),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA VANL +D++PK +GKW+PLPMAMAVPFLVGA F
Sbjct  548  AILGVEGFSALPQHCLQLCYGFFAFAFVANLFRDITPKKIGKWVPLPMAMAVPFLVGAYF  607

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY WH+LN +KATLMVPAVASG+ICGDGLWILP SILAL KV  PICM+F
Sbjct  608  AIDMCVGSLVVYVWHKLNSRKATLMVPAVASGMICGDGLWILPSSILALFKVNPPICMSF  667

Query  361  LPA  369
            LP 
Sbjct  668  LPT  670



>gb|KDO59687.1| hypothetical protein CISIN_1g0442261mg, partial [Citrus sinensis]
Length=403

 Score =   208 bits (530),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANLL+DLSPK + KWIPLPMAMAVPFLVGA F
Sbjct  281  AILGVEGFSALPQHCLQLCYGFFAFAIAANLLRDLSPKKIAKWIPLPMAMAVPFLVGAYF  340

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ WH+LN K A LM+PAVASGLICGDGLWILP SILALA V+ PICM F
Sbjct  341  AIDMCLGSLVVFAWHKLNSKNADLMIPAVASGLICGDGLWILPSSILALANVRPPICMKF  400

Query  361  LPA  369
            L +
Sbjct  401  LAS  403



>gb|KDP30688.1| hypothetical protein JCGZ_16395 [Jatropha curcas]
Length=661

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA++ANL +DLSPKNVGKWIPLPMAMAVPFLVGA F
Sbjct  538  AILGVEGFSALPQHCLQLCYGFFAFAILANLARDLSPKNVGKWIPLPMAMAVPFLVGAYF  597

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM +GSL+V+ WH+LN+KKA LM+PAVASGLICGDGLWILP S+LALAKV  PICM+F
Sbjct  598  AIDMSVGSLIVFGWHKLNKKKAGLMIPAVASGLICGDGLWILPSSVLALAKVHPPICMSF  657

Query  361  LPAK  372
            L +K
Sbjct  658  LKSK  661



>ref|XP_011075924.1| PREDICTED: LOW QUALITY PROTEIN: metal-nicotianamine transporter 
YSL3 [Sesamum indicum]
Length=664

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FA++ANLL+D+ P+  GKW+PLPMAMAVPFLVGA F
Sbjct  539  AILGVEGFSALPHHCLQLCYGFFAFAVLANLLRDIMPEKFGKWVPLPMAMAVPFLVGAYF  598

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY WH++N +KA+LMVPAVASGLICGDGLWILP SILALAK+  PICM F
Sbjct  599  AIDMCVGSLVVYVWHKVNSRKASLMVPAVASGLICGDGLWILPSSILALAKINPPICMNF  658

Query  361  LPAKAS  378
            LP K+S
Sbjct  659  LPTKSS  664



>ref|XP_007136481.1| hypothetical protein PHAVU_009G048800g [Phaseolus vulgaris]
 ref|XP_007136482.1| hypothetical protein PHAVU_009G048800g [Phaseolus vulgaris]
 gb|ESW08475.1| hypothetical protein PHAVU_009G048800g [Phaseolus vulgaris]
 gb|ESW08476.1| hypothetical protein PHAVU_009G048800g [Phaseolus vulgaris]
Length=673

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL++DL PK VGKWIPLPMAMAVPFLVG  F
Sbjct  548  AILGVEGFSALPQHCLQLCYGFFAFAVAANLVRDLGPKKVGKWIPLPMAMAVPFLVGGYF  607

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSLVV+ WH+LN+ +A LMVPAVASGLICGDGLWILP SILAL KV+ PICM+F
Sbjct  608  AIDMCMGSLVVFMWHKLNKSEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICMSF  667

Query  361  LPAKAS  378
            L A AS
Sbjct  668  LSASAS  673



>gb|KJB37388.1| hypothetical protein B456_006G203200 [Gossypium raimondii]
Length=443

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQ+CLQLCYGFF FA+ ANLL+D +PKN+GKWIP+PMAMAVPFLVGA F
Sbjct  320  AILGVQGFSALPQYCLQLCYGFFSFAIAANLLRDFTPKNIGKWIPIPMAMAVPFLVGAYF  379

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL V+ WH+LNRKKA+LMVPAVASGLICGDGLW+LP SILAL K + PICMTF
Sbjct  380  AIDMCVGSLAVFAWHKLNRKKASLMVPAVASGLICGDGLWLLPSSILALFKARPPICMTF  439

Query  361  L  363
            L
Sbjct  440  L  440



>ref|XP_008456007.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X3 [Cucumis 
melo]
Length=563

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+VANLL+DL+PK  GKWIPLPMAMAVPFLVGA F
Sbjct  439  AILGVEGFSALPQHCLQLCYGFFSFAIVANLLRDLTPKKFGKWIPLPMAMAVPFLVGAYF  498

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH LNR++A LM+PAVASGLICG+GLWILP SILALAKV  PICM F
Sbjct  499  AIDMCVGSLIVFVWHYLNRQRAELMIPAVASGLICGEGLWILPSSILALAKVHPPICMNF  558

Query  361  LPAKA  375
              +K+
Sbjct  559  FSSKS  563



>gb|KGN57644.1| hypothetical protein Csa_3G238100 [Cucumis sativus]
Length=668

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANLL+DL+PK  GKWIPLPMAMAVPFLVGA F
Sbjct  544  AILGVEGFSALPQHCLQLCYGFFSFAIAANLLRDLTPKKFGKWIPLPMAMAVPFLVGAYF  603

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ WH LNR+KA LMVPAVASGLICG+GLWILP SILALAKV  PICM F
Sbjct  604  AIDMCIGSLVVFVWHYLNRQKAGLMVPAVASGLICGEGLWILPSSILALAKVHPPICMNF  663

Query  361  LPAKA  375
              +K+
Sbjct  664  FSSKS  668



>ref|XP_004146239.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Cucumis 
sativus]
Length=668

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANLL+DL+PK  GKWIPLPMAMAVPFLVGA F
Sbjct  544  AILGVEGFSALPQHCLQLCYGFFSFAIAANLLRDLTPKKFGKWIPLPMAMAVPFLVGAYF  603

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ WH LNR+KA LMVPAVASGLICG+GLWILP SILALAKV  PICM F
Sbjct  604  AIDMCIGSLVVFVWHYLNRQKAGLMVPAVASGLICGEGLWILPSSILALAKVHPPICMNF  663

Query  361  LPAKA  375
              +K+
Sbjct  664  FSSKS  668



>ref|XP_008456005.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X1 [Cucumis 
melo]
Length=669

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+VANLL+DL+PK  GKWIPLPMAMAVPFLVGA F
Sbjct  545  AILGVEGFSALPQHCLQLCYGFFSFAIVANLLRDLTPKKFGKWIPLPMAMAVPFLVGAYF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH LNR++A LM+PAVASGLICG+GLWILP SILALAKV  PICM F
Sbjct  605  AIDMCVGSLIVFVWHYLNRQRAELMIPAVASGLICGEGLWILPSSILALAKVHPPICMNF  664

Query  361  LPAKA  375
              +K+
Sbjct  665  FSSKS  669



>gb|KHG05098.1| Metal-nicotianamine transporter YSL3 -like protein [Gossypium 
arboreum]
Length=668

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQ+CLQLCYGFF FA+ ANLL+D SPKN+GKWIPLPMAMAVPFLVGA F
Sbjct  545  AILGVQGFSALPQYCLQLCYGFFSFAIAANLLRDFSPKNIGKWIPLPMAMAVPFLVGAYF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL V+ WH+LNRKKA+LMVPAVASGLICGDGLW+LP SILAL KV+ PICMTF
Sbjct  605  AIDMCVGSLAVFAWHKLNRKKASLMVPAVASGLICGDGLWLLPSSILALFKVRPPICMTF  664

Query  361  L  363
            L
Sbjct  665  L  665



>ref|XP_002515673.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF46725.1| oligopeptide transporter, putative [Ricinus communis]
Length=671

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA++ANLL+DLSPKN+G+WIPLPMAMAVPFLVGA F
Sbjct  548  AILGVEGFSALPQHCLQLCYGFFSFAILANLLRDLSPKNIGRWIPLPMAMAVPFLVGAYF  607

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM +GSL+V+ WH+LN +KA LM+PAVASGLICGDGLWILP SILALAK+  PICM F
Sbjct  608  AIDMSVGSLIVFVWHKLNNRKAGLMLPAVASGLICGDGLWILPSSILALAKIHPPICMNF  667

Query  361  LPAK  372
            L  K
Sbjct  668  LATK  671



>ref|XP_002318472.2| hypothetical protein POPTR_0012s03180g [Populus trichocarpa]
 ref|XP_006376676.1| hypothetical protein POPTR_0012s03180g [Populus trichocarpa]
 ref|XP_002318482.2| transporter family protein [Populus trichocarpa]
 gb|EEE96692.2| hypothetical protein POPTR_0012s03180g [Populus trichocarpa]
 gb|ERP54473.1| hypothetical protein POPTR_0012s03180g [Populus trichocarpa]
 gb|EEE96702.2| transporter family protein [Populus trichocarpa]
Length=665

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA++ANL +DLSP N+GK++PLPMAMAVPFLVGA F
Sbjct  542  AILGVEGFSALPQHCLQLCYGFFAFAILANLSRDLSPNNIGKYVPLPMAMAVPFLVGAYF  601

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ WH+LN +KA+LMVPAVASGLICGDGLWILP SILALAK++ PICM+F
Sbjct  602  AIDMCVGSLVVFAWHKLNSRKASLMVPAVASGLICGDGLWILPSSILALAKIRPPICMSF  661

Query  361  L  363
            L
Sbjct  662  L  662



>ref|XP_006581667.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Glycine max]
 ref|XP_006581668.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X3 [Glycine max]
 ref|XP_003527996.2| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Glycine max]
 gb|KHN23328.1| Metal-nicotianamine transporter YSL3 [Glycine soja]
Length=676

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FA+ ANL++DL PK +GKWIPLPMAMAVPFLVG  F
Sbjct  551  AILGVEGFSALPHHCLQLCYGFFTFAIAANLVRDLGPKKIGKWIPLPMAMAVPFLVGGYF  610

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSLVV+ WH LNR +A LMVPAVASGLICGDGLWILP SILAL K++ PICM+F
Sbjct  611  AIDMCMGSLVVFLWHTLNRNEAGLMVPAVASGLICGDGLWILPSSILALLKIRPPICMSF  670

Query  361  LPAKAS  378
            L A AS
Sbjct  671  LSASAS  676



>ref|XP_004165023.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Cucumis 
sativus]
Length=668

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANLL+D +PK  GKWIPLPMAMAVPFLVGA F
Sbjct  544  AILGVEGFSALPQHCLQLCYGFFSFAIAANLLRDFAPKKFGKWIPLPMAMAVPFLVGAYF  603

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ WH LNR+KA LMVPAVASGLICG+GLWILP SILALAKV  PICM F
Sbjct  604  AIDMCIGSLVVFVWHYLNRQKAGLMVPAVASGLICGEGLWILPSSILALAKVHPPICMNF  663

Query  361  LPAKA  375
              +K+
Sbjct  664  FSSKS  668



>gb|KJB37389.1| hypothetical protein B456_006G203200 [Gossypium raimondii]
Length=623

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQ+CLQLCYGFF FA+ ANLL+D +PKN+GKWIP+PMAMAVPFLVGA F
Sbjct  500  AILGVQGFSALPQYCLQLCYGFFSFAIAANLLRDFTPKNIGKWIPIPMAMAVPFLVGAYF  559

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL V+ WH+LNRKKA+LMVPAVASGLICGDGLW+LP SILAL K + PICMTF
Sbjct  560  AIDMCVGSLAVFAWHKLNRKKASLMVPAVASGLICGDGLWLLPSSILALFKARPPICMTF  619

Query  361  L  363
            L
Sbjct  620  L  620



>ref|XP_011043727.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Populus euphratica]
Length=655

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA++ANL +DLSP N+GK++PLPMAMAVPFLVGA F
Sbjct  532  AILGVEGFSALPQHCLQLCYGFFAFAILANLSRDLSPNNIGKYVPLPMAMAVPFLVGAYF  591

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC GSLVV+ WH+LN +KA+LM+PAVASGLICGDGLWILP SILALAK++ PICM+F
Sbjct  592  AIDMCGGSLVVFVWHKLNSRKASLMIPAVASGLICGDGLWILPSSILALAKIRPPICMSF  651

Query  361  L  363
            L
Sbjct  652  L  652



>ref|XP_006441189.1| hypothetical protein CICLE_v10019170mg [Citrus clementina]
 gb|ESR54429.1| hypothetical protein CICLE_v10019170mg [Citrus clementina]
Length=667

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANLL+DLSPK + KWIPLPMAMAVPFLVGA F
Sbjct  545  AILGVEGFSALPQHCLQLCYGFFAFAIAANLLRDLSPKKIAKWIPLPMAMAVPFLVGAYF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ WH+LN K A LM+PAVASGLICGDGLWILP SILALA V+ PICM F
Sbjct  605  AIDMCLGSLVVFAWHKLNSKNADLMIPAVASGLICGDGLWILPSSILALANVRPPICMKF  664

Query  361  LPA  369
            L +
Sbjct  665  LAS  667



>ref|XP_006491954.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X7 [Citrus sinensis]
Length=667

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANLL+DLSPK + KWIPLPMAMAVPFLVGA F
Sbjct  545  AILGVEGFSALPQHCLQLCYGFFAFAIAANLLRDLSPKKIAKWIPLPMAMAVPFLVGAYF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ WH+LN K A LM+PAVASGLICGDGLWILP SILALA V+ PICM F
Sbjct  605  AIDMCLGSLVVFAWHKLNSKNADLMIPAVASGLICGDGLWILPSSILALANVRPPICMKF  664

Query  361  LPA  369
            L +
Sbjct  665  LAS  667



>ref|XP_006491948.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Citrus sinensis]
 ref|XP_006491949.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Citrus sinensis]
 ref|XP_006491950.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X3 [Citrus sinensis]
 ref|XP_006491951.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X4 [Citrus sinensis]
 ref|XP_006491952.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X5 [Citrus sinensis]
 ref|XP_006491953.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X6 [Citrus sinensis]
Length=673

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANLL+DLSPK + KWIPLPMAMAVPFLVGA F
Sbjct  551  AILGVEGFSALPQHCLQLCYGFFAFAIAANLLRDLSPKKIAKWIPLPMAMAVPFLVGAYF  610

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ WH+LN K A LM+PAVASGLICGDGLWILP SILALA V+ PICM F
Sbjct  611  AIDMCLGSLVVFAWHKLNSKNADLMIPAVASGLICGDGLWILPSSILALANVRPPICMKF  670

Query  361  LPA  369
            L +
Sbjct  671  LAS  673



>ref|XP_011043724.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Populus euphratica]
 ref|XP_011043725.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Populus euphratica]
 ref|XP_011043726.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Populus euphratica]
Length=665

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA++ANL +DLSP N+GK++PLPMAMAVPFLVGA F
Sbjct  542  AILGVEGFSALPQHCLQLCYGFFAFAILANLSRDLSPNNIGKYVPLPMAMAVPFLVGAYF  601

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC GSLVV+ WH+LN +KA+LM+PAVASGLICGDGLWILP SILALAK++ PICM+F
Sbjct  602  AIDMCGGSLVVFVWHKLNSRKASLMIPAVASGLICGDGLWILPSSILALAKIRPPICMSF  661

Query  361  L  363
            L
Sbjct  662  L  662



>ref|XP_006441190.1| hypothetical protein CICLE_v10019170mg [Citrus clementina]
 gb|ESR54430.1| hypothetical protein CICLE_v10019170mg [Citrus clementina]
Length=673

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANLL+DLSPK + KWIPLPMAMAVPFLVGA F
Sbjct  551  AILGVEGFSALPQHCLQLCYGFFAFAIAANLLRDLSPKKIAKWIPLPMAMAVPFLVGAYF  610

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ WH+LN K A LM+PAVASGLICGDGLWILP SILALA V+ PICM F
Sbjct  611  AIDMCLGSLVVFAWHKLNSKNADLMIPAVASGLICGDGLWILPSSILALANVRPPICMKF  670

Query  361  LPA  369
            L +
Sbjct  671  LAS  673



>ref|XP_009361313.1| PREDICTED: metal-nicotianamine transporter YSL2 [Pyrus x bretschneideri]
Length=671

 Score =   209 bits (533),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HCLQLCYGFF FA+ ANLL+DL+P  +GKW+PLPMAMAVPFLVGA F
Sbjct  548  AILGVEGFSALPKHCLQLCYGFFSFAIAANLLRDLAPTKIGKWVPLPMAMAVPFLVGAYF  607

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSLVV+ WH+L + KA+LM+PAVASGLICGDG+WILP SILALAKV+ PICM F
Sbjct  608  AIDMCMGSLVVFVWHKLKKNKASLMIPAVASGLICGDGMWILPSSILALAKVQPPICMNF  667

Query  361  LPAK  372
            L  K
Sbjct  668  LATK  671



>gb|KJB37386.1| hypothetical protein B456_006G203200 [Gossypium raimondii]
 gb|KJB37390.1| hypothetical protein B456_006G203200 [Gossypium raimondii]
Length=668

 Score =   209 bits (532),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQ+CLQLCYGFF FA+ ANLL+D +PKN+GKWIP+PMAMAVPFLVGA F
Sbjct  545  AILGVQGFSALPQYCLQLCYGFFSFAIAANLLRDFTPKNIGKWIPIPMAMAVPFLVGAYF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL V+ WH+LNRKKA+LMVPAVASGLICGDGLW+LP SILAL K + PICMTF
Sbjct  605  AIDMCVGSLAVFAWHKLNRKKASLMVPAVASGLICGDGLWLLPSSILALFKARPPICMTF  664

Query  361  L  363
            L
Sbjct  665  L  665



>ref|XP_006431856.1| hypothetical protein CICLE_v10003961mg [Citrus clementina]
 gb|ESR45096.1| hypothetical protein CICLE_v10003961mg [Citrus clementina]
Length=673

 Score =   209 bits (532),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP+HCLQLCYGFF FA+ ANLL+DLSPK +GKWIPLPMAMAVPFLVGA F
Sbjct  551  AILGVQGFSALPRHCLQLCYGFFAFAIAANLLRDLSPKKIGKWIPLPMAMAVPFLVGAYF  610

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W +LN+KKA LM+PAVASGLICGDGLWILP SILALAK++ PICM F
Sbjct  611  AIDMCVGSLIVFVWQKLNKKKAELMIPAVASGLICGDGLWILPSSILALAKIRPPICMKF  670

Query  361  LPA  369
            L +
Sbjct  671  LAS  673



>gb|KDO53476.1| hypothetical protein CISIN_1g047730mg [Citrus sinensis]
Length=673

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP+HCLQLCYGFF FA+ ANLL+DLSPK +GKWIPLPMAMAVPFLVGA F
Sbjct  551  AILGVQGFSALPRHCLQLCYGFFAFAIAANLLRDLSPKKIGKWIPLPMAMAVPFLVGAYF  610

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W +LN+KKA LM+PAVASGLICGDGLWILP SILALAK++ PICM F
Sbjct  611  AIDMCVGSLIVFVWQKLNKKKADLMIPAVASGLICGDGLWILPSSILALAKIRPPICMKF  670

Query  361  LPA  369
            L +
Sbjct  671  LAS  673



>ref|XP_006471126.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Citrus 
sinensis]
Length=673

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP+HCLQLCYGFF FA+ ANLL+DLSPK +GKWIPLPMAMAVPFLVGA F
Sbjct  551  AILGVQGFSALPRHCLQLCYGFFAFAIAANLLRDLSPKKIGKWIPLPMAMAVPFLVGAYF  610

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W +LN+KKA LM+PAVASGLICGDGLWILP SILALAK++ PICM F
Sbjct  611  AIDMCVGSLIVFVWQKLNKKKADLMIPAVASGLICGDGLWILPSSILALAKIRPPICMKF  670

Query  361  LPA  369
            L +
Sbjct  671  LAS  673



>ref|XP_008381368.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Malus domestica]
Length=671

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+  NLL+DL+PK +GK++PLPMAMAVPFLVGA F
Sbjct  548  AILGVEGFSALPQHCLQLCYGFFSFAIATNLLRDLAPKKIGKYVPLPMAMAVPFLVGAYF  607

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSLVV+ WH+LN  KA+ MVPAVASGLICGDGLWILP SILALAK++ PICM F
Sbjct  608  AIDMCMGSLVVFVWHKLNNNKASSMVPAVASGLICGDGLWILPSSILALAKIQPPICMNF  667

Query  361  LPAK  372
            L  K
Sbjct  668  LANK  671



>ref|XP_009765494.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009765501.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009765507.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009765514.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Nicotiana sylvestris]
Length=675

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FA++ANL++D++PK  GKW+PLPMAMAVPFL  ASF
Sbjct  550  AILGVEGFSALPNHCLQLCYGFFAFAVIANLVRDITPKRFGKWVPLPMAMAVPFLNNASF  609

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+VY WH+LN KKA+LMVPAVASGLICGDGLWILP ++LAL KVK PICMTF
Sbjct  610  AIDMCVGSLIVYVWHKLNSKKASLMVPAVASGLICGDGLWILPSALLALVKVKPPICMTF  669

Query  361  LPAKAS  378
               + S
Sbjct  670  TVGQTS  675



>ref|XP_009765519.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X2 [Nicotiana sylvestris]
Length=674

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FA++ANL++D++PK  GKW+PLPMAMAVPFL  ASF
Sbjct  549  AILGVEGFSALPNHCLQLCYGFFAFAVIANLVRDITPKRFGKWVPLPMAMAVPFLNNASF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+VY WH+LN KKA+LMVPAVASGLICGDGLWILP ++LAL KVK PICMTF
Sbjct  609  AIDMCVGSLIVYVWHKLNSKKASLMVPAVASGLICGDGLWILPSALLALVKVKPPICMTF  668

Query  361  LPAKAS  378
               + S
Sbjct  669  TVGQTS  674



>gb|KJB19873.1| hypothetical protein B456_003G122700 [Gossypium raimondii]
Length=665

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQLCYGFF FA+ ANLL+D SPKN+GKW+PLPMAMAVPFLVGA F
Sbjct  542  AILGVQGFSALPHHCLQLCYGFFAFAIAANLLRDFSPKNIGKWVPLPMAMAVPFLVGAYF  601

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ WH+LN KKA LMVPAVASGLICGDGLW+LP SILAL KV+ PICM+F
Sbjct  602  AIDMCVGSLVVFAWHKLNGKKADLMVPAVASGLICGDGLWLLPSSILALFKVRPPICMSF  661

Query  361  LPA  369
              +
Sbjct  662  FAS  664



>ref|XP_008376798.1| PREDICTED: metal-nicotianamine transporter YSL3 [Malus domestica]
Length=671

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HCLQLCYGFF FA+ ANLL+DL+P  +GKW+P PMAMAVPFLVGA F
Sbjct  548  AILGVEGFSALPKHCLQLCYGFFSFAIAANLLRDLAPTKIGKWVPFPMAMAVPFLVGAYF  607

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSLVV+ WH+L + KA+LM+PAVASGLICGDG+WILP SILALAKV+ PICM F
Sbjct  608  AIDMCMGSLVVFVWHKLKKNKASLMIPAVASGLICGDGMWILPSSILALAKVQPPICMNF  667

Query  361  LPAK  372
            L  K
Sbjct  668  LATK  671



>ref|XP_011084545.1| PREDICTED: LOW QUALITY PROTEIN: metal-nicotianamine transporter 
YSL3 [Sesamum indicum]
Length=655

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FA++ANLL+D+ P+  GKW+PLPMAMAVPFLVGA F
Sbjct  530  AILGVEGFSALPHHCLQLCYGFFAFAVLANLLRDVGPEKYGKWVPLPMAMAVPFLVGAYF  589

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY WH+++ +KA LM+PAVASGLICGDGLWILP SILALAK+  PICM+F
Sbjct  590  AIDMCVGSLVVYIWHKIDSRKAGLMIPAVASGLICGDGLWILPSSILALAKINPPICMSF  649

Query  361  LPAKAS  378
            LP  ++
Sbjct  650  LPTAST  655



>ref|XP_010482756.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Camelina sativa]
Length=406

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL++DLSP+ +GKW+PLPMAMAVPFLVG  F
Sbjct  282  AILGVEGFSALPQHCLQLCYGFFSFAVAANLVRDLSPEKIGKWVPLPMAMAVPFLVGGYF  341

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W+  +R KA LM+PAVASGLICGDGLWILP S+LALA V+ PICM+F
Sbjct  342  AIDMCVGSLIVFAWNMRDRVKAGLMIPAVASGLICGDGLWILPSSVLALAGVRPPICMSF  401

Query  361  LPAK  372
            +P+K
Sbjct  402  MPSK  405



>emb|CBI23058.3| unnamed protein product [Vitis vinifera]
Length=649

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLC GFF+FA+ ANL++DLSP  +GKWIPLPMAMAVPFLVGA F
Sbjct  527  AILGVEGFSALPHHCLQLCCGFFIFAIAANLVRDLSPSKIGKWIPLPMAMAVPFLVGAYF  586

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSLVV+ WH++N KKA+LMVPAVASGLICGDGLWILP S+LALAK+  PICM+F
Sbjct  587  AIDMCMGSLVVFVWHKVNSKKASLMVPAVASGLICGDGLWILPSSVLALAKINPPICMSF  646

Query  361  L  363
            L
Sbjct  647  L  647



>ref|XP_010671369.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=656

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCY FF FA+ ANL++D SPK +GKWIPLPMAMAVPFLVGA F
Sbjct  534  AILGVQGFSALPQHCLQLCYAFFGFAIFANLVRDTSPKKIGKWIPLPMAMAVPFLVGAYF  593

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ WHRLN +KA+LM+PAVASGLICGDG WILP SILALAK+K PICMTF
Sbjct  594  AIDMCLGSLVVFVWHRLNSQKASLMIPAVASGLICGDGFWILPSSILALAKLKPPICMTF  653



>ref|XP_007039161.1| YELLOW STRIPE like 3 isoform 2 [Theobroma cacao]
 ref|XP_007039162.1| YELLOW STRIPE like 3 isoform 2 [Theobroma cacao]
 gb|EOY23662.1| YELLOW STRIPE like 3 isoform 2 [Theobroma cacao]
 gb|EOY23663.1| YELLOW STRIPE like 3 isoform 2 [Theobroma cacao]
Length=668

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGFF FA+ ANLL+D +PKN+GKW PLPMAMAVPFLVGA F
Sbjct  545  AILGVQGFSALPQHCLQLCYGFFSFAIAANLLRDFTPKNIGKWAPLPMAMAVPFLVGAYF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ WH+LN KKA LM+PAVASGLICGDGLW+LP SILAL KV+ PICM F
Sbjct  605  AIDMCVGSLVVFAWHKLNGKKAGLMIPAVASGLICGDGLWLLPSSILALFKVRPPICMNF  664

Query  361  L  363
            L
Sbjct  665  L  665



>ref|XP_002274166.1| PREDICTED: metal-nicotianamine transporter YSL3 [Vitis vinifera]
Length=665

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLC GFF+FA+ ANL++DLSP  +GKWIPLPMAMAVPFLVGA F
Sbjct  543  AILGVEGFSALPHHCLQLCCGFFIFAIAANLVRDLSPSKIGKWIPLPMAMAVPFLVGAYF  602

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSLVV+ WH++N KKA+LMVPAVASGLICGDGLWILP S+LALAK+  PICM+F
Sbjct  603  AIDMCMGSLVVFVWHKVNSKKASLMVPAVASGLICGDGLWILPSSVLALAKINPPICMSF  662

Query  361  L  363
            L
Sbjct  663  L  663



>ref|XP_010671364.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010671365.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010671366.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010671367.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=662

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCY FF FA+ ANL++D SPK +GKWIPLPMAMAVPFLVGA F
Sbjct  540  AILGVQGFSALPQHCLQLCYAFFGFAIFANLVRDTSPKKIGKWIPLPMAMAVPFLVGAYF  599

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ WHRLN +KA+LM+PAVASGLICGDG WILP SILALAK+K PICMTF
Sbjct  600  AIDMCLGSLVVFVWHRLNSQKASLMIPAVASGLICGDGFWILPSSILALAKLKPPICMTF  659



>gb|ADN33766.1| YSL transporter [Cucumis melo subsp. melo]
Length=535

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+VANLL+DL+ +  GKWIPLPM MAVPFLVGA F
Sbjct  410  AILGVEGFSALPQHCLQLCYGFFSFAIVANLLRDLTLEKFGKWIPLPMVMAVPFLVGAYF  469

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH LNR+KA LMVPAVASGLICG+GLWILP SILALAK+  PICM+F
Sbjct  470  AIDMCVGSLIVFVWHYLNREKAGLMVPAVASGLICGEGLWILPSSILALAKIHPPICMSF  529

Query  361  LPAKAS  378
              +  S
Sbjct  530  FSSSKS  535



>ref|XP_010034897.1| PREDICTED: metal-nicotianamine transporter YSL2-like [Eucalyptus 
grandis]
 gb|KCW46094.1| hypothetical protein EUGRSUZ_K00010 [Eucalyptus grandis]
Length=668

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HCLQLCYGFF FA++ANL +DLSPKN+GKW+P+PMAMAVPFLVGA+F
Sbjct  545  AILGVEGFSALPKHCLQLCYGFFGFAVLANLARDLSPKNIGKWVPIPMAMAVPFLVGANF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH+LN KKA L+VPA ASGLICGDGLWILP +ILALAK+  PICM F
Sbjct  605  AIDMCVGSLIVFVWHKLNSKKAALLVPAAASGLICGDGLWILPSAILALAKIHPPICMNF  664

Query  361  LPAK  372
            L  +
Sbjct  665  LKGE  668



>gb|KGN65329.1| hypothetical protein Csa_1G329900 [Cucumis sativus]
Length=617

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+VANLL+DL+ +  GKWIPLPM MAVPFLVGA F
Sbjct  492  AILGVEGFSALPQHCLQLCYGFFSFAIVANLLRDLTLEKFGKWIPLPMVMAVPFLVGAYF  551

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSL+V+ WH LNR+KA LMVPAVASGLICG+GLWILP SILALAK+  PICM+F
Sbjct  552  AIDMCMGSLIVFVWHYLNREKAGLMVPAVASGLICGEGLWILPSSILALAKIHPPICMSF  611

Query  361  LPAKAS  378
              +  S
Sbjct  612  FSSSKS  617



>ref|XP_004172903.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Cucumis 
sativus]
Length=670

 Score =   207 bits (526),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+VANLL+DL+ +  GKWIPLPM MAVPFLVGA F
Sbjct  545  AILGVEGFSALPQHCLQLCYGFFSFAIVANLLRDLTLEKFGKWIPLPMVMAVPFLVGAYF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSL+V+ WH LNR+KA LMVPAVASGLICG+GLWILP SILALAK+  PICM+F
Sbjct  605  AIDMCMGSLIVFVWHYLNREKAGLMVPAVASGLICGEGLWILPSSILALAKIHPPICMSF  664

Query  361  LPAKAS  378
              +  S
Sbjct  665  FSSSKS  670



>emb|CAN77891.1| hypothetical protein VITISV_016271 [Vitis vinifera]
Length=677

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLC GFF+FA+ ANL++DLSP  +GKWIPLPMAMAVPFLVGA F
Sbjct  555  AILGVEGFSALPHHCLQLCCGFFIFAIAANLVRDLSPSKIGKWIPLPMAMAVPFLVGAYF  614

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSLVV+ WH+ N KKA+LMVPAVASGLICGDGLWILP S+LALAK+  PICM+F
Sbjct  615  AIDMCMGSLVVFVWHKXNSKKASLMVPAVASGLICGDGLWILPSSVLALAKINPPICMSF  674

Query  361  L  363
            L
Sbjct  675  L  675



>ref|XP_004150025.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Cucumis 
sativus]
Length=670

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+VANLL+DL+ +  GKWIPLPM MAVPFLVGA F
Sbjct  545  AILGVEGFSALPQHCLQLCYGFFSFAIVANLLRDLTLEKFGKWIPLPMVMAVPFLVGAYF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSL+V+ WH LNR+KA LMVPAVASGLICG+GLWILP SILALAK+  PICM+F
Sbjct  605  AIDMCMGSLIVFVWHYLNREKAGLMVPAVASGLICGEGLWILPSSILALAKIHPPICMSF  664

Query  361  LPAKAS  378
              +  S
Sbjct  665  FSSSKS  670



>ref|XP_010445924.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X2 [Camelina 
sativa]
Length=406

 Score =   201 bits (512),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL++DLSP+  GKW+PLPMAMAVPFLVG  F
Sbjct  282  AILGVEGFSALPQHCLQLCYGFFSFAVAANLVRDLSPEKFGKWVPLPMAMAVPFLVGGYF  341

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W+  +R KA LM+PAVASGLICGDGLWILP S+LALA V+ PICM+F
Sbjct  342  AIDMCVGSLIVFAWNMRDRVKAGLMIPAVASGLICGDGLWILPSSVLALAGVRPPICMSF  401

Query  361  LPAK  372
            +P+K
Sbjct  402  MPSK  405



>ref|XP_009351940.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Pyrus x 
bretschneideri]
Length=671

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+  NLL+DL+P  +GK++PLPMAMAVPFLVGA F
Sbjct  548  AILGVEGFSALPQHCLQLCYGFFSFAIATNLLRDLAPTKIGKYVPLPMAMAVPFLVGAYF  607

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSLVV+ WH+L   KA+LMVPAVASGLICGDGLWILP SILALAKV+ PICM F
Sbjct  608  AIDMCMGSLVVFVWHKLKNNKASLMVPAVASGLICGDGLWILPSSILALAKVQPPICMNF  667

Query  361  LPAK  372
            L  K
Sbjct  668  LANK  671



>ref|XP_007220212.1| hypothetical protein PRUPE_ppa002475mg [Prunus persica]
 gb|EMJ21411.1| hypothetical protein PRUPE_ppa002475mg [Prunus persica]
Length=669

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGFF FA+ ANLL+DL+PK +GKW+PLPMAMAVPFLVGA F
Sbjct  546  AILGVQGFSALPQHCLQLCYGFFAFAVAANLLRDLAPKKIGKWVPLPMAMAVPFLVGAYF  605

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL V+ WH+L   +A LMVPAVASGLICGDGLWILP SILALAK++ PICM F
Sbjct  606  AIDMCVGSLAVFVWHKLKNNEAGLMVPAVASGLICGDGLWILPSSILALAKIRPPICMNF  665

Query  361  LPAK  372
            L  K
Sbjct  666  LTTK  669



>gb|AEQ28192.1| yellow stripe-like protein 3 [Malus baccata var. xiaojinensis]
Length=671

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+  NLL+DL+PK +GK++PLPMAMAVPFLVGA F
Sbjct  548  AILGVEGFSALPQHCLQLCYGFFSFAIATNLLRDLAPKKIGKYVPLPMAMAVPFLVGAYF  607

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSLVV+ WH+L   KA+ MVPAVASGLICGDGLWILP SILALAK++ PICM F
Sbjct  608  AIDMCMGSLVVFVWHKLKNNKASSMVPAVASGLICGDGLWILPSSILALAKIQPPICMNF  667

Query  361  LPAK  372
            L  K
Sbjct  668  LANK  671



>ref|XP_009119903.1| PREDICTED: metal-nicotianamine transporter YSL3 [Brassica rapa]
 ref|XP_009119904.1| PREDICTED: metal-nicotianamine transporter YSL3 [Brassica rapa]
 ref|XP_009119905.1| PREDICTED: metal-nicotianamine transporter YSL3 [Brassica rapa]
Length=674

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL++D+SP+ +GKW+PLPMAMAVPFLVG  F
Sbjct  551  AILGVEGFSALPQHCLQLCYGFFAFAVAANLVRDMSPEKIGKWVPLPMAMAVPFLVGGYF  610

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W++ +R KA LMVPAVASGLICGDGLWILP S+LALA VK PICM+F
Sbjct  611  AIDMCVGSLIVFVWNKRDRVKAGLMVPAVASGLICGDGLWILPSSVLALAGVKPPICMSF  670

Query  361  LPAK  372
            +P+K
Sbjct  671  MPSK  674



>emb|CDY20248.1| BnaC09g29910D [Brassica napus]
Length=674

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL++D+SP+ +GKW+PLPMAMAVPFLVG  F
Sbjct  551  AILGVEGFSALPQHCLQLCYGFFAFAVAANLVRDMSPEKIGKWVPLPMAMAVPFLVGGYF  610

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W++ +R KA LMVPAVASGLICGDGLWILP S+LALA VK PICM+F
Sbjct  611  AIDMCVGSLIVFVWNKRDRVKAGLMVPAVASGLICGDGLWILPSSVLALAGVKPPICMSF  670

Query  361  LPAK  372
            +P+K
Sbjct  671  MPSK  674



>emb|CDY14371.1| BnaA10g06840D [Brassica napus]
Length=678

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL++D+SP+ +GKW+PLPMAMAVPFLVG  F
Sbjct  555  AILGVEGFSALPQHCLQLCYGFFAFAVAANLVRDMSPEKIGKWVPLPMAMAVPFLVGGYF  614

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W++ +R KA LMVPAVASGLICGDGLWILP S+LALA VK PICM+F
Sbjct  615  AIDMCVGSLIVFVWNKRDRVKAGLMVPAVASGLICGDGLWILPSSVLALAGVKPPICMSF  674

Query  361  LPAK  372
            +P+K
Sbjct  675  MPSK  678



>gb|KHG10996.1| Metal-nicotianamine transporter YSL3 -like protein [Gossypium 
arboreum]
Length=645

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQLCYGFF FA+ ANLL+D SPKN+GKW+PLPMAMAVPFLVGA F
Sbjct  522  AILGVQGFSALPHHCLQLCYGFFAFAIAANLLRDFSPKNIGKWVPLPMAMAVPFLVGAYF  581

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ W++LN KKA LMVPAVASGLICGDGLW+LP SILAL KV+ PICM+F
Sbjct  582  AIDMCVGSLVVFGWYKLNGKKADLMVPAVASGLICGDGLWLLPSSILALFKVRPPICMSF  641

Query  361  LPA  369
              +
Sbjct  642  FAS  644



>gb|AES72566.2| OPT family oligopeptide transporter [Medicago truncatula]
Length=667

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLC GFF FA+VANL++DL P+ VGKWIPLPMAMAVPFLVG  F
Sbjct  544  AILGVEGFSALPDHCLQLCCGFFAFAIVANLVRDLGPQQVGKWIPLPMAMAVPFLVGGYF  603

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ WH LN+K+A LMVPAVASGLICGDGLWILP SILAL KV+ PICM+F
Sbjct  604  AIDMCVGSLVVFAWHMLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICMSF  663

Query  361  LPAK  372
             P++
Sbjct  664  FPSR  667



>ref|XP_003602315.1| YSL transporter [Medicago truncatula]
Length=841

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 117/143 (82%), Gaps = 5/143 (3%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLC GFF FA+VANL++DL P+ VGKWIPLPMAMAVPFLVG  F
Sbjct  565  AILGVEGFSALPDHCLQLCCGFFAFAIVANLVRDLGPQQVGKWIPLPMAMAVPFLVGGYF  624

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ WH LN+K+A LMVPAVASGLICGDGLWILP SILAL KV+ PICM+F
Sbjct  625  AIDMCVGSLVVFAWHMLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICMSF  684

Query  361  LPAKAS*KFKRLALPDTTIRLLE  429
             P++     + L   ++++R+ +
Sbjct  685  FPSR-----RDLTQHNSSLRISQ  702



>ref|XP_008234683.1| PREDICTED: metal-nicotianamine transporter YSL3 [Prunus mume]
Length=669

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGFF FA+ ANLL+DL+PK +GKW+PLPMAMAVPFLVGA F
Sbjct  546  AILGVQGFSALPQHCLQLCYGFFAFAVAANLLRDLAPKKIGKWVPLPMAMAVPFLVGAYF  605

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL V+ WH+L   +A LMVPAVASGLICGDGLWILP SILALA ++ PICM F
Sbjct  606  AIDMCVGSLAVFVWHKLKNNEAGLMVPAVASGLICGDGLWILPSSILALANIRPPICMNF  665

Query  361  LPAK  372
            L  K
Sbjct  666  LATK  669



>dbj|BAF48331.1| putative yellow stripe-like protein [Nicotiana tabacum]
Length=675

 Score =   204 bits (520),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FA++ANL++D++P+  GKW+PLPMAMAVPFL  ASF
Sbjct  551  AILGVEGFSALPNHCLQLCYGFFAFAIIANLVRDITPERFGKWVPLPMAMAVPFLNNASF  610

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+VY WH+LN KKA+LMVPAVASGLICGDGLWILP ++LAL KVK PICM F
Sbjct  611  AIDMCVGSLIVYVWHKLNSKKASLMVPAVASGLICGDGLWILPSALLALVKVKPPICMAF  670

Query  361  LPAKA  375
               +A
Sbjct  671  TVGQA  675



>ref|XP_010035301.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Eucalyptus 
grandis]
 gb|KCW46603.1| hypothetical protein EUGRSUZ_K004131 [Eucalyptus grandis]
 gb|KCW46604.1| hypothetical protein EUGRSUZ_K004131 [Eucalyptus grandis]
Length=668

 Score =   204 bits (518),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HCLQLCYGFF FA++ANL +DL PKN+G W+PLPMAMAVPFLVGA+F
Sbjct  545  AILGVEGFSALPKHCLQLCYGFFGFAVLANLARDLLPKNIGNWVPLPMAMAVPFLVGANF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH+LN KKA L+VPA ASGLICGDGLWILP +ILALAK+  PICM F
Sbjct  605  AIDMCVGSLIVFVWHKLNSKKAALLVPAAASGLICGDGLWILPSAILALAKIHPPICMNF  664

Query  361  LPAK  372
            L  +
Sbjct  665  LKGE  668



>ref|XP_009588595.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009588596.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009588597.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009588598.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009588599.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Nicotiana tomentosiformis]
Length=674

 Score =   204 bits (518),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FA++ANL++D++P+  GKW+PLPMAMAVPFL  ASF
Sbjct  550  AILGVEGFSALPNHCLQLCYGFFAFAIIANLVRDITPERFGKWVPLPMAMAVPFLNNASF  609

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+VY WH+LN KKA+LMVPAVASGLICGDGLWILP ++LAL KVK PICM F
Sbjct  610  AIDMCVGSLIVYVWHKLNSKKASLMVPAVASGLICGDGLWILPSALLALVKVKPPICMAF  669



>ref|XP_009588601.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X2 [Nicotiana tomentosiformis]
Length=673

 Score =   203 bits (517),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FA++ANL++D++P+  GKW+PLPMAMAVPFL  ASF
Sbjct  549  AILGVEGFSALPNHCLQLCYGFFAFAIIANLVRDITPERFGKWVPLPMAMAVPFLNNASF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+VY WH+LN KKA+LMVPAVASGLICGDGLWILP ++LAL KVK PICM F
Sbjct  609  AIDMCVGSLIVYVWHKLNSKKASLMVPAVASGLICGDGLWILPSALLALVKVKPPICMAF  668



>ref|XP_002864249.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40508.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=675

 Score =   203 bits (517),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL++D SP+ +GKW+PLPMAMAVPFLVG  F
Sbjct  549  AILGVEGFSALPQHCLQLCYGFFAFAVAANLVRDWSPEKIGKWVPLPMAMAVPFLVGGYF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W+  +R KA LMVPAVASGLICGDGLWILP S+LALA VK PICM F
Sbjct  609  AIDMCVGSLIVFAWNMRDRVKAGLMVPAVASGLICGDGLWILPSSVLALAGVKPPICMNF  668

Query  361  LPAKAS  378
            +P+K S
Sbjct  669  MPSKYS  674



>gb|EYU19676.1| hypothetical protein MIMGU_mgv1a002464mg [Erythranthe guttata]
Length=671

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HCL+LCYGFF FA+ ANL +DL PK  GKW+PLPMAMAVPFLVG  F
Sbjct  546  AILGVEGFSALPRHCLELCYGFFAFAVAANLSRDLLPKRFGKWVPLPMAMAVPFLVGGYF  605

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            A+DMC+GSLVVY WHR++ +KA  MVPAVASGLICGDGLWILP SILALAK+  PICM+F
Sbjct  606  AVDMCVGSLVVYVWHRVDGRKAGFMVPAVASGLICGDGLWILPSSILALAKINPPICMSF  665

Query  361  LPAKAS  378
            LP   S
Sbjct  666  LPTLRS  671



>ref|XP_008653898.1| PREDICTED: probable metal-nicotianamine transporter YSL16, partial 
[Zea mays]
Length=136

 Score =   189 bits (481),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HC+QLC GFF FA++ANL +DL P+ + + +PLPMAMAVPFLVGASF
Sbjct  13   AILGVEGFSALPRHCMQLCAGFFAFAVLANLARDLLPRRLARLVPLPMAMAVPFLVGASF  72

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            A+DMC+GSLVV+ WHRL+ KKA L+VPAVASGLICGDG+W  P S+LALAKVK PICM F
Sbjct  73   AVDMCVGSLVVFAWHRLDGKKAALLVPAVASGLICGDGIWTFPSSLLALAKVKPPICMKF  132

Query  361  LPAK  372
             P  
Sbjct  133  TPGS  136



>ref|XP_010482755.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Camelina sativa]
Length=673

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL++DLSP+ +GKW+PLPMAMAVPFLVG  F
Sbjct  549  AILGVEGFSALPQHCLQLCYGFFSFAVAANLVRDLSPEKIGKWVPLPMAMAVPFLVGGYF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W+  +R KA LM+PAVASGLICGDGLWILP S+LALA V+ PICM+F
Sbjct  609  AIDMCVGSLIVFAWNMRDRVKAGLMIPAVASGLICGDGLWILPSSVLALAGVRPPICMSF  668

Query  361  LPAKA  375
            +P+K 
Sbjct  669  MPSKT  673



>ref|XP_008649050.1| PREDICTED: probable metal-nicotianamine transporter YSL16 [Zea 
mays]
Length=125

 Score =   189 bits (479),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HC+QLC GFF FA++ANL +DL P+ + + +PLPMAMAVPFLVGASF
Sbjct  2    AILGVEGFSALPRHCMQLCAGFFAFAVLANLARDLLPRRLARLVPLPMAMAVPFLVGASF  61

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            A+DMC+GSLVV+ WHRL+ KKA L+VPAVASGLICGDG+W  P S+LALAKVK PICM F
Sbjct  62   AVDMCVGSLVVFAWHRLDGKKAALLVPAVASGLICGDGIWTFPSSLLALAKVKPPICMKF  121

Query  361  LPAK  372
             P  
Sbjct  122  TPGS  125



>ref|XP_008444004.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Cucumis 
melo]
 ref|XP_008444005.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Cucumis 
melo]
Length=704

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+VANLL+DL+ +  GKWIPLPM MAVPFLVGA F
Sbjct  545  AILGVEGFSALPQHCLQLCYGFFSFAIVANLLRDLTLEKFGKWIPLPMVMAVPFLVGAYF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH LNR+KA LMVPAVASGLICG+GLWILP SILALAK+  PICM+F
Sbjct  605  AIDMCVGSLIVFVWHYLNREKAGLMVPAVASGLICGEGLWILPSSILALAKIHPPICMSF  664

Query  361  L  363
             
Sbjct  665  F  665



>gb|AFU82908.1| yellow stripe-like transporter 3.1 [Arachis hypogaea]
Length=674

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FA+ ANL++DLSPK VG+WIPLPMAMAVPFLVG  F
Sbjct  551  AILGVEGFSALPHHCLQLCYGFFAFAIAANLVRDLSPKKVGRWIPLPMAMAVPFLVGGYF  610

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+VY+WH L  ++A LMVPAVASGLICGDGLWILP S+LAL  V+ PICM+F
Sbjct  611  AIDMCVGSLIVYSWHTLKSEEANLMVPAVASGLICGDGLWILPSSLLALFGVRPPICMSF  670

Query  361  LPAK  372
              +K
Sbjct  671  FTSK  674



>emb|CDX96232.1| BnaC02g14190D [Brassica napus]
Length=672

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ AN++KDLSP+ VGKW+PLPMAMAVPFLVG  F
Sbjct  549  AILGVEGFSALPQHCLQLCYGFFAFAVAANVVKDLSPEKVGKWVPLPMAMAVPFLVGGYF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            A+DMC+GSL+V+ W+  +R KA LMVPA ASGLICGDGLWILP SILALA VK PICM F
Sbjct  609  AVDMCVGSLIVFVWNMRDRVKAGLMVPAAASGLICGDGLWILPSSILALAGVKPPICMRF  668

Query  361  LPAK  372
            +P+K
Sbjct  669  VPSK  672



>ref|XP_010445905.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X1 [Camelina 
sativa]
 ref|XP_010445908.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X1 [Camelina 
sativa]
 ref|XP_010445915.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X1 [Camelina 
sativa]
 ref|XP_010445922.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X1 [Camelina 
sativa]
Length=673

 Score =   202 bits (513),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL++DLSP+  GKW+PLPMAMAVPFLVG  F
Sbjct  549  AILGVEGFSALPQHCLQLCYGFFSFAVAANLVRDLSPEKFGKWVPLPMAMAVPFLVGGYF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W+  +R KA LM+PAVASGLICGDGLWILP S+LALA V+ PICM+F
Sbjct  609  AIDMCVGSLIVFAWNMRDRVKAGLMIPAVASGLICGDGLWILPSSVLALAGVRPPICMSF  668

Query  361  LPAKA  375
            +P+K 
Sbjct  669  MPSKT  673



>ref|XP_006401691.1| hypothetical protein EUTSA_v10012886mg [Eutrema salsugineum]
 dbj|BAJ34221.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ43144.1| hypothetical protein EUTSA_v10012886mg [Eutrema salsugineum]
Length=672

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FA+ ANL++DLSP+ +GKW+PLPMAMAVPFLVG  F
Sbjct  549  AILGVEGFSALPHHCLQLCYGFFAFAVAANLVRDLSPEKIGKWVPLPMAMAVPFLVGGYF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W+  +R KA LM+PAVASGLICGDGLWILP S+LALA V+ PICM+F
Sbjct  609  AIDMCVGSLIVFVWNMRDRVKAGLMIPAVASGLICGDGLWILPSSVLALAGVRPPICMSF  668

Query  361  LPAK  372
            +P+K
Sbjct  669  MPSK  672



>gb|KCW77323.1| hypothetical protein EUGRSUZ_D01684 [Eucalyptus grandis]
Length=475

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP+HCLQLCYGFF FA+ ANL++DL P+ VGKW+PLPMAMA PFLVGA F
Sbjct  353  AILGVQGFSALPRHCLQLCYGFFSFAVAANLIRDLGPRKVGKWMPLPMAMAPPFLVGAYF  412

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
             IDMC+G+L+VY W +LN KKA LMVPAVASGLICG+GLW+LP S+LALAK+K PICM F
Sbjct  413  TIDMCLGTLIVYVWQKLNVKKAELMVPAVASGLICGEGLWVLPASVLALAKIKPPICMKF  472

Query  361  LPA  369
            +P+
Sbjct  473  VPS  475



>ref|XP_008367110.1| PREDICTED: metal-nicotianamine transporter YSL1-like, partial 
[Malus domestica]
Length=285

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGFF FA++ N+++D SPK +GKW+PLPM M VPFLVGA F
Sbjct  164  AILGVQGFSALPQHCLQLCYGFFAFAVLVNIVRDFSPK-IGKWMPLPMVMGVPFLVGAYF  222

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH++N KKA LMVPAVASGLICG+GLW LP S+LALAKVK P+CM F
Sbjct  223  AIDMCIGSLIVFVWHKINSKKAVLMVPAVASGLICGEGLWTLPASVLALAKVKPPMCMKF  282

Query  361  L  363
            L
Sbjct  283  L  283



>ref|XP_004976408.1| PREDICTED: probable metal-nicotianamine transporter YSL9-like 
isoform X2 [Setaria italica]
 ref|XP_004976409.1| PREDICTED: probable metal-nicotianamine transporter YSL9-like 
isoform X3 [Setaria italica]
Length=663

 Score =   201 bits (510),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGFF FA+ +NL++DL P   GKW+PLPMAM VPFLVGASF
Sbjct  540  AILGVQGFSALPQHCLQLCYGFFGFAVASNLMRDLLPPKYGKWVPLPMAMGVPFLVGASF  599

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+TWH ++R KA+LMVPAVASGLICGDGLWILP+S+LALAK+  P+CM F
Sbjct  600  AIDMCVGSLIVFTWHMIDRSKASLMVPAVASGLICGDGLWILPESLLALAKISPPLCMAF  659

Query  361  LP  366
             P
Sbjct  660  RP  661



>ref|XP_009398090.1| PREDICTED: probable metal-nicotianamine transporter YSL9 isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009398091.1| PREDICTED: probable metal-nicotianamine transporter YSL9 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=664

 Score =   201 bits (510),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FA+V N ++D+ P     W+PLPMAMAVPFLVGASF
Sbjct  542  AILGVEGFSALPHHCLQLCYGFFGFAVVMNTMRDILPDKYSHWVPLPMAMAVPFLVGASF  601

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ WH+LNRKKA LMVPAVASGLICGDGLWILP S+LALAKV  PICM F
Sbjct  602  AIDMCVGSLVVFAWHKLNRKKAALMVPAVASGLICGDGLWILPSSLLALAKVNPPICMKF  661

Query  361  LPA  369
            L A
Sbjct  662  LAA  664



>ref|XP_004976407.1| PREDICTED: probable metal-nicotianamine transporter YSL9-like 
isoform X1 [Setaria italica]
Length=685

 Score =   201 bits (511),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGFF FA+ +NL++DL P   GKW+PLPMAM VPFLVGASF
Sbjct  562  AILGVQGFSALPQHCLQLCYGFFGFAVASNLMRDLLPPKYGKWVPLPMAMGVPFLVGASF  621

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+TWH ++R KA+LMVPAVASGLICGDGLWILP+S+LALAK+  P+CM F
Sbjct  622  AIDMCVGSLIVFTWHMIDRSKASLMVPAVASGLICGDGLWILPESLLALAKISPPLCMAF  681

Query  361  LP  366
             P
Sbjct  682  RP  683



>gb|EYU45295.1| hypothetical protein MIMGU_mgv1a002502mg [Erythranthe guttata]
Length=666

 Score =   201 bits (510),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCL LCYGFF FA++ANLL+D+ P   GKW+PLPMAMAVPFLVGA F
Sbjct  541  AILGVEGFSALPHHCLHLCYGFFGFAVLANLLRDVGPGKSGKWVPLPMAMAVPFLVGAYF  600

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY WHR+++ +A +MVPAVASGLICGDGLWILP  ILAL K+  PICM F
Sbjct  601  AIDMCVGSLVVYVWHRIDKVRAPMMVPAVASGLICGDGLWILPSCILALFKISPPICMNF  660

Query  361  LPAKAS  378
            LP+K+S
Sbjct  661  LPSKSS  666



>gb|KHN05985.1| Metal-nicotianamine transporter YSL3-like protein [Glycine soja]
Length=551

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLC GFF FA+  NL++DL+PKN+G+WIPLPMAMAVPF+VG  F
Sbjct  428  AILGVEGFSALPHHCLQLCCGFFAFAVATNLVRDLNPKNIGRWIPLPMAMAVPFVVGGYF  487

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSLVVY W  L  K+A+LMVPA ASGLICGDG WILP SILAL KV  PICM F
Sbjct  488  AIDMCMGSLVVYAWQTLKSKEASLMVPAAASGLICGDGFWILPSSILALFKVHPPICMRF  547

Query  361  LPAK  372
            LP K
Sbjct  548  LPTK  551



>ref|XP_010442924.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Camelina sativa]
Length=406

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLC GFF FA+ ANL++DL P+ +GKW+PLPMAMAVPFLVG  F
Sbjct  282  AILGVEGFSALPQHCLQLCCGFFSFAVAANLVRDLLPEKIGKWVPLPMAMAVPFLVGGYF  341

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W+  +R KA LM+PAVASGLICGDGLWILP S+LALA V+ PICM+F
Sbjct  342  AIDMCVGSLIVFAWNMRDRVKAGLMIPAVASGLICGDGLWILPSSVLALAGVRPPICMSF  401

Query  361  LPAK  372
            +P+K
Sbjct  402  MPSK  405



>emb|CDY70890.1| BnaCnng70180D, partial [Brassica napus]
Length=388

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+G S LP +CL+LCYGFF FA+ ANL +D  P+ VGKWIPLPMAMAVPFLVG SF
Sbjct  265  AIIGVQGLSALPHNCLELCYGFFAFAVAANLARDFLPEKVGKWIPLPMAMAVPFLVGGSF  324

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GS VV+ W ++NRKKA  MVPAVASGLICGDGLWILP S+LALAK++ PICM F
Sbjct  325  AIDMCIGSFVVFIWQKVNRKKAEFMVPAVASGLICGDGLWILPSSLLALAKIRPPICMNF  384

Query  361  LPAK  372
             PA 
Sbjct  385  TPAH  388



>ref|XP_010537056.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X2 [Tarenaya 
hassleriana]
Length=677

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HCL+LCYGFF FA+ ANL +D+ P+NVGKW+PLPMAMAVPFLVG  F
Sbjct  553  AILGVEGFSALPRHCLELCYGFFAFAVAANLARDMLPENVGKWVPLPMAMAVPFLVGGYF  612

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ W+R+++ KA LM+PA+ASGLICGDGLWILP SILALA V  PICM+F
Sbjct  613  AIDMCVGSLVVFVWNRIDKTKARLMIPAIASGLICGDGLWILPSSILALAGVYPPICMSF  672

Query  361  LPAK  372
            +P+ 
Sbjct  673  MPSS  676



>ref|XP_010537055.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X1 [Tarenaya 
hassleriana]
Length=680

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HCL+LCYGFF FA+ ANL +D+ P+NVGKW+PLPMAMAVPFLVG  F
Sbjct  556  AILGVEGFSALPRHCLELCYGFFAFAVAANLARDMLPENVGKWVPLPMAMAVPFLVGGYF  615

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ W+R+++ KA LM+PA+ASGLICGDGLWILP SILALA V  PICM+F
Sbjct  616  AIDMCVGSLVVFVWNRIDKTKARLMIPAIASGLICGDGLWILPSSILALAGVYPPICMSF  675

Query  361  LPAK  372
            +P+ 
Sbjct  676  MPSS  679



>ref|XP_010919337.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL9 [Elaeis guineensis]
Length=665

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA+VANL+KD+ P   GKW+PLPMAMAVPFLVGA+F
Sbjct  543  AILGVQGFSALPHHCLQICYGFFGFAVVANLMKDIFPSKYGKWVPLPMAMAVPFLVGANF  602

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WHRLN  KA LM PAVASGLICGDGLWILP S+LALA+V  PICM F
Sbjct  603  AIDMCLGSLIVFAWHRLNSNKAALMAPAVASGLICGDGLWILPSSLLALARVNPPICMKF  662

Query  361  L  363
            +
Sbjct  663  I  663



>ref|XP_006281523.1| hypothetical protein CARUB_v10027623mg [Capsella rubella]
 gb|EOA14421.1| hypothetical protein CARUB_v10027623mg [Capsella rubella]
Length=672

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL++D SP+ +GKW+PLPMAMAVPFLVG  F
Sbjct  549  AILGVEGFSALPQHCLQLCYGFFAFAVAANLVRDSSPEKIGKWVPLPMAMAVPFLVGGYF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            A+DMC+GSL+V+ W+  ++ KA LMVPAVASGLICGDGLWILP S+LALA V+ PICM+F
Sbjct  609  AVDMCVGSLIVFAWNMRDKVKAGLMVPAVASGLICGDGLWILPSSVLALAGVRPPICMSF  668

Query  361  LPAK  372
            +P+K
Sbjct  669  MPSK  672



>ref|XP_006653627.1| PREDICTED: probable metal-nicotianamine transporter YSL9-like 
[Oryza brachyantha]
Length=621

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL++DLSP   G+W+PLPMAM VPFLVGASF
Sbjct  498  AILGVEGFSALPQHCLQLCYGFFGFAVAANLVRDLSPPKYGRWVPLPMAMGVPFLVGASF  557

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+TWH L++ KA LMVPAVASGLICGDGLWI P S+LALAK+  P+CM F
Sbjct  558  AIDMCIGSLIVFTWHMLDKSKAALMVPAVASGLICGDGLWIFPASLLALAKISPPMCMAF  617



>gb|KHN46380.1| Metal-nicotianamine transporter YSL1 [Glycine soja]
Length=585

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            A+L VEGFS LPQHCLQLCYGFF FA+V N+++DLSP   GKW+PLPM MA+PFLVGA F
Sbjct  463  AVLGVEGFSALPQHCLQLCYGFFAFAVVVNMVRDLSPNVFGKWMPLPMVMAIPFLVGAYF  522

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY WH+LN KKA  M+PA ASGLICG+GLW LP SILALAKV  PICM F
Sbjct  523  AIDMCLGSLVVYVWHKLNTKKAEAMIPATASGLICGEGLWALPASILALAKVNPPICMNF  582

Query  361  LPA  369
            L +
Sbjct  583  LAS  585



>dbj|BAE98794.1| EspB-like protein [Arabidopsis thaliana]
Length=491

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL++D  P  +G W+PLPMAMAVPFLVG  F
Sbjct  365  AILGVEGFSALPQHCLQLCYGFFAFAVAANLVRDRLPDKIGNWVPLPMAMAVPFLVGGYF  424

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W+  +R KA LMVPAVASGLICGDGLWILP S+LALA V+ PICM F
Sbjct  425  AIDMCVGSLIVFAWNMRDRVKAGLMVPAVASGLICGDGLWILPSSVLALAGVRPPICMGF  484

Query  361  LPAKAS  378
            +P+K S
Sbjct  485  MPSKYS  490



>ref|XP_003551122.2| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Glycine max]
Length=669

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLC GFF FA+  NL++DL+PKN+G+WIPLPMAMAVPF+VG  F
Sbjct  546  AILGVEGFSALPHHCLQLCCGFFAFAVATNLVRDLNPKNIGRWIPLPMAMAVPFVVGGYF  605

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSLVVY W  L  K+A+LMVPA ASGLICGDG WILP SILAL KV  PICM F
Sbjct  606  AIDMCMGSLVVYAWQTLKSKEASLMVPAAASGLICGDGFWILPSSILALFKVHPPICMRF  665

Query  361  LPAK  372
            LP K
Sbjct  666  LPTK  669



>ref|XP_006601048.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Glycine max]
 ref|XP_006601049.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X3 [Glycine max]
Length=673

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLC GFF FA+  NL++DL+PKN+G+WIPLPMAMAVPF+VG  F
Sbjct  550  AILGVEGFSALPHHCLQLCCGFFAFAVATNLVRDLNPKNIGRWIPLPMAMAVPFVVGGYF  609

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSLVVY W  L  K+A+LMVPA ASGLICGDG WILP SILAL KV  PICM F
Sbjct  610  AIDMCMGSLVVYAWQTLKSKEASLMVPAAASGLICGDGFWILPSSILALFKVHPPICMRF  669

Query  361  LPAK  372
            LP K
Sbjct  670  LPTK  673



>ref|XP_010053070.1| PREDICTED: metal-nicotianamine transporter YSL1 [Eucalyptus grandis]
 gb|KCW77322.1| hypothetical protein EUGRSUZ_D01684 [Eucalyptus grandis]
Length=669

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP+HCLQLCYGFF FA+ ANL++DL P+ VGKW+PLPMAMA PFLVGA F
Sbjct  547  AILGVQGFSALPRHCLQLCYGFFSFAVAANLIRDLGPRKVGKWMPLPMAMAPPFLVGAYF  606

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
             IDMC+G+L+VY W +LN KKA LMVPAVASGLICG+GLW+LP S+LALAK+K PICM F
Sbjct  607  TIDMCLGTLIVYVWQKLNVKKAELMVPAVASGLICGEGLWVLPASVLALAKIKPPICMKF  666

Query  361  LPA  369
            +P+
Sbjct  667  VPS  669



>ref|XP_008803948.1| PREDICTED: probable metal-nicotianamine transporter YSL9 [Phoenix 
dactylifera]
 ref|XP_008803949.1| PREDICTED: probable metal-nicotianamine transporter YSL9 [Phoenix 
dactylifera]
Length=664

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HCLQLCYGFF FA+VAN++KD+ P   G+W+PLPMAMAVPFLVGA+F
Sbjct  542  AILGVEGFSALPEHCLQLCYGFFGFAVVANVMKDILPAKYGRWVPLPMAMAVPFLVGANF  601

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH+LN  KA LMVPAVASGLICGDGLWILP S+LALA+V  PICM F
Sbjct  602  AIDMCVGSLIVFAWHKLNSDKAPLMVPAVASGLICGDGLWILPSSLLALARVNPPICMKF  661

Query  361  L  363
            +
Sbjct  662  I  662



>gb|AAM98073.1| AT5g24380/K16H17_9 [Arabidopsis thaliana]
 gb|AAO64741.1| AT5g24380/K16H17_9 [Arabidopsis thaliana]
Length=409

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+G S LP+HCL+LCYGFF FA+ ANL +DL P   GKWIPLPMAMAVPFLVG SF
Sbjct  286  AIIGVQGPSALPKHCLELCYGFFAFAVAANLARDLLPDKPGKWIPLPMAMAVPFLVGGSF  345

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY W ++NRKKA +MVPAVASGLICGDGLWILP S+LALAKV+ PICM F
Sbjct  346  AIDMCIGSLVVYVWKKVNRKKADVMVPAVASGLICGDGLWILPSSLLALAKVRPPICMNF  405

Query  361  LPAK  372
              A 
Sbjct  406  TAAH  409



>dbj|BAH57276.1| AT5G24380 [Arabidopsis thaliana]
Length=419

 Score =   194 bits (493),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+G S LP+HCL+LCYGFF FA+ ANL +DL P   GKWIPLPMAMAVPFLVG SF
Sbjct  296  AIIGVQGPSALPKHCLELCYGFFAFAVAANLARDLLPDKPGKWIPLPMAMAVPFLVGGSF  355

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY W ++NRKKA +MVPAVASGLICGDGLWILP S+LALAKV+ PICM F
Sbjct  356  AIDMCIGSLVVYVWKKVNRKKADVMVPAVASGLICGDGLWILPSSLLALAKVRPPICMNF  415

Query  361  LPAK  372
              A 
Sbjct  416  TAAH  419



>ref|XP_010252366.1| PREDICTED: metal-nicotianamine transporter YSL2 [Nelumbo nucifera]
 ref|XP_010252375.1| PREDICTED: metal-nicotianamine transporter YSL2 [Nelumbo nucifera]
 ref|XP_010252385.1| PREDICTED: metal-nicotianamine transporter YSL2 [Nelumbo nucifera]
Length=681

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HCLQLCYGFF FA+  NL++DLSP   G+ +PLPMAMAVPFLVGA F
Sbjct  559  AILGVEGFSALPRHCLQLCYGFFSFAVGLNLVRDLSPPKYGRLVPLPMAMAVPFLVGAYF  618

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH+LN KKA+LMVPAVASGLICG+GLWILP SILALAKVK+PICM F
Sbjct  619  AIDMCVGSLIVFAWHKLNSKKASLMVPAVASGLICGEGLWILPSSILALAKVKSPICMKF  678

Query  361  L  363
            L
Sbjct  679  L  679



>ref|XP_010267463.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Nelumbo 
nucifera]
 ref|XP_010267464.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Nelumbo 
nucifera]
 ref|XP_010267465.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Nelumbo 
nucifera]
 ref|XP_010267466.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Nelumbo 
nucifera]
 ref|XP_010267467.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Nelumbo 
nucifera]
Length=680

 Score =   198 bits (504),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HCLQLC GFF FA+ ANLL+DLSP  +GKW+PLPMAMAVPFLVGA F
Sbjct  558  AILGVEGFSALPRHCLQLCCGFFAFAVGANLLRDLSPPKLGKWVPLPMAMAVPFLVGAYF  617

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V  WH+L+ KKATLM+PAVASGLICGDGLWILP SILALA V  PICM F
Sbjct  618  AIDMCVGSLIVLVWHKLDSKKATLMIPAVASGLICGDGLWILPSSILALANVNPPICMRF  677

Query  361  L  363
            L
Sbjct  678  L  678



>ref|XP_004245462.1| PREDICTED: metal-nicotianamine transporter YSL1 [Solanum lycopersicum]
Length=663

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL+V+G S LPQHCLQLCYGFF FA+  NL+KDLSP+ +GKW+PLPMAMAVPFL+G  F
Sbjct  541  AILSVQGVSALPQHCLQLCYGFFAFAVAINLVKDLSPEKIGKWMPLPMAMAVPFLIGGYF  600

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
             IDMC+GSLVV+ WH+LN KKA +MVPAVASGLICG+GLWILP SILALA+V  PICM F
Sbjct  601  GIDMCIGSLVVFVWHKLNSKKAKVMVPAVASGLICGEGLWILPSSILALARVAPPICMKF  660

Query  361  LPA  369
            L +
Sbjct  661  LAS  663



>ref|XP_010493592.1| PREDICTED: metal-nicotianamine transporter YSL2 isoform X1 [Camelina 
sativa]
Length=667

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+G S LP HCL+LCYGFF FA+VANL +D  P+  GKWIPLPMAMAVPFLVG SF
Sbjct  544  AILGVQGLSALPDHCLELCYGFFAFAVVANLARDFLPERPGKWIPLPMAMAVPFLVGGSF  603

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY W+++NRKKA +MVPAVASGLICGDGLWILP S+LALAKVK P+CM F
Sbjct  604  AIDMCIGSLVVYVWNKVNRKKADVMVPAVASGLICGDGLWILPSSLLALAKVKPPMCMNF  663

Query  361  LPA  369
              A
Sbjct  664  TAA  666



>ref|XP_010493593.1| PREDICTED: metal-nicotianamine transporter YSL2 isoform X2 [Camelina 
sativa]
Length=665

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+G S LP HCL+LCYGFF FA+VANL +D  P+  GKWIPLPMAMAVPFLVG SF
Sbjct  542  AILGVQGLSALPDHCLELCYGFFAFAVVANLARDFLPERPGKWIPLPMAMAVPFLVGGSF  601

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY W+++NRKKA +MVPAVASGLICGDGLWILP S+LALAKVK P+CM F
Sbjct  602  AIDMCIGSLVVYVWNKVNRKKADVMVPAVASGLICGDGLWILPSSLLALAKVKPPMCMNF  661

Query  361  LPA  369
              A
Sbjct  662  TAA  664



>ref|XP_008456006.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X2 [Cucumis 
melo]
Length=659

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+VANLL+DL+PK  GKWIPLPMAMAVPFLVGA F
Sbjct  545  AILGVEGFSALPQHCLQLCYGFFSFAIVANLLRDLTPKKFGKWIPLPMAMAVPFLVGAYF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVK  339
            AIDMC+GSL+V+ WH LNR++A LM+PAVASGLICG+GLWILP SILALAK K
Sbjct  605  AIDMCVGSLIVFVWHYLNRQRAELMIPAVASGLICGEGLWILPSSILALAKRK  657



>ref|XP_003556858.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Glycine 
max]
Length=670

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            A+L VEGFS LPQHCLQLCYGFF FA+V N+++DLSP   GKW+PLPM MA+PFLVGA F
Sbjct  548  AVLGVEGFSALPQHCLQLCYGFFAFAVVVNMVRDLSPNVFGKWMPLPMVMAIPFLVGAYF  607

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY WH+LN KKA  M+PA ASGLICG+GLW LP SILALAKV  PICM F
Sbjct  608  AIDMCLGSLVVYVWHKLNTKKAEAMIPATASGLICGEGLWALPASILALAKVNPPICMNF  667

Query  361  LPA  369
            L +
Sbjct  668  LAS  670



>ref|XP_010034899.1| PREDICTED: metal-nicotianamine transporter YSL2-like [Eucalyptus 
grandis]
Length=665

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            A+L VEGFS LP+HCLQLCYGFF FA+ ANL +DL PKN+ KW+PLPMAMAVPFLVGA+F
Sbjct  542  AVLGVEGFSALPKHCLQLCYGFFGFAVSANLARDLLPKNIAKWVPLPMAMAVPFLVGANF  601

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH+LN K   LMVPA ASGLICGDGLWILP  IL LAK++ PICM F
Sbjct  602  AIDMCLGSLIVFVWHKLNSKNTALMVPAAASGLICGDGLWILPSVILDLAKIQPPICMNF  661

Query  361  LPAK  372
            L  +
Sbjct  662  LKGE  665



>ref|XP_002872112.1| hypothetical protein ARALYDRAFT_489303 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48371.1| hypothetical protein ARALYDRAFT_489303 [Arabidopsis lyrata subsp. 
lyrata]
Length=664

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+G S LPQHCL+LCYGFF FA+VANL +DL P   GKWIPLPMAMAVPFLVG SF
Sbjct  541  AIIGVQGLSALPQHCLELCYGFFAFAVVANLARDLLPDRPGKWIPLPMAMAVPFLVGGSF  600

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GS+VV+ W ++NRKKA +MVPAVASGLICGDGLWILP S+LALAKV+ PICM F
Sbjct  601  AIDMCIGSVVVFVWQKVNRKKADVMVPAVASGLICGDGLWILPSSLLALAKVRPPICMNF  660

Query  361  LPA  369
              A
Sbjct  661  TAA  663



>ref|XP_011470188.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=670

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCL LCY FF FA+ ANLL+D  PK + K++PLPMAMAVPFLVGA F
Sbjct  548  AILGVQGFSALPQHCLDLCYAFFSFAIAANLLRDFGPKKMSKYVPLPMAMAVPFLVGAYF  607

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSL+V+ WH+L   KA+LMVPAVASGLICGDGLWILP SILALAKV+ PICM F
Sbjct  608  AIDMCMGSLIVFVWHKLKHNKASLMVPAVASGLICGDGLWILPSSILALAKVRPPICMNF  667

Query  361  LPA  369
            L +
Sbjct  668  LAS  670



>gb|KCW46096.1| hypothetical protein EUGRSUZ_K00012 [Eucalyptus grandis]
Length=695

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            A+L VEGFS LP+HCLQLCYGFF FA+ ANL +DL PKN+ KW+PLPMAMAVPFLVGA+F
Sbjct  572  AVLGVEGFSALPKHCLQLCYGFFGFAVSANLARDLLPKNIAKWVPLPMAMAVPFLVGANF  631

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH+LN K   LMVPA ASGLICGDGLWILP  IL LAK++ PICM F
Sbjct  632  AIDMCLGSLIVFVWHKLNSKNTALMVPAAASGLICGDGLWILPSVILDLAKIQPPICMNF  691

Query  361  LPAK  372
            L  +
Sbjct  692  LKGE  695



>gb|KJB18947.1| hypothetical protein B456_003G076700 [Gossypium raimondii]
 gb|KJB18948.1| hypothetical protein B456_003G076700 [Gossypium raimondii]
Length=662

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP+HCLQLCYGFF FA++ N ++D+SP  +GKW+PLPMAMAVPFLVG  F
Sbjct  540  AILGVQGFSALPRHCLQLCYGFFAFAVLVNFVRDVSPHKIGKWMPLPMAMAVPFLVGGYF  599

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+LV++ W +LN KKA LMVPAVASGLICG+GLWILP SILALAK+  PICM F
Sbjct  600  AIDMCLGTLVMFAWQKLNAKKAELMVPAVASGLICGEGLWILPASILALAKINPPICMKF  659

Query  361  LPA  369
            LP+
Sbjct  660  LPS  662



>ref|XP_010240192.1| PREDICTED: probable metal-nicotianamine transporter YSL9 [Brachypodium 
distachyon]
Length=187

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FA+ ANL++DL P   G+W+PLPMAM VPFLVGASF
Sbjct  64   AILGVEGFSALPLHCLQLCYGFFGFAVAANLMRDLFPPKYGRWVPLPMAMGVPFLVGASF  123

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ WH ++  KA LMVPAVASGLICGDGLWI P ++LALAK+  P+CM F
Sbjct  124  AIDMCVGSLVVFVWHMIDGGKAALMVPAVASGLICGDGLWIFPSALLALAKINPPLCMAF  183



>ref|XP_009762636.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Nicotiana sylvestris]
Length=737

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL+V+G S LPQHCLQLCYGFF FA+  NL+KDLSP+ +GKW+PLPMAMAVPFL+G  F
Sbjct  615  AILSVQGVSALPQHCLQLCYGFFAFAVAINLVKDLSPEKIGKWMPLPMAMAVPFLIGGYF  674

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
             IDMC+GSLVV+ WH+LN KKA +MVPAVASGLICG+GLWILP SILALA+V  PICM F
Sbjct  675  GIDMCIGSLVVFVWHKLNSKKAKVMVPAVASGLICGEGLWILPASILALARVTPPICMKF  734

Query  361  LPA  369
            L +
Sbjct  735  LAS  737



>ref|XP_009762638.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X3 [Nicotiana sylvestris]
 ref|XP_009762640.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X3 [Nicotiana sylvestris]
Length=665

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL+V+G S LPQHCLQLCYGFF FA+  NL+KDLSP+ +GKW+PLPMAMAVPFL+G  F
Sbjct  543  AILSVQGVSALPQHCLQLCYGFFAFAVAINLVKDLSPEKIGKWMPLPMAMAVPFLIGGYF  602

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
             IDMC+GSLVV+ WH+LN KKA +MVPAVASGLICG+GLWILP SILALA+V  PICM F
Sbjct  603  GIDMCIGSLVVFVWHKLNSKKAKVMVPAVASGLICGEGLWILPASILALARVTPPICMKF  662

Query  361  LPA  369
            L +
Sbjct  663  LAS  665



>ref|XP_009762637.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X2 [Nicotiana sylvestris]
Length=736

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL+V+G S LPQHCLQLCYGFF FA+  NL+KDLSP+ +GKW+PLPMAMAVPFL+G  F
Sbjct  614  AILSVQGVSALPQHCLQLCYGFFAFAVAINLVKDLSPEKIGKWMPLPMAMAVPFLIGGYF  673

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
             IDMC+GSLVV+ WH+LN KKA +MVPAVASGLICG+GLWILP SILALA+V  PICM F
Sbjct  674  GIDMCIGSLVVFVWHKLNSKKAKVMVPAVASGLICGEGLWILPASILALARVTPPICMKF  733

Query  361  LPA  369
            L +
Sbjct  734  LAS  736



>dbj|BAB09731.1| EspB-like protein [Arabidopsis thaliana]
Length=669

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL++D  P  +G W+PLPMAMAVPFLVG  F
Sbjct  543  AILGVEGFSALPQHCLQLCYGFFAFAVAANLVRDRLPDKIGNWVPLPMAMAVPFLVGGYF  602

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W+  +R KA LMVPAVASGLICGDGLWILP S+LALA V+ PICM F
Sbjct  603  AIDMCVGSLIVFAWNMRDRVKAGLMVPAVASGLICGDGLWILPSSVLALAGVRPPICMGF  662

Query  361  LPAKAS  378
            +P+K S
Sbjct  663  MPSKYS  668



>ref|NP_200167.2| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana]
 ref|NP_001190532.1| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana]
 sp|Q2EF88.1|YSL3_ARATH RecName: Full=Metal-nicotianamine transporter YSL3; AltName: 
Full=Protein YELLOW STRIPE LIKE 3; Short=AtYSL3 [Arabidopsis 
thaliana]
 gb|ABD38920.1| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana]
 gb|AED96375.1| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana]
 gb|AED96376.1| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana]
Length=675

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL++D  P  +G W+PLPMAMAVPFLVG  F
Sbjct  549  AILGVEGFSALPQHCLQLCYGFFAFAVAANLVRDRLPDKIGNWVPLPMAMAVPFLVGGYF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W+  +R KA LMVPAVASGLICGDGLWILP S+LALA V+ PICM F
Sbjct  609  AIDMCVGSLIVFAWNMRDRVKAGLMVPAVASGLICGDGLWILPSSVLALAGVRPPICMGF  668

Query  361  LPAKAS  378
            +P+K S
Sbjct  669  MPSKYS  674



>dbj|BAE99250.1| hypothetical protein [Arabidopsis thaliana]
Length=491

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+G S LP+HCL+LCYGFF FA+ ANL +DL P   GKWIPLPMAMAVPFLVG SF
Sbjct  368  AIIGVQGPSALPKHCLELCYGFFAFAVAANLARDLLPDKPGKWIPLPMAMAVPFLVGGSF  427

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY W ++NRKKA +MVPAVASGLICGDGLWILP S+LALAKV+ PICM F
Sbjct  428  AIDMCIGSLVVYVWKKVNRKKADVMVPAVASGLICGDGLWILPSSLLALAKVRPPICMNF  487

Query  361  LPA  369
              A
Sbjct  488  TAA  490



>ref|XP_010454748.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X2 [Camelina sativa]
Length=664

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+G S LP HCL+LCYGFF FA+VANL +D  P+  GKWIPLPM MAVPFLVG SF
Sbjct  541  AILGVQGLSALPDHCLELCYGFFAFAVVANLARDFLPERPGKWIPLPMEMAVPFLVGGSF  600

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY W+++NRKKA +MVPAVASGLICGDGLWILP S+LALAKVK P+CM F
Sbjct  601  AIDMCIGSLVVYVWNKVNRKKADVMVPAVASGLICGDGLWILPSSLLALAKVKPPMCMNF  660

Query  361  LPA  369
              A
Sbjct  661  TAA  663



>ref|XP_010454747.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Camelina sativa]
Length=666

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+G S LP HCL+LCYGFF FA+VANL +D  P+  GKWIPLPM MAVPFLVG SF
Sbjct  543  AILGVQGLSALPDHCLELCYGFFAFAVVANLARDFLPERPGKWIPLPMEMAVPFLVGGSF  602

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY W+++NRKKA +MVPAVASGLICGDGLWILP S+LALAKVK P+CM F
Sbjct  603  AIDMCIGSLVVYVWNKVNRKKADVMVPAVASGLICGDGLWILPSSLLALAKVKPPMCMNF  662

Query  361  LPA  369
              A
Sbjct  663  TAA  665



>ref|XP_007211288.1| hypothetical protein PRUPE_ppa002524mg [Prunus persica]
 gb|EMJ12487.1| hypothetical protein PRUPE_ppa002524mg [Prunus persica]
Length=662

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 107/121 (88%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGFF FA++ NL++D SPK +GK++PLPM M VPFLVGA F
Sbjct  541  AILGVQGFSALPQHCLQLCYGFFAFAVIVNLVRDFSPK-IGKYMPLPMVMGVPFLVGAYF  599

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+TWH+L+ KKA LMVPAVASGLICG+GLW LP S+LALAKVKAP+CM F
Sbjct  600  AIDMCIGSLIVFTWHKLDSKKAVLMVPAVASGLICGEGLWTLPASVLALAKVKAPMCMKF  659

Query  361  L  363
            L
Sbjct  660  L  660



>ref|XP_008374112.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Malus domestica]
Length=664

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGFF FA++ NL++D SPK +GKW+PLPM M VPFLVGA F
Sbjct  543  AILGVQGFSALPQHCLQLCYGFFAFAVLVNLVRDFSPK-IGKWMPLPMVMGVPFLVGAYF  601

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH+LN KKA LMVPAVASGLICG+GLW LP SILALAKVK P+CM F
Sbjct  602  AIDMCIGSLIVFVWHKLNSKKAVLMVPAVASGLICGEGLWTLPASILALAKVKPPMCMKF  661

Query  361  L  363
            L
Sbjct  662  L  662



>ref|XP_010454749.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X3 [Camelina sativa]
Length=629

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+G S LP HCL+LCYGFF FA+VANL +D  P+  GKWIPLPM MAVPFLVG SF
Sbjct  506  AILGVQGLSALPDHCLELCYGFFAFAVVANLARDFLPERPGKWIPLPMEMAVPFLVGGSF  565

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY W+++NRKKA +MVPAVASGLICGDGLWILP S+LALAKVK P+CM F
Sbjct  566  AIDMCIGSLVVYVWNKVNRKKADVMVPAVASGLICGDGLWILPSSLLALAKVKPPMCMNF  625

Query  361  LPAK  372
              A 
Sbjct  626  TAAH  629



>ref|NP_001141294.1| uncharacterized protein LOC100273385 [Zea mays]
 gb|ACF86002.1| unknown [Zea mays]
Length=303

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HCLQLC GFF FA++ANL +DL P+ + + +PLPMAMAVPFLVGASF
Sbjct  180  AILGVEGFSALPRHCLQLCAGFFAFAVLANLARDLLPRRLARLVPLPMAMAVPFLVGASF  239

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            A+DMC+GSLVV+ WH+L+ KKA L+VPAVASGLICGDG+W  P S+LALAKVK PICM F
Sbjct  240  AVDMCVGSLVVFAWHKLDGKKAALLVPAVASGLICGDGIWTFPSSLLALAKVKPPICMKF  299

Query  361  LPAK  372
             P  
Sbjct  300  TPGS  303



>ref|XP_009358702.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Pyrus x 
bretschneideri]
Length=664

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGFF FA++ NL++D SPK +GKW+PLPM M VPFLVGA F
Sbjct  543  AILGVQGFSALPQHCLQLCYGFFAFAVLVNLVRDFSPK-IGKWMPLPMVMGVPFLVGAYF  601

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH+LN KKA LMVPAVASGLICG+GLW LP SILALAKVK P+CM F
Sbjct  602  AIDMCIGSLIVFVWHKLNSKKAVLMVPAVASGLICGEGLWTLPASILALAKVKPPMCMKF  661

Query  361  L  363
            L
Sbjct  662  L  662



>ref|XP_009150965.1| PREDICTED: metal-nicotianamine transporter YSL2 [Brassica rapa]
Length=666

 Score =   196 bits (498),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+G S LP +CL+LCYGFF FA+ ANL +D  P+ VGKWIPLPMAMAVPFLVG SF
Sbjct  543  AIIGVQGLSALPHNCLELCYGFFAFAVAANLARDFLPEKVGKWIPLPMAMAVPFLVGGSF  602

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GS VV+ W ++NRKKA  MVPAVASGLICGDGLWILP S+LALAK++ PICM F
Sbjct  603  AIDMCIGSFVVFVWQKVNRKKAEFMVPAVASGLICGDGLWILPSSLLALAKIRPPICMNF  662

Query  361  LPA  369
             PA
Sbjct  663  TPA  665



>ref|XP_010442922.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Camelina sativa]
 ref|XP_010442923.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Camelina sativa]
Length=673

 Score =   196 bits (497),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLC GFF FA+ ANL++DL P+ +GKW+PLPMAMAVPFLVG  F
Sbjct  549  AILGVEGFSALPQHCLQLCCGFFSFAVAANLVRDLLPEKIGKWVPLPMAMAVPFLVGGYF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W+  +R KA LM+PAVASGLICGDGLWILP S+LALA V+ PICM+F
Sbjct  609  AIDMCVGSLIVFAWNMRDRVKAGLMIPAVASGLICGDGLWILPSSVLALAGVRPPICMSF  668

Query  361  LPAKA  375
            +P+K 
Sbjct  669  MPSKT  673



>ref|XP_010318047.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform 
X1 [Solanum lycopersicum]
Length=666

 Score =   196 bits (497),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HCLQLCYGFF FA++ANL++D++P+ VGK +PLPMA+AVPFLVGASF
Sbjct  542  AILGVEGFSALPRHCLQLCYGFFAFAVLANLVRDMAPERVGKLVPLPMAIAVPFLVGASF  601

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM  GSL+VY WH+LN KKA LMVPAVASG ICGDGLWILP ++LAL KV+ PICM F
Sbjct  602  AIDMAAGSLIVYVWHKLNSKKADLMVPAVASGFICGDGLWILPSALLALLKVRPPICMAF  661



>gb|KHN44642.1| Metal-nicotianamine transporter YSL1 [Glycine soja]
Length=631

 Score =   195 bits (495),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            A+L VEGFS LP HCLQLCYGFF FA+  N+++DLSPK +GKW+PLPM MA+PFLVGA F
Sbjct  509  AVLGVEGFSALPHHCLQLCYGFFAFAVAVNMVRDLSPKKIGKWMPLPMVMAIPFLVGAYF  568

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM +G+LVVY WH+LN KKA  M+PA ASGLICG+GLW LP SILAL+K+K PICM F
Sbjct  569  AIDMALGTLVVYVWHKLNSKKAEAMIPATASGLICGEGLWALPASILALSKIKPPICMNF  628

Query  361  LPA  369
            L +
Sbjct  629  LAS  631



>gb|ABB76763.1| YSL transporter 3 [Noccaea caerulescens]
Length=672

 Score =   195 bits (496),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCY FF FA+ ANL++DLSP+  GKW+PLPMAMAVPFLVG  F
Sbjct  549  AILGVEGFSALPQHCLQLCYVFFAFAVAANLVRDLSPEKFGKWVPLPMAMAVPFLVGGYF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W+  +R KA LMVPAVASGLICGDGLWILP S+LALA VK PICM+F
Sbjct  609  AIDMCVGSLIVFGWNMRDRVKAGLMVPAVASGLICGDGLWILPSSLLALAGVKPPICMSF  668

Query  361  LPAK  372
            + ++
Sbjct  669  MSSR  672



>gb|ABD04075.1| YSL transporter 3 [Noccaea caerulescens]
Length=672

 Score =   195 bits (496),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCY FF FA+ ANL++DLSP+  GKW+PLPMAMAVPFLVG  F
Sbjct  549  AILGVEGFSALPQHCLQLCYVFFAFAVAANLVRDLSPEKFGKWVPLPMAMAVPFLVGGYF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W+  +R KA LMVPAVASGLICGDGLWILP S+LALA VK PICM+F
Sbjct  609  AIDMCVGSLIVFGWNMRDRVKAGLMVPAVASGLICGDGLWILPSSLLALAGVKPPICMSF  668

Query  361  LPAK  372
            + ++
Sbjct  669  MSSR  672



>gb|EYU40692.1| hypothetical protein MIMGU_mgv1a002430mg [Erythranthe guttata]
Length=676

 Score =   195 bits (496),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+GFS LPQHCLQLCYGFF FA+  NL+KD+SPK +GKW+PLP AMAVPFL+G  F
Sbjct  554  AIIGVQGFSALPQHCLQLCYGFFAFAIGVNLVKDISPKRIGKWMPLPTAMAVPFLIGGYF  613

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+ +V+ WH++N  KA LMVPAVASGLICG+G+W LP S+LALAK+  PICM F
Sbjct  614  AIDMCVGTAIVFVWHKINSNKAELMVPAVASGLICGEGIWTLPASVLALAKITPPICMNF  673

Query  361  LPA  369
            LPA
Sbjct  674  LPA  676



>dbj|BAB11231.1| unnamed protein product [Arabidopsis thaliana]
Length=652

 Score =   195 bits (495),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+G S LP+HCL+LCYGFF FA+ ANL +DL P   GKWIPLPMAMAVPFLVG SF
Sbjct  529  AIIGVQGPSALPKHCLELCYGFFAFAVAANLARDLLPDKPGKWIPLPMAMAVPFLVGGSF  588

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY W ++NRKKA +MVPAVASGLICGDGLWILP S+LALAKV+ PICM F
Sbjct  589  AIDMCIGSLVVYVWKKVNRKKADVMVPAVASGLICGDGLWILPSSLLALAKVRPPICMNF  648

Query  361  LPA  369
              A
Sbjct  649  TAA  651



>ref|XP_006343788.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Solanum 
tuberosum]
Length=674

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL+V+G S LPQHCLQLCYGFF FA+  NL+KDLSP+ +GKW+PLPMAMAVPFL+G  F
Sbjct  552  AILSVQGVSALPQHCLQLCYGFFAFAVAINLVKDLSPEKIGKWMPLPMAMAVPFLIGGYF  611

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
             IDMC+GSLVV+ WH+LN K A +MVPAVASGLICG+GLWILP SILALA+V  PICM F
Sbjct  612  GIDMCIGSLVVFVWHKLNSKTAKVMVPAVASGLICGEGLWILPASILALARVAPPICMKF  671

Query  361  LPA  369
            L +
Sbjct  672  LAS  674



>ref|XP_006593833.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X2 [Glycine max]
 ref|XP_003543988.2| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Glycine max]
 ref|XP_006593834.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X3 [Glycine max]
 ref|XP_006593835.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X4 [Glycine max]
Length=669

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            A+L VEGFS LP HCLQLCYGFF FA+  N+++DLSPK +GKW+PLPM MA+PFLVGA F
Sbjct  547  AVLGVEGFSALPHHCLQLCYGFFAFAVAVNMVRDLSPKKIGKWMPLPMVMAIPFLVGAYF  606

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM +G+LVVY WH+LN KKA  M+PA ASGLICG+GLW LP SILAL+K+K PICM F
Sbjct  607  AIDMALGTLVVYVWHKLNSKKAEAMIPATASGLICGEGLWALPASILALSKIKPPICMNF  666

Query  361  LPA  369
            L +
Sbjct  667  LAS  669



>ref|NP_197826.2| metal-nicotianamine transporter YSL2 [Arabidopsis thaliana]
 sp|Q6R3K9.1|YSL2_ARATH RecName: Full=Metal-nicotianamine transporter YSL2; AltName: 
Full=Protein YELLOW STRIPE LIKE 2; Short=AtYSL2 [Arabidopsis 
thaliana]
 gb|AAS00692.1| metal-nicotianamine transporter YSL2 [Arabidopsis thaliana]
 gb|AAT69741.1| putative metal-nicotianamine transporter [Arabidopsis thaliana]
 gb|AED93305.1| metal-nicotianamine transporter YSL2 [Arabidopsis thaliana]
Length=664

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+G S LP+HCL+LCYGFF FA+ ANL +DL P   GKWIPLPMAMAVPFLVG SF
Sbjct  541  AIIGVQGPSALPKHCLELCYGFFAFAVAANLARDLLPDKPGKWIPLPMAMAVPFLVGGSF  600

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY W ++NRKKA +MVPAVASGLICGDGLWILP S+LALAKV+ PICM F
Sbjct  601  AIDMCIGSLVVYVWKKVNRKKADVMVPAVASGLICGDGLWILPSSLLALAKVRPPICMNF  660

Query  361  LPA  369
              A
Sbjct  661  TAA  663



>ref|XP_006593836.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X5 [Glycine max]
Length=668

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            A+L VEGFS LP HCLQLCYGFF FA+  N+++DLSPK +GKW+PLPM MA+PFLVGA F
Sbjct  546  AVLGVEGFSALPHHCLQLCYGFFAFAVAVNMVRDLSPKKIGKWMPLPMVMAIPFLVGAYF  605

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM +G+LVVY WH+LN KKA  M+PA ASGLICG+GLW LP SILAL+K+K PICM F
Sbjct  606  AIDMALGTLVVYVWHKLNSKKAEAMIPATASGLICGEGLWALPASILALSKIKPPICMNF  665

Query  361  LPA  369
            L +
Sbjct  666  LAS  668



>ref|XP_006593837.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X6 [Glycine max]
Length=678

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            A+L VEGFS LP HCLQLCYGFF FA+  N+++DLSPK +GKW+PLPM MA+PFLVGA F
Sbjct  556  AVLGVEGFSALPHHCLQLCYGFFAFAVAVNMVRDLSPKKIGKWMPLPMVMAIPFLVGAYF  615

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM +G+LVVY WH+LN KKA  M+PA ASGLICG+GLW LP SILAL+K+K PICM F
Sbjct  616  AIDMALGTLVVYVWHKLNSKKAEAMIPATASGLICGEGLWALPASILALSKIKPPICMNF  675

Query  361  LPA  369
            L +
Sbjct  676  LAS  678



>ref|NP_001053449.2| Os04g0542200 [Oryza sativa Japonica Group]
 gb|AAS49493.1| iron transport protein 1 [Oryza sativa]
 dbj|BAE91889.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAH00231.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF15363.2| Os04g0542200 [Oryza sativa Japonica Group]
Length=657

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL +DL P   G+W+PLPMAM VPFLVGASF
Sbjct  534  AILGVEGFSALPQHCLQLCYGFFGFAVAANLTRDLCPPKYGRWVPLPMAMGVPFLVGASF  593

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+TWH +++ KA LMVPAVASGLICGDGLWI P S+LALAK+  P+CM F
Sbjct  594  AIDMCIGSLIVFTWHIIDKSKAALMVPAVASGLICGDGLWIFPASLLALAKISPPMCMAF  653



>ref|XP_008239220.1| PREDICTED: metal-nicotianamine transporter YSL1 [Prunus mume]
 ref|XP_008239221.1| PREDICTED: metal-nicotianamine transporter YSL1 [Prunus mume]
Length=662

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 106/121 (88%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGFF FA++ NL++D SPK +GK++PLPM M VPFLVGA F
Sbjct  541  AILGVQGFSALPQHCLQLCYGFFAFAVIVNLVRDFSPK-IGKYMPLPMVMGVPFLVGAYF  599

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+TWH+L+ KKA LMVPAVASGLICG+GLW LP S+LALAKVK P+CM F
Sbjct  600  AIDMCIGSLIVFTWHKLDSKKAVLMVPAVASGLICGEGLWTLPASVLALAKVKPPMCMKF  659

Query  361  L  363
            L
Sbjct  660  L  660



>gb|EMT08573.1| Putative metal-nicotianamine transporter YSL9 [Aegilops tauschii]
Length=508

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLC GFF FA+VANL++D  P+  GKW+PLPMAM  PFLVGASF
Sbjct  385  AILGVEGFSALPMHCLQLCCGFFAFALVANLMRDFLPQKYGKWVPLPMAMGFPFLVGASF  444

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC GSL+VY WHR++R KAT MVPAVASG ICGDGLWI P S+LALAK+  P+CM F
Sbjct  445  AIDMCAGSLIVYIWHRIDRSKATHMVPAVASGFICGDGLWIFPASLLALAKITPPMCMAF  504



>sp|Q7XUJ2.2|YSL9_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL9; 
AltName: Full=Protein YELLOW STRIPE LIKE 9; Short=OsYSL9 [Oryza 
sativa Japonica Group]
 emb|CAD41272.2| OSJNBb0103I08.11 [Oryza sativa Japonica Group]
Length=684

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL +DL P   G+W+PLPMAM VPFLVGASF
Sbjct  561  AILGVEGFSALPQHCLQLCYGFFGFAVAANLTRDLCPPKYGRWVPLPMAMGVPFLVGASF  620

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+TWH +++ KA LMVPAVASGLICGDGLWI P S+LALAK+  P+CM F
Sbjct  621  AIDMCIGSLIVFTWHIIDKSKAALMVPAVASGLICGDGLWIFPASLLALAKISPPMCMAF  680



>emb|CAH67443.1| H0501D11.7 [Oryza sativa Indica Group]
Length=684

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL +DL P   G+W+PLPMAM VPFLVGASF
Sbjct  561  AILGVEGFSALPQHCLQLCYGFFGFAVAANLTRDLCPPKYGRWVPLPMAMGVPFLVGASF  620

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+TWH +++ KA LMVPAVASGLICGDGLWI P S+LALAK+  P+CM F
Sbjct  621  AIDMCIGSLIVFTWHIIDKSKAALMVPAVASGLICGDGLWIFPASLLALAKISPPMCMAF  680



>ref|XP_008390279.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Malus domestica]
Length=664

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGFF FA++ N+++D SPK +GKW+PLPM M VPFLVGA F
Sbjct  543  AILGVQGFSALPQHCLQLCYGFFAFAVLVNIVRDFSPK-IGKWMPLPMVMGVPFLVGAYF  601

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH++N KKA LMVPAVASGLICG+GLW LP S+LALAKVK P+CM F
Sbjct  602  AIDMCIGSLIVFVWHKINSKKAVLMVPAVASGLICGEGLWTLPASVLALAKVKPPMCMKF  661

Query  361  L  363
            L
Sbjct  662  L  662



>ref|XP_009587674.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009587675.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=668

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI++V+G S LP HCLQLCYGFF FA+  N++KDLSP+ +GKW+PLPMAMAVPFL+G  F
Sbjct  546  AIISVQGVSALPHHCLQLCYGFFAFAVAINMVKDLSPEKIGKWMPLPMAMAVPFLIGGYF  605

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
             IDMC+GSLVV+ WH+LN KKA +MVPAVASGLICG+GLWILP SILALA+V  PICM F
Sbjct  606  GIDMCIGSLVVFVWHKLNSKKAKVMVPAVASGLICGEGLWILPASILALARVTPPICMKF  665

Query  361  LPA  369
            L +
Sbjct  666  LAS  668



>ref|XP_009587676.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=667

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI++V+G S LP HCLQLCYGFF FA+  N++KDLSP+ +GKW+PLPMAMAVPFL+G  F
Sbjct  545  AIISVQGVSALPHHCLQLCYGFFAFAVAINMVKDLSPEKIGKWMPLPMAMAVPFLIGGYF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
             IDMC+GSLVV+ WH+LN KKA +MVPAVASGLICG+GLWILP SILALA+V  PICM F
Sbjct  605  GIDMCIGSLVVFVWHKLNSKKAKVMVPAVASGLICGEGLWILPASILALARVTPPICMKF  664

Query  361  LPA  369
            L +
Sbjct  665  LAS  667



>ref|XP_006394695.1| hypothetical protein EUTSA_v10003781mg [Eutrema salsugineum]
 gb|ESQ31981.1| hypothetical protein EUTSA_v10003781mg [Eutrema salsugineum]
Length=659

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+G S LP+HCL+LCYGFF FA+ ANL +D  P+ +GKWIPLPMAMAVPFLVG SF
Sbjct  536  AIIGVQGLSALPEHCLELCYGFFAFAVAANLARDRLPERLGKWIPLPMAMAVPFLVGGSF  595

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GS VV+ W ++N KKA  MVPAVASGLICGDGLWILP S+LALAKV+APICM F
Sbjct  596  AIDMCVGSFVVFVWKKVNSKKAEFMVPAVASGLICGDGLWILPSSLLALAKVRAPICMNF  655

Query  361  LPA  369
              A
Sbjct  656  TAA  658



>ref|XP_006350625.1| PREDICTED: metal-nicotianamine transporter YSL2-like [Solanum 
tuberosum]
Length=863

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FA++ANL++D++P+ VGK +PLPMAMAVPFLVGASF
Sbjct  563  AILGVEGFSALPLHCLQLCYGFFTFAILANLVRDMAPERVGKLVPLPMAMAVPFLVGASF  622

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM  GSL+VY WH+ N KKA LM+PAVASG ICGDGLWILP ++LAL KV+ PICM F
Sbjct  623  AIDMAAGSLIVYVWHKFNSKKADLMIPAVASGFICGDGLWILPSAVLALLKVRPPICMAF  682



>gb|EAZ31500.1| hypothetical protein OsJ_15637 [Oryza sativa Japonica Group]
Length=716

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL +DL P   G+W+PLPMAM VPFLVGASF
Sbjct  593  AILGVEGFSALPQHCLQLCYGFFGFAVAANLTRDLCPPKYGRWVPLPMAMGVPFLVGASF  652

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+TWH +++ KA LMVPAVASGLICGDGLWI P S+LALAK+  P+CM F
Sbjct  653  AIDMCIGSLIVFTWHIIDKSKAALMVPAVASGLICGDGLWIFPASLLALAKISPPMCMAF  712



>gb|KJB37387.1| hypothetical protein B456_006G203200 [Gossypium raimondii]
Length=666

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQ+CLQLCYGFF FA+ ANLL+D +PKN+GKWIP+PMAMAVPFLVGA F
Sbjct  545  AILGVQGFSALPQYCLQLCYGFFSFAIAANLLRDFTPKNIGKWIPIPMAMAVPFLVGAYF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAK  333
            AIDMC+GSL V+ WH+LNRKKA+LMVPAVASGLICGDGLW+LP SILAL K
Sbjct  605  AIDMCVGSLAVFAWHKLNRKKASLMVPAVASGLICGDGLWLLPSSILALFK  655



>gb|KFK27715.1| hypothetical protein AALP_AA8G420300 [Arabis alpina]
Length=661

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+G S LP HCL+LCYGFF FA+VANL +DL P+  GKWIPLPMAMAVPFLVG SF
Sbjct  538  AIIGVQGLSALPLHCLELCYGFFAFAVVANLGRDLLPEKPGKWIPLPMAMAVPFLVGGSF  597

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ W ++NRKKA +MVPAVASGLICGDGLWILP S+LALAKV+ P+CM F
Sbjct  598  AIDMCIGSLVVFVWKKVNRKKAEVMVPAVASGLICGDGLWILPSSLLALAKVRPPMCMNF  657

Query  361  LPA  369
              A
Sbjct  658  TAA  660



>ref|XP_009359553.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009359554.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009359555.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X2 [Pyrus x bretschneideri]
Length=664

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGFF FA++ N+++D SPK VGKW+PLPM M VPFLVGA F
Sbjct  543  AILGVQGFSALPQHCLQLCYGFFAFAVLVNIVRDFSPK-VGKWMPLPMVMGVPFLVGAYF  601

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH++N KKA L+VPAVASGLICG+GLW LP S+LALAKVK P+CM F
Sbjct  602  AIDMCLGSLIVFVWHKINNKKAVLIVPAVASGLICGEGLWTLPASVLALAKVKPPMCMKF  661

Query  361  L  363
            L
Sbjct  662  L  662



>gb|EAY95020.1| hypothetical protein OsI_16829 [Oryza sativa Indica Group]
Length=716

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+ ANL +DL P   G+W+PLPMAM VPFLVGASF
Sbjct  593  AILGVEGFSALPQHCLQLCYGFFGFAVAANLTRDLCPPKYGRWVPLPMAMGVPFLVGASF  652

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+TWH +++ KA LMVPAVASGLICGDGLWI P S+LALAK+  P+CM F
Sbjct  653  AIDMCIGSLIVFTWHIIDKSKAALMVPAVASGLICGDGLWIFPASLLALAKISPPMCMAF  712



>gb|AJP06486.1| metal-nicotianamine transporter [Solanum nigrum]
Length=665

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FA++ NL++D++P+ VGKW+PLPMAMAVPFLVGASF
Sbjct  541  AILGVEGFSALPLHCLQLCYGFFAFAIIVNLVRDVAPERVGKWVPLPMAMAVPFLVGASF  600

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM  GSL+V  WH+LN KKA LM+PAVASGLICGDG WILP ++LAL K++ PICM F
Sbjct  601  AIDMAAGSLIVCVWHKLNSKKADLMIPAVASGLICGDGFWILPSALLALIKIRPPICMAF  660



>ref|XP_006838312.1| hypothetical protein AMTR_s00103p00133560 [Amborella trichopoda]
 gb|ERN00881.1| hypothetical protein AMTR_s00103p00133560 [Amborella trichopoda]
Length=312

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL+VEG S LPQHCLQ+C G FVFA + NL+KDL P+  G+W+PLPMAMA PFLVG  F
Sbjct  190  AILSVEGLSALPQHCLQICAGAFVFAAMVNLVKDLVPERFGRWVPLPMAMAAPFLVGGYF  249

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
             IDMC+G+ VVY WH++NR++A  +VPAVASGL+CGDGLWILP SILALAKV+AP+CM+F
Sbjct  250  TIDMCIGTAVVYIWHKINRERAEALVPAVASGLMCGDGLWILPSSILALAKVEAPMCMSF  309

Query  361  L  363
             
Sbjct  310  F  310



>ref|XP_011082337.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Sesamum indicum]
 ref|XP_011082338.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Sesamum indicum]
Length=672

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+GFS LPQHCLQLCYGFF FA+  NLLKDL PK  GKW+P+P AMAVPFL+G  F
Sbjct  550  AIIGVQGFSALPQHCLQLCYGFFGFAIAINLLKDLLPKRTGKWMPIPTAMAVPFLIGGYF  609

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ W ++N KKA LMVPAVASGLICG+GLW LP S+LALAK+  PICM F
Sbjct  610  AIDMCVGSLVVFLWQKVNSKKAELMVPAVASGLICGEGLWTLPASVLALAKITPPICMKF  669

Query  361  LPA  369
            LP 
Sbjct  670  LPG  672



>ref|XP_011082339.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X2 [Sesamum indicum]
Length=671

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+GFS LPQHCLQLCYGFF FA+  NLLKDL PK  GKW+P+P AMAVPFL+G  F
Sbjct  549  AIIGVQGFSALPQHCLQLCYGFFGFAIAINLLKDLLPKRTGKWMPIPTAMAVPFLIGGYF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ W ++N KKA LMVPAVASGLICG+GLW LP S+LALAK+  PICM F
Sbjct  609  AIDMCVGSLVVFLWQKVNSKKAELMVPAVASGLICGEGLWTLPASVLALAKITPPICMKF  668

Query  361  LPA  369
            LP 
Sbjct  669  LPG  671



>ref|XP_011082340.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X3 [Sesamum indicum]
 ref|XP_011082341.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X3 [Sesamum indicum]
Length=668

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+GFS LPQHCLQLCYGFF FA+  NLLKDL PK  GKW+P+P AMAVPFL+G  F
Sbjct  546  AIIGVQGFSALPQHCLQLCYGFFGFAIAINLLKDLLPKRTGKWMPIPTAMAVPFLIGGYF  605

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ W ++N KKA LMVPAVASGLICG+GLW LP S+LALAK+  PICM F
Sbjct  606  AIDMCVGSLVVFLWQKVNSKKAELMVPAVASGLICGEGLWTLPASVLALAKITPPICMKF  665

Query  361  LPA  369
            LP 
Sbjct  666  LPG  668



>ref|XP_009359552.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Pyrus x bretschneideri]
Length=712

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGFF FA++ N+++D SPK VGKW+PLPM M VPFLVGA F
Sbjct  591  AILGVQGFSALPQHCLQLCYGFFAFAVLVNIVRDFSPK-VGKWMPLPMVMGVPFLVGAYF  649

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH++N KKA L+VPAVASGLICG+GLW LP S+LALAKVK P+CM F
Sbjct  650  AIDMCLGSLIVFVWHKINNKKAVLIVPAVASGLICGEGLWTLPASVLALAKVKPPMCMKF  709

Query  361  L  363
            L
Sbjct  710  L  710



>ref|XP_004495506.1| PREDICTED: LOW QUALITY PROTEIN: metal-nicotianamine transporter 
YSL1-like [Cicer arietinum]
Length=687

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            A++ V+GFS LP+HCLQLC+GFF FA+  N+L+D SPK +GKW+PLPM MAVPFLVGA F
Sbjct  565  AVIGVQGFSALPRHCLQLCFGFFAFAIGTNILRDFSPKKIGKWMPLPMVMAVPFLVGAYF  624

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMCMGSLVV+  H+LN KKA LMVPAVASGLICG+GLW LP +ILALAK+K PICM F
Sbjct  625  AIDMCMGSLVVFVMHKLNNKKAELMVPAVASGLICGEGLWTLPAAILALAKIKPPICMKF  684

Query  361  LPA  369
            + +
Sbjct  685  VTS  687



>ref|XP_010048775.1| PREDICTED: metal-nicotianamine transporter YSL3 [Eucalyptus grandis]
 gb|KCW89105.1| hypothetical protein EUGRSUZ_A01430 [Eucalyptus grandis]
Length=670

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            A+L  EGFS LPQHCLQLCYGFF FA+VANL +DLSPK++G W+PLPMAMAVPFLVGA F
Sbjct  544  ALLGTEGFSALPQHCLQLCYGFFAFAVVANLARDLSPKHIGNWVPLPMAMAVPFLVGAYF  603

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GS +V+ + + N ++A LMVPAVASGLICGDGLWILP SILALAKV  P C+ F
Sbjct  604  AIDMCVGSFIVFAYKKANGEEAGLMVPAVASGLICGDGLWILPSSILALAKVHPPFCLRF  663

Query  361  LP  366
             P
Sbjct  664  SP  665



>ref|XP_007039405.1| YELLOW STRIPE like 1 isoform 3 [Theobroma cacao]
 ref|XP_007039406.1| YELLOW STRIPE like 1 isoform 3 [Theobroma cacao]
 gb|EOY23906.1| YELLOW STRIPE like 1 isoform 3 [Theobroma cacao]
 gb|EOY23907.1| YELLOW STRIPE like 1 isoform 3 [Theobroma cacao]
Length=554

 Score =   191 bits (486),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQLCYGFF  A+  NL++D SP  +GKW+PLPM MAVPFLVGA F
Sbjct  432  AILGVQGFSALPHHCLQLCYGFFALAVAVNLVRDFSPHKIGKWMPLPMVMAVPFLVGAYF  491

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            A+DMC+G+L+V+ W +L  K+A LMVPAVASGLICG+GLWILP SILALAK+  PICM F
Sbjct  492  AVDMCLGTLIVFVWQKLKAKEAELMVPAVASGLICGEGLWILPASILALAKINPPICMKF  551

Query  361  LPA  369
            LP+
Sbjct  552  LPS  554



>ref|XP_007039160.1| YELLOW STRIPE like 3 isoform 1 [Theobroma cacao]
 gb|EOY23661.1| YELLOW STRIPE like 3 isoform 1 [Theobroma cacao]
Length=668

 Score =   193 bits (490),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGFF FA+ ANLL+D +PKN+GKW PLPMAMAVPFLVGA F
Sbjct  545  AILGVQGFSALPQHCLQLCYGFFSFAIAANLLRDFTPKNIGKWAPLPMAMAVPFLVGAYF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKA  342
            AIDMC+GSLVV+ WH+LN KKA LM+PAVASGLICGDGLW+LP SILAL K ++
Sbjct  605  AIDMCVGSLVVFAWHKLNGKKAGLMIPAVASGLICGDGLWLLPSSILALFKSQS  658



>ref|XP_002448252.1| hypothetical protein SORBIDRAFT_06g024030 [Sorghum bicolor]
 gb|EES12580.1| hypothetical protein SORBIDRAFT_06g024030 [Sorghum bicolor]
Length=668

 Score =   193 bits (490),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP+HCL LCYGFF FA+ ANL++DL P   GKW+PLPMAM VPFLVGASF
Sbjct  545  AILGVQGFSALPKHCLHLCYGFFGFAVAANLMRDLLPPKYGKWVPLPMAMGVPFLVGASF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH ++R KA+LMVPAVASGLICGDGLWI P+S+LAL K+  P+CM F
Sbjct  605  AIDMCVGSLIVFIWHMIDRSKASLMVPAVASGLICGDGLWIFPESLLALFKINPPLCMAF  664

Query  361  LPAK  372
             P+ 
Sbjct  665  RPSH  668



>gb|EMT10300.1| Putative metal-nicotianamine transporter YSL9 [Aegilops tauschii]
Length=613

 Score =   192 bits (487),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+VANL++DL     G+W+PLPMAM VPFLVGASF
Sbjct  490  AILGVEGFSALPQHCLQLCYGFFGFAVVANLMRDLLSPKYGRWVPLPMAMGVPFLVGASF  549

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ W+ ++R KA LMVPAVASGLICGDGLWI P ++LALAK+  P CM F
Sbjct  550  AIDMCVGSLVVFVWNMMDRNKAALMVPAVASGLICGDGLWIFPSALLALAKISPPFCMAF  609

Query  361  LPAK  372
             P  
Sbjct  610  RPTH  613



>ref|XP_009397635.1| PREDICTED: probable metal-nicotianamine transporter YSL9 [Musa 
acuminata subsp. malaccensis]
Length=700

 Score =   193 bits (490),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL+VEGFS LP HCLQLCYGFF FA+VAN+++D  P     W+PLP+AMAVPFLVGASF
Sbjct  577  AILSVEGFSALPHHCLQLCYGFFGFAVVANMMRDTLPAKYSGWVPLPVAMAVPFLVGASF  636

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
             IDMC+GSL+V+TWH+LNRKK  LMVPAVASG ICGDGLW+LP S+LALAKV  PIC+ F
Sbjct  637  TIDMCVGSLIVFTWHKLNRKKGALMVPAVASGFICGDGLWMLPSSLLALAKVDPPICVKF  696

Query  361  L  363
            +
Sbjct  697  V  697



>ref|XP_011026765.1| PREDICTED: metal-nicotianamine transporter YSL1 isoform X2 [Populus 
euphratica]
Length=602

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ VEGFS LPQ+CLQLCYGFF FA+  NL++D SP+ +G+W+PLP+ MAVPF++GASF
Sbjct  480  AIIGVEGFSALPQYCLQLCYGFFAFAIAVNLVRDFSPRKIGQWVPLPLVMAVPFVIGASF  539

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH+ N  KA  M+PAVASGLICG+GLW LP +ILALAK+K PICM F
Sbjct  540  AIDMCVGSLIVFVWHKRNTSKAEFMIPAVASGLICGEGLWTLPAAILALAKIKPPICMNF  599

Query  361  LPA  369
            + +
Sbjct  600  VAS  602



>ref|XP_011011616.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Populus 
euphratica]
 ref|XP_011011617.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Populus 
euphratica]
Length=661

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ VEGFS LPQ+CLQLCYGFF FA+  NL++D SP+ +G+W+PLP+ MAVPF++GASF
Sbjct  539  AIIGVEGFSALPQYCLQLCYGFFAFAIAVNLVRDFSPRKIGQWVPLPLVMAVPFVIGASF  598

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH+ N  KA  M+PAVASGLICG+GLW LP +ILALAK+K PICM F
Sbjct  599  AIDMCVGSLIVFVWHKRNTSKAEFMIPAVASGLICGEGLWTLPAAILALAKIKPPICMNF  658

Query  361  LPA  369
            + +
Sbjct  659  VAS  661



>ref|XP_007140990.1| hypothetical protein PHAVU_008G157800g [Phaseolus vulgaris]
 gb|ESW12984.1| hypothetical protein PHAVU_008G157800g [Phaseolus vulgaris]
Length=673

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP +CL LC GFF F++ ANL++D +PKN+G+W+P PMAMAVPF+VG  F
Sbjct  550  AILGVEGFSALPHYCLHLCCGFFAFSVAANLVRDFNPKNIGRWVPFPMAMAVPFVVGGYF  609

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+VY +H L  K+A+LM+PA+ASGLICGDGLWILP SILAL KV+APICM F
Sbjct  610  AIDMCVGSLIVYAYHTLKSKEASLMLPAIASGLICGDGLWILPSSILALFKVRAPICMRF  669

Query  361  LP  366
            LP
Sbjct  670  LP  671



>ref|XP_007140989.1| hypothetical protein PHAVU_008G157800g [Phaseolus vulgaris]
 gb|ESW12983.1| hypothetical protein PHAVU_008G157800g [Phaseolus vulgaris]
Length=669

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP +CL LC GFF F++ ANL++D +PKN+G+W+P PMAMAVPF+VG  F
Sbjct  546  AILGVEGFSALPHYCLHLCCGFFAFSVAANLVRDFNPKNIGRWVPFPMAMAVPFVVGGYF  605

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+VY +H L  K+A+LM+PA+ASGLICGDGLWILP SILAL KV+APICM F
Sbjct  606  AIDMCVGSLIVYAYHTLKSKEASLMLPAIASGLICGDGLWILPSSILALFKVRAPICMRF  665

Query  361  LP  366
            LP
Sbjct  666  LP  667



>ref|XP_011026763.1| PREDICTED: metal-nicotianamine transporter YSL1 isoform X1 [Populus 
euphratica]
Length=661

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ VEGFS LPQ+CLQLCYGFF FA+  NL++D SP+ +G+W+PLP+ MAVPF++GASF
Sbjct  539  AIIGVEGFSALPQYCLQLCYGFFAFAIAVNLVRDFSPRKIGQWVPLPLVMAVPFVIGASF  598

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH+ N  KA  M+PAVASGLICG+GLW LP +ILALAK+K PICM F
Sbjct  599  AIDMCVGSLIVFVWHKRNTSKAEFMIPAVASGLICGEGLWTLPAAILALAKIKPPICMNF  658

Query  361  LPA  369
            + +
Sbjct  659  VAS  661



>ref|XP_004498494.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X3 [Cicer arietinum]
Length=674

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQ CYGFF FA++ANL++DLSPKN+GKW+PLPMAMAVPF+VGA F
Sbjct  551  AILGVEGFSALPNHCLQFCYGFFAFAVLANLMRDLSPKNIGKWVPLPMAMAVPFVVGAYF  610

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W    R +A+LMVPAVASGLICGDG+W+LP + LA  KV  PICM+F
Sbjct  611  AIDMCVGSLIVFIWSMKKRNEASLMVPAVASGLICGDGIWVLPSAFLAWFKVNPPICMSF  670

Query  361  LPAK  372
               K
Sbjct  671  SANK  674



>ref|NP_001168540.1| hypothetical protein [Zea mays]
 ref|XP_008668330.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008668331.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008668332.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN28591.1| unknown [Zea mays]
 tpg|DAA36639.1| TPA: hypothetical protein ZEAMMB73_082828 [Zea mays]
 tpg|DAA36640.1| TPA: hypothetical protein ZEAMMB73_082828 [Zea mays]
Length=672

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQLCYGFF FA+ ANL++DL P   GKW+PLPMAM VPFLVGASF
Sbjct  549  AILGVQGFSALPLHCLQLCYGFFGFAVAANLMRDLLPPKYGKWVPLPMAMGVPFLVGASF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH ++R KA+LMVPAVASGLICGDGLWI P+S+LALAK+  P+CM F
Sbjct  609  AIDMCVGSLMVFIWHIIDRSKASLMVPAVASGLICGDGLWIFPESLLALAKISPPLCMAF  668



>ref|XP_004498492.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X1 [Cicer arietinum]
 ref|XP_004498493.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform 
X2 [Cicer arietinum]
Length=670

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQ CYGFF FA++ANL++DLSPKN+GKW+PLPMAMAVPF+VGA F
Sbjct  547  AILGVEGFSALPNHCLQFCYGFFAFAVLANLMRDLSPKNIGKWVPLPMAMAVPFVVGAYF  606

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W    R +A+LMVPAVASGLICGDG+W+LP + LA  KV  PICM+F
Sbjct  607  AIDMCVGSLIVFIWSMKKRNEASLMVPAVASGLICGDGIWVLPSAFLAWFKVNPPICMSF  666

Query  361  LPAK  372
               K
Sbjct  667  SANK  670



>ref|XP_008668329.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 tpg|DAA36641.1| TPA: hypothetical protein ZEAMMB73_082828 [Zea mays]
Length=696

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQLCYGFF FA+ ANL++DL P   GKW+PLPMAM VPFLVGASF
Sbjct  573  AILGVQGFSALPLHCLQLCYGFFGFAVAANLMRDLLPPKYGKWVPLPMAMGVPFLVGASF  632

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH ++R KA+LMVPAVASGLICGDGLWI P+S+LALAK+  P+CM F
Sbjct  633  AIDMCVGSLMVFIWHIIDRSKASLMVPAVASGLICGDGLWIFPESLLALAKISPPLCMAF  692



>gb|KEH16132.1| OPT family oligopeptide transporter [Medicago truncatula]
 gb|AES58717.2| OPT family oligopeptide transporter [Medicago truncatula]
Length=673

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQ CYGFF FA++ANLL+D +PKN+GKW+PLPMAMAVPF+VGA F
Sbjct  550  AILGVEGFSALPSHCLQFCYGFFAFALLANLLRDWNPKNIGKWVPLPMAMAVPFVVGAYF  609

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ W  + +++A LM+PAVASGLICGDG+W+LP S+LA  K+  PICM F
Sbjct  610  AIDMCVGSLVVFVWSWMKKEEAGLMIPAVASGLICGDGIWVLPSSLLAWFKIHPPICMNF  669

Query  361  LPAK  372
            L  K
Sbjct  670  LANK  673



>ref|XP_007039403.1| YELLOW STRIPE like 1 isoform 1 [Theobroma cacao]
 ref|XP_007039404.1| YELLOW STRIPE like 1 isoform 1 [Theobroma cacao]
 gb|EOY23904.1| YELLOW STRIPE like 1 isoform 1 [Theobroma cacao]
 gb|EOY23905.1| YELLOW STRIPE like 1 isoform 1 [Theobroma cacao]
Length=664

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQLCYGFF  A+  NL++D SP  +GKW+PLPM MAVPFLVGA F
Sbjct  542  AILGVQGFSALPHHCLQLCYGFFALAVAVNLVRDFSPHKIGKWMPLPMVMAVPFLVGAYF  601

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            A+DMC+G+L+V+ W +L  K+A LMVPAVASGLICG+GLWILP SILALAK+  PICM F
Sbjct  602  AVDMCLGTLIVFVWQKLKAKEAELMVPAVASGLICGEGLWILPASILALAKINPPICMKF  661

Query  361  LPA  369
            LP+
Sbjct  662  LPS  664



>ref|XP_009359556.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Pyrus x 
bretschneideri]
Length=664

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL+V+GFS LPQHCLQLCY FF FA++ N+++D SPK +GKW+PLPM M VPFLVG+ F
Sbjct  543  AILSVQGFSALPQHCLQLCYSFFAFAVLVNIVRDFSPK-IGKWMPLPMVMGVPFLVGSYF  601

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH++N KKA LMVPAVASGLICG+GLW LP S+LALAKVK P+CM F
Sbjct  602  AIDMCLGSLIVFVWHKINSKKAVLMVPAVASGLICGEGLWTLPASVLALAKVKPPMCMKF  661

Query  361  L  363
            L
Sbjct  662  L  662



>ref|XP_003588466.1| Metal-nicotianamine transporter YSL3 [Medicago truncatula]
Length=696

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQ CYGFF FA++ANLL+D +PKN+GKW+PLPMAMAVPF+VGA F
Sbjct  573  AILGVEGFSALPSHCLQFCYGFFAFALLANLLRDWNPKNIGKWVPLPMAMAVPFVVGAYF  632

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ W  + +++A LM+PAVASGLICGDG+W+LP S+LA  K+  PICM F
Sbjct  633  AIDMCVGSLVVFVWSWMKKEEAGLMIPAVASGLICGDGIWVLPSSLLAWFKIHPPICMNF  692

Query  361  LPAK  372
            L  K
Sbjct  693  LANK  696



>gb|KDO76708.1| hypothetical protein CISIN_1g037863mg [Citrus sinensis]
Length=672

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            A++ V+GFS LPQHCLQLCYG F  A+  NL++D SP+ +GKW+PLPM MA+PFLVGA F
Sbjct  550  AVIGVQGFSALPQHCLQLCYGLFASAVAVNLVRDFSPEKIGKWMPLPMVMALPFLVGAYF  609

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY WH+ N KKA LM+PAVASGLICG+GLW LP SILALAK++ PICM F
Sbjct  610  AIDMCVGSLVVYLWHKRNPKKAELMIPAVASGLICGEGLWTLPASILALAKIQPPICMKF  669

Query  361  LPA  369
            L +
Sbjct  670  LDS  672



>gb|EMS59689.1| putative metal-nicotianamine transporter YSL9 [Triticum urartu]
Length=492

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLC GFF FA+VANL++D  P+  GKW+PLPMAM  PFLVGASF
Sbjct  369  AILGVEGFSALPMHCLQLCCGFFAFALVANLMRDFLPQKYGKWVPLPMAMGFPFLVGASF  428

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC GSL+VY WH+++R KA  MVPAVASG ICGDGLWI P S+LALAK+  P+CM F
Sbjct  429  AIDMCAGSLIVYIWHKIDRSKAAHMVPAVASGFICGDGLWIFPASLLALAKITPPMCMAF  488



>ref|XP_006287225.1| hypothetical protein CARUB_v10000403mg [Capsella rubella]
 gb|EOA20123.1| hypothetical protein CARUB_v10000403mg [Capsella rubella]
Length=664

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+G S LP+HCL LCY FF FA+ ANL +D  P+  GKWIPLPMAMAVPFLVG SF
Sbjct  541  AILGVQGLSALPEHCLDLCYAFFAFAISANLARDFLPERPGKWIPLPMAMAVPFLVGGSF  600

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ W ++N KKA +MVPAVASGLICGDGLWILP S+LALAKVK PICM F
Sbjct  601  AIDMCIGSLVVFVWQKVNHKKADVMVPAVASGLICGDGLWILPSSLLALAKVKPPICMNF  660

Query  361  LPA  369
              A
Sbjct  661  TAA  663



>ref|XP_010658081.1| PREDICTED: YS1-like protein-like isoform X1 [Vitis vinifera]
Length=661

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEG + LPQHCLQLCYGFF FA+V N+ KDL P  +GKW+PLPM MAVPFLVGA F
Sbjct  539  AILGVEGVAALPQHCLQLCYGFFAFAVVVNMAKDLCPPKIGKWMPLPMCMAVPFLVGAYF  598

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+L+V+ WH+L+ KKA LMVPAVASGLICG+G+W LP S+LALAK+  PICM F
Sbjct  599  AIDMCLGTLIVFLWHKLDTKKAELMVPAVASGLICGEGMWTLPASVLALAKISPPICMKF  658

Query  361  LPA  369
            L +
Sbjct  659  LAS  661



>emb|CAN77515.1| hypothetical protein VITISV_013366 [Vitis vinifera]
Length=661

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEG + LPQHCLQLCYGFF FA+V N+ KDL P  +GKW+PLPM MAVPFLVGA F
Sbjct  539  AILGVEGVAALPQHCLQLCYGFFAFAVVVNMAKDLCPPKIGKWMPLPMCMAVPFLVGAYF  598

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+L+V+ WH+L+ KKA LMVPAVASGLICG+G+W LP S+LALAK+  PICM F
Sbjct  599  AIDMCLGTLIVFLWHKLDTKKAELMVPAVASGLICGEGMWTLPASVLALAKISPPICMKF  658

Query  361  LPA  369
            L +
Sbjct  659  LAS  661



>ref|XP_006476298.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Citrus 
sinensis]
Length=675

 Score =   191 bits (484),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            A++ V+GFS LPQHCLQLCYG F  A+  NL++D SP+ +GKW+PLPM MA+PFLVGA F
Sbjct  553  AVIGVQGFSALPQHCLQLCYGLFASAVAVNLVRDFSPEKIGKWMPLPMVMALPFLVGAYF  612

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY WH+ N KKA LM+PAVASGLICG+GLW LP SILALAK++ PICM F
Sbjct  613  AIDMCVGSLVVYLWHKRNPKKAELMIPAVASGLICGEGLWTLPASILALAKIQPPICMKF  672

Query  361  LPA  369
            L +
Sbjct  673  LDS  675



>ref|NP_001053450.2| Os04g0542800 [Oryza sativa Japonica Group]
 sp|Q7XN54.2|YSL16_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL16; 
AltName: Full=Protein YELLOW STRIPE LIKE 16; Short=OsYSL16 
[Oryza sativa Japonica Group]
 emb|CAE04269.2| OSJNBb0103I08.15 [Oryza sativa Japonica Group]
 gb|AAS49494.1| iron transport protein 2 [Oryza sativa]
 dbj|BAE91894.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF15364.2| Os04g0542800 [Oryza sativa Japonica Group]
 dbj|BAM67027.1| transporter for Cu-nicotianamine complex [Oryza sativa Japonica 
Group]
Length=675

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ VEGFS LP+HCLQLC GFF FA++ANL +D  P+  G+++PLPMAMAVPFLVGASF
Sbjct  552  AIIGVEGFSALPRHCLQLCAGFFAFAVLANLARDFLPRRYGRYMPLPMAMAVPFLVGASF  611

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC GSLVV+ WHR + K+A L+VPAVASGLICGDG+W  P S+LALAKVK PICM F
Sbjct  612  AIDMCAGSLVVFLWHRFDGKRAALLVPAVASGLICGDGIWTFPSSLLALAKVKPPICMKF  671

Query  361  LPAK  372
            +P  
Sbjct  672  IPGN  675



>ref|XP_006653628.1| PREDICTED: probable metal-nicotianamine transporter YSL16-like, 
partial [Oryza brachyantha]
Length=559

 Score =   189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            A+L VEGFS LP+HCLQLC GFF FA++ NL +D  P+  G+++PLPMAMAVPFLVGA+F
Sbjct  436  AVLGVEGFSALPRHCLQLCAGFFAFAVLVNLARDFLPRRYGRFMPLPMAMAVPFLVGANF  495

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY WH+++ K+A L+VPAVASGLICGDG+WI P S+LALAKVK PICM F
Sbjct  496  AIDMCVGSLVVYVWHKVDGKRAALLVPAVASGLICGDGIWIFPSSLLALAKVKPPICMKF  555

Query  361  LPAK  372
             P  
Sbjct  556  TPGN  559



>gb|EAY95023.1| hypothetical protein OsI_16833 [Oryza sativa Indica Group]
Length=721

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ VEGFS LP+HCLQLC GFF FA++ANL +D  P+  G+++PLPMAMAVPFLVGASF
Sbjct  598  AIIGVEGFSALPRHCLQLCAGFFAFAVLANLARDFLPRRYGRYMPLPMAMAVPFLVGASF  657

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC GSLVV+ WHR + K+A L+VPAVASGLICGDG+W  P S+LALAKVK PICM F
Sbjct  658  AIDMCAGSLVVFLWHRFDGKRAALLVPAVASGLICGDGIWTFPSSLLALAKVKPPICMKF  717

Query  361  LPAK  372
            +P  
Sbjct  718  IPGN  721



>emb|CBI34579.3| unnamed protein product [Vitis vinifera]
Length=679

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEG + LPQHCLQLCYGFF FA+V N+ KDL P  +GKW+PLPM MAVPFLVGA F
Sbjct  539  AILGVEGVAALPQHCLQLCYGFFAFAVVVNMAKDLCPPKIGKWMPLPMCMAVPFLVGAYF  598

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+L+V+ WH+L+ KKA LMVPAVASGLICG+G+W LP S+LALAK+  PICM F
Sbjct  599  AIDMCLGTLIVFLWHKLDTKKAELMVPAVASGLICGEGMWTLPASVLALAKISPPICMKF  658

Query  361  L  363
            L
Sbjct  659  L  659



>ref|XP_008360215.1| PREDICTED: LOW QUALITY PROTEIN: metal-nicotianamine transporter 
YSL1-like [Malus domestica]
Length=641

 Score =   190 bits (482),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 103/121 (85%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGF  FA++ N+++D  PK +GKW+PLPM M VPFLVGA F
Sbjct  520  AILGVQGFSALPQHCLQLCYGFLAFAVIVNIVRDFLPK-IGKWMPLPMVMGVPFLVGAYF  578

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH++N KKA LMVPAVASGLICG+GLW LP S+LALAKVK P+CM F
Sbjct  579  AIDMCIGSLIVFVWHKINSKKAVLMVPAVASGLICGEGLWTLPASVLALAKVKPPMCMKF  638

Query  361  L  363
            L
Sbjct  639  L  639



>emb|CDO99601.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   190 bits (482),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP++CL LCYGFF  A+  N++KDLSP  +GKW+P+PMA+A+PFLVGA  
Sbjct  556  AILGVEGFSALPRYCLDLCYGFFALAVGINIVKDLSPARIGKWMPVPMAVALPFLVGAYV  615

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ WH+LN KKA LMVPAVASGLICG+GLW+LP SILALAKVK PICM F
Sbjct  616  AIDMCIGSLVVFVWHKLNSKKAELMVPAVASGLICGEGLWVLPASILALAKVKPPICMKF  675

Query  361  LPA  369
            L +
Sbjct  676  LAS  678



>ref|XP_008367109.1| PREDICTED: LOW QUALITY PROTEIN: metal-nicotianamine transporter 
YSL1-like [Malus domestica]
Length=656

 Score =   190 bits (482),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGF  FA+  N+++D  PK +GKW+PLPM M VPFLVGA F
Sbjct  535  AILGVQGFSALPQHCLQLCYGFXAFAVJVNIVRDFXPK-IGKWMPLPMVMGVPFLVGAYF  593

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH++N KKA LMVPAVASGLICG+GLW LP S+LALAKVK P+CM F
Sbjct  594  AIDMCIGSLIVFVWHKINSKKAVLMVPAVASGLICGEGLWTLPASVLALAKVKPPMCMKF  653

Query  361  L  363
            L
Sbjct  654  L  654



>ref|XP_010100194.1| Metal-nicotianamine transporter YSL1 [Morus notabilis]
 gb|EXB81865.1| Metal-nicotianamine transporter YSL1 [Morus notabilis]
Length=666

 Score =   190 bits (482),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP+HCLQLC GFF FA+V N+++D SPK +GKW+PLPM M VPFLVGA F
Sbjct  544  AILGVQGFSALPRHCLQLCLGFFAFAVVVNIVRDFSPKKIGKWMPLPMVMGVPFLVGAYF  603

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+L+V+ WH+LN K A +MVPAVASGLICG+G+W LP S+LAL KVK PICM F
Sbjct  604  AIDMCVGTLIVFLWHKLNTKNAEMMVPAVASGLICGEGMWTLPASVLALTKVKPPICMKF  663

Query  361  L  363
            +
Sbjct  664  V  664



>gb|EMS63506.1| putative metal-nicotianamine transporter YSL9 [Triticum urartu]
Length=644

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQLCYGFF FA+VANL++DL P   G+ +PLPMAM VPFLVGASF
Sbjct  521  AILGVEGFSALPQHCLQLCYGFFGFAVVANLMRDLLPPKYGRCVPLPMAMGVPFLVGASF  580

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ W+ ++R KA LMVPAVASGLICGDGLWI P ++LALAK+  P CM F
Sbjct  581  AIDMCVGSLVVFVWNMMDRSKAALMVPAVASGLICGDGLWIFPSALLALAKISPPFCMAF  640

Query  361  LPAK  372
             P  
Sbjct  641  RPTH  644



>ref|XP_011026790.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Populus euphratica]
 ref|XP_011026791.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Populus euphratica]
Length=669

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGFF FA+  NL++D SP+ +G+W+PLPM M VPFL+GASF
Sbjct  547  AILGVDGFSALPQHCLQLCYGFFAFAIAINLVRDFSPQKIGQWMPLPMVMGVPFLIGASF  606

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM +GSL+V  WH+ N KKA  MVPAVASGLICG+GLW LP+++LALA+VK PICM F
Sbjct  607  AIDMSIGSLIVLIWHKRNTKKAEFMVPAVASGLICGEGLWTLPEAVLALAQVKPPICMKF  666

Query  361  LPA  369
            + +
Sbjct  667  VAS  669



>ref|XP_006439232.1| hypothetical protein CICLE_v10019189mg [Citrus clementina]
 gb|ESR52472.1| hypothetical protein CICLE_v10019189mg [Citrus clementina]
Length=667

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            A++ V+GFS LPQHCLQLCYG F  A+  NL++D SP+ +GKW+PLPM MA+PFLVGA F
Sbjct  545  AVIGVQGFSALPQHCLQLCYGLFASAVAVNLVRDFSPEKIGKWMPLPMVMALPFLVGAYF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY WH+ N KKA LM+PAVASGLICG+GLW LP SILALAK++ P+CM F
Sbjct  605  AIDMCVGSLVVYLWHKRNPKKAELMIPAVASGLICGEGLWTLPASILALAKIQPPLCMKF  664

Query  361  LPA  369
            L +
Sbjct  665  LDS  667



>ref|XP_011026792.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X2 [Populus euphratica]
Length=668

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGFF FA+  NL++D SP+ +G+W+PLPM M VPFL+GASF
Sbjct  546  AILGVDGFSALPQHCLQLCYGFFAFAIAINLVRDFSPQKIGQWMPLPMVMGVPFLIGASF  605

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM +GSL+V  WH+ N KKA  MVPAVASGLICG+GLW LP+++LALA+VK PICM F
Sbjct  606  AIDMSIGSLIVLIWHKRNTKKAEFMVPAVASGLICGEGLWTLPEAVLALAQVKPPICMKF  665

Query  361  LPA  369
            + +
Sbjct  666  VAS  668



>ref|XP_008661601.1| PREDICTED: uncharacterized protein LOC100273385 isoform X2 [Zea 
mays]
 gb|ACR36914.1| unknown [Zea mays]
 gb|AFW59028.1| hypothetical protein ZEAMMB73_172012 [Zea mays]
Length=672

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HCLQLC GFF FA++ANL +DL P+ + + +PLPMAMAVPFLVGASF
Sbjct  549  AILGVEGFSALPRHCLQLCAGFFAFAVLANLARDLLPRRLARLVPLPMAMAVPFLVGASF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            A+DMC+GSLVV+ WH+L+ KKA L+VPAVASGLICGDG+W  P S+LALAKVK PICM F
Sbjct  609  AVDMCVGSLVVFAWHKLDGKKAALLVPAVASGLICGDGIWTFPSSLLALAKVKPPICMKF  668

Query  361  LPAK  372
             P  
Sbjct  669  TPGS  672



>ref|XP_008661599.1| PREDICTED: uncharacterized protein LOC100273385 isoform X1 [Zea 
mays]
 ref|XP_008661600.1| PREDICTED: uncharacterized protein LOC100273385 isoform X1 [Zea 
mays]
 gb|AFW59029.1| hypothetical protein ZEAMMB73_172012 [Zea mays]
Length=727

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HCLQLC GFF FA++ANL +DL P+ + + +PLPMAMAVPFLVGASF
Sbjct  604  AILGVEGFSALPRHCLQLCAGFFAFAVLANLARDLLPRRLARLVPLPMAMAVPFLVGASF  663

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            A+DMC+GSLVV+ WH+L+ KKA L+VPAVASGLICGDG+W  P S+LALAKVK PICM F
Sbjct  664  AVDMCVGSLVVFAWHKLDGKKAALLVPAVASGLICGDGIWTFPSSLLALAKVKPPICMKF  723

Query  361  LPAK  372
             P  
Sbjct  724  TPGS  727



>ref|XP_003588469.1| Metal-nicotianamine transporter YSL2 [Medicago truncatula]
 gb|AES58720.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=673

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI  VEGFS LP HCLQ C GFF FA++ANLL+DL+PKN+GKW+PLPMAMAVPF+VGA F
Sbjct  550  AIFGVEGFSALPSHCLQFCCGFFAFALLANLLRDLNPKNIGKWVPLPMAMAVPFVVGAYF  609

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ W  +  K+A LM+PAVASGLICGDG+W+LP S+LA  K+  PICM F
Sbjct  610  AIDMCVGSLVVFVWSWMKNKEAGLMIPAVASGLICGDGIWVLPSSLLAWFKIHPPICMNF  669

Query  361  LPAK  372
            L  K
Sbjct  670  LANK  673



>gb|KEH42903.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=680

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            A++ V+GFS LP+HCLQLC+GFF FA+  N+L+D SPK +GKW+PLPM MAVPFLVGA F
Sbjct  558  AVIGVQGFSALPRHCLQLCFGFFAFAIGTNMLRDFSPKKIGKWMPLPMVMAVPFLVGAYF  617

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC GSLVV+  H+LN KKA LMVPA+ASGLICG+GLW LP +ILALAK+  PICM F
Sbjct  618  AIDMCTGSLVVFVLHKLNSKKAELMVPAIASGLICGEGLWTLPAAILALAKINPPICMKF  677

Query  361  LPA  369
            + +
Sbjct  678  VTS  680



>ref|XP_007151963.1| hypothetical protein PHAVU_004G090100g [Phaseolus vulgaris]
 gb|ESW23957.1| hypothetical protein PHAVU_004G090100g [Phaseolus vulgaris]
Length=668

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            A+L VEGFS LPQHCLQ+CYGFF  A+  N+++DL PK +GKW+PLPM MA+PFLVGA F
Sbjct  546  AVLGVEGFSALPQHCLQICYGFFALAVAVNMMRDLCPKKIGKWMPLPMVMAIPFLVGAYF  605

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVVY WH++N  +A  M+ A ASGLICG+GLW LP SILALAK+  PICM F
Sbjct  606  AIDMCLGSLVVYVWHKVNPNRAETMLSATASGLICGEGLWALPASILALAKIHPPICMKF  665

Query  361  LPA  369
             P+
Sbjct  666  FPS  668



>ref|XP_002299431.1| hypothetical protein POPTR_0001s11310g [Populus trichocarpa]
 gb|EEE84236.1| hypothetical protein POPTR_0001s11310g [Populus trichocarpa]
Length=652

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCLQLCYGFF FA+  NL++D SP+ +G+W+PLPM M VPFL+GASF
Sbjct  530  AILGVDGFSALPQHCLQLCYGFFAFAIAINLVRDFSPQKIGQWMPLPMVMGVPFLIGASF  589

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM +GSL+V  WH+ + KKA  MVPAVASGLICG+GLW LP+++LALA+VK PICM F
Sbjct  590  AIDMSIGSLIVLIWHKRDTKKAEFMVPAVASGLICGEGLWTLPEAVLALAQVKPPICMKF  649

Query  361  LPA  369
            + +
Sbjct  650  VAS  652



>ref|XP_010541874.1| PREDICTED: metal-nicotianamine transporter YSL1 [Tarenaya hassleriana]
Length=654

 Score =   187 bits (476),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ N+++D +P+N+GK++PLP+AMAVPFLVGA F
Sbjct  532  AILGVQGFSALPLHCLQMCYGFFAFAVLVNVVRDFAPRNIGKFMPLPIAMAVPFLVGAYF  591

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+L+V+ W ++NRKKA +MVPAVASGLICG+GLW LP+S+LALA V  PICM F
Sbjct  592  AIDMCVGTLIVFVWEKMNRKKAEVMVPAVASGLICGEGLWTLPESVLALAGVNPPICMKF  651



>ref|NP_001266881.1| probable metal-nicotianamine transporter YSL9-like [Brachypodium 
distachyon]
 ref|XP_010239579.1| PREDICTED: probable metal-nicotianamine transporter YSL9-like 
isoform X1 [Brachypodium distachyon]
 gb|ADO64257.1| yellow stripe-like 9 transporter [Brachypodium distachyon]
Length=663

 Score =   187 bits (476),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FA+VAN+++D  P+  GKWIPLPMAM  PFLVG SF
Sbjct  540  AILGVEGFSALPMHCLQLCYGFFGFALVANVMRDFLPRKYGKWIPLPMAMGFPFLVGGSF  599

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+VY W +++R KA  MVPAVASG ICGDGLWI P S+LALAK+  P+CM F
Sbjct  600  AIDMCVGSLIVYIWRKIDRTKAGHMVPAVASGFICGDGLWIFPASLLALAKITPPMCMAF  659



>ref|XP_003588462.1| Metal-nicotianamine transporter YSL2 [Medicago truncatula]
Length=1748

 Score =   191 bits (486),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  1     AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
             AIL VEGFS LP HCLQ CYGFF FA++ANLL+D +PKN+GKW+PLPMAMAVPF+VGA F
Sbjct  1625  AILGVEGFSALPSHCLQFCYGFFAFALLANLLRDWNPKNIGKWVPLPMAMAVPFVVGAYF  1684

Query  181   AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
             AIDMC+GSLVV+ W  + +++A LM+PAVASGLICGDG+W+LP S+LA  KV  PICM F
Sbjct  1685  AIDMCVGSLVVFVWSWMKKEEAGLMIPAVASGLICGDGIWVLPSSLLAWFKVHPPICMNF  1744

Query  361   LPAK  372
             L  K
Sbjct  1745  LANK  1748


 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI  VEGFS LP HCLQ C GFF FA++ANLL DL+PKN+GKW+PLPMAMAVPF+VGA F
Sbjct  625  AIFGVEGFSALPSHCLQFCCGFFAFALLANLLSDLNPKNIGKWVPLPMAMAVPFVVGAYF  684

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ W  +  K+A LM+PAVASGLICGDG+W+LP S+LA  K+  PICM F
Sbjct  685  AIDMCVGSLVVFVWSWMKNKEAGLMIPAVASGLICGDGIWVLPSSLLAWFKIHPPICMNF  744

Query  361  L  363
            +
Sbjct  745  V  745



>ref|NP_001268107.1| YS1-like protein-like [Vitis vinifera]
 gb|AAT09976.1| putative YS1-like protein [Vitis vinifera]
Length=661

 Score =   187 bits (476),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI  VEG + LPQHCLQLCYGFF FA+V N+ KDL P  +GKW+PLPM MAVPFLVGA F
Sbjct  539  AIPGVEGVAALPQHCLQLCYGFFAFAVVVNMAKDLCPPKIGKWMPLPMCMAVPFLVGAYF  598

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+L+V+ WH+L+ KKA LMVPAVASGLICG+G+W LP S+LALAK+  PICM F
Sbjct  599  AIDMCLGTLIVFLWHKLDTKKAELMVPAVASGLICGEGMWTLPASVLALAKISPPICMKF  658

Query  361  LPA  369
            L +
Sbjct  659  LAS  661



>gb|AFP55583.1| yellow stripe-like protein [Rosa rugosa]
Length=832

 Score =   188 bits (477),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LPQHCLQ+CYGFF FA+ ANLL+DL+P  +GK++PLPMAMAVPFLVGA F
Sbjct  524  AILGVEGFSALPQHCLQICYGFFGFAVAANLLRDLAPTKIGKYVPLPMAMAVPFLVGAYF  583

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKV  336
            AIDMC+GSL+V+ WH+L   KA+LMVPAVASGLICGDGLWILP SILALAK+
Sbjct  584  AIDMCVGSLIVFVWHKLKHNKASLMVPAVASGLICGDGLWILPSSILALAKL  635



>ref|XP_010676897.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Beta vulgaris 
subsp. vulgaris]
Length=665

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HCL+LC GFFVFA+VA+L++DL+P  +G+ +PLPM MAVPFLVG  F
Sbjct  541  AILGVEGFSALPRHCLELCCGFFVFAIVADLIRDLAPSKIGRLMPLPMVMAVPFLVGGYF  600

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV+ W++++ K++ LMVPAVASGLICG+GLW LP S LALA V  PICMTF
Sbjct  601  AIDMCVGSLVVFVWNKIDSKQSELMVPAVASGLICGEGLWSLPASFLALANVNPPICMTF  660

Query  361  LPAKA  375
            LP+K 
Sbjct  661  LPSKT  665



>ref|XP_011470899.1| PREDICTED: metal-nicotianamine transporter YSL1 [Fragaria vesca 
subsp. vesca]
 ref|XP_011470900.1| PREDICTED: metal-nicotianamine transporter YSL1 [Fragaria vesca 
subsp. vesca]
 ref|XP_004309544.2| PREDICTED: metal-nicotianamine transporter YSL1 [Fragaria vesca 
subsp. vesca]
Length=663

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HC+QLCYGFF FA++ NL++D SP  +GKW+PLPM M VPFLVGA F
Sbjct  541  AILGVEGFSALPRHCVQLCYGFFAFAVMVNLIRDFSPPKIGKWMPLPMVMGVPFLVGAYF  600

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM +GS++V+ WHRL+   A +MVPAVASGLICG+GLW LP S+LALAKVK PICM F
Sbjct  601  AIDMFIGSVIVFAWHRLDSMNAGMMVPAVASGLICGEGLWSLPASVLALAKVKPPICMKF  660

Query  361  L  363
            L
Sbjct  661  L  661



>gb|KEH35475.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=664

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLC GFF FA+VANL++DL P+ VGKWIPLPMAMAVPFLVG  F
Sbjct  544  AILGVEGFSALPDHCLQLCCGFFAFAIVANLVRDLGPQQVGKWIPLPMAMAVPFLVGGYF  603

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAK  333
            AIDMC+GSLVV+ WH LN+K+A LMVPAVASGLICGDGLWILP SILAL K
Sbjct  604  AIDMCVGSLVVFAWHMLNKKEAGLMVPAVASGLICGDGLWILPSSILALLK  654



>ref|XP_002518903.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF43436.1| oligopeptide transporter, putative [Ricinus communis]
Length=667

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEG S LP HCLQLCYGFF FA+  NL++DLSP+ +G W+PLPM MAVPFLVGA F
Sbjct  545  AILGVEGISALPHHCLQLCYGFFGFAVAINLVRDLSPRKLGPWMPLPMVMAVPFLVGAYF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V++W++LN KKA  M+PAVASGLICG+GLW LP ++LALAK+  PICM F
Sbjct  605  AIDMCIGSLIVFSWNKLNGKKAESMIPAVASGLICGEGLWTLPAAVLALAKINPPICMKF  664

Query  361  LPA  369
            + +
Sbjct  665  VAS  667



>ref|XP_007161580.1| hypothetical protein PHAVU_001G081600g [Phaseolus vulgaris]
 ref|XP_007161581.1| hypothetical protein PHAVU_001G081600g [Phaseolus vulgaris]
 gb|ESW33574.1| hypothetical protein PHAVU_001G081600g [Phaseolus vulgaris]
 gb|ESW33575.1| hypothetical protein PHAVU_001G081600g [Phaseolus vulgaris]
Length=670

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+GFS LPQHCLQLC+GFF FA+ AN ++DLSP+ +GKW+PLPM MAVPFLVGA F
Sbjct  548  AIIGVQGFSALPQHCLQLCFGFFAFAIGANTIRDLSPQKIGKWVPLPMVMAVPFLVGAYF  607

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM +GS+VV+ WH+L+  KA  MVPA ASGLICG+GLW LP +ILALA++  PICM F
Sbjct  608  AIDMFIGSVVVFVWHKLDSIKAESMVPAAASGLICGEGLWTLPAAILALARIHPPICMKF  667

Query  361  LPA  369
            +P+
Sbjct  668  VPS  670



>ref|XP_002299420.2| hypothetical protein POPTR_0001s11510g [Populus trichocarpa]
 gb|EEE84225.2| hypothetical protein POPTR_0001s11510g [Populus trichocarpa]
Length=667

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ VEGFS LPQ+CLQLC GFF FA+  NL++D  P+ +G+W+PLP+ MAVPF++GASF
Sbjct  545  AIIGVEGFSALPQYCLQLCCGFFAFAIAVNLVRDFLPRKIGQWVPLPLVMAVPFVIGASF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ WH+ N  KA  M+PAVASGLICG+GLW LP +ILALAK+K PICM F
Sbjct  605  AIDMCVGSLIVFVWHKRNTNKAEFMIPAVASGLICGEGLWTLPAAILALAKIKPPICMNF  664

Query  361  LPA  369
            + +
Sbjct  665  VAS  667



>ref|XP_006413472.1| hypothetical protein EUTSA_v10024600mg [Eutrema salsugineum]
 gb|ESQ54925.1| hypothetical protein EUTSA_v10024600mg [Eutrema salsugineum]
Length=672

 Score =   184 bits (468),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ N+++DL+P  VG+++PLP AMAVPFLVGA F
Sbjct  550  AILGVQGFSALPLHCLQMCYGFFGFAVLVNVVRDLTPAKVGRFMPLPTAMAVPFLVGAYF  609

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+LVV+ W ++NRKKA +MVPAVASGLICG+GLW LP +ILALA +K PICM F
Sbjct  610  AIDMCVGTLVVFVWEKMNRKKAEVMVPAVASGLICGEGLWTLPAAILALAGIKPPICMKF  669

Query  361  LPA  369
            L +
Sbjct  670  LAS  672



>ref|XP_010433812.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Camelina 
sativa]
 ref|XP_010433813.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Camelina 
sativa]
Length=671

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ N+++DL+P  +G+++PLP AMAVPFLVGA F
Sbjct  549  AILGVQGFSALPLHCLQMCYGFFGFAVLVNVVRDLTPAKIGRFMPLPTAMAVPFLVGAYF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+LVV+ W ++NRKKA +MVPAVASGLICG+GLW LP ++LALA VK PICM F
Sbjct  609  AIDMCVGTLVVFVWEKMNRKKAEVMVPAVASGLICGEGLWTLPAAVLALAGVKPPICMKF  668

Query  361  LPA  369
            L +
Sbjct  669  LAS  671



>emb|CAB51655.1| putative protein [Arabidopsis thaliana]
 emb|CAB81330.1| putative protein [Arabidopsis thaliana]
Length=620

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ N+++DL+P  +G+++PLP AMAVPFLVGA F
Sbjct  498  AILGVQGFSALPLHCLQMCYGFFGFAVLVNVVRDLTPAKIGRFMPLPTAMAVPFLVGAYF  557

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+L+V+ W ++NRKKA  MVPAVASGLICG+GLW LP ++LALA VK PICM F
Sbjct  558  AIDMCVGTLIVFVWEKMNRKKAEFMVPAVASGLICGEGLWTLPAAVLALAGVKPPICMKF  617

Query  361  LPA  369
            L +
Sbjct  618  LAS  620



>ref|XP_010439083.1| PREDICTED: metal-nicotianamine transporter YSL1 [Camelina sativa]
Length=671

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ N+++DL+P  +G+++PLP AMAVPFLVGA F
Sbjct  549  AILGVQGFSALPLHCLQMCYGFFGFAVLVNVVRDLTPAKIGRFMPLPTAMAVPFLVGAYF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+LVV+ W ++NRKKA +MVPAVASGLICG+GLW LP ++LALA VK PICM F
Sbjct  609  AIDMCVGTLVVFVWEKMNRKKAEVMVPAVASGLICGEGLWTLPAAVLALAGVKPPICMKF  668

Query  361  LPA  369
            L +
Sbjct  669  LAS  671



>gb|AFU82907.1| yellow stripe-like transporter 1 [Arachis hypogaea]
Length=679

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            A++ VEGFS LP HCLQLCY FF FA+  N+++D SPK + KW+PLPM MAVPFLVGA F
Sbjct  557  AVIGVEGFSALPHHCLQLCYAFFAFAVAVNVVRDHSPKKIAKWMPLPMVMAVPFLVGAYF  616

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM MG+++V+ WH++N KKA LMVPA ASGLICG+GLW LP +ILALA++  PICM F
Sbjct  617  AIDMFMGTVIVFLWHKINDKKAKLMVPAAASGLICGEGLWTLPAAILALARINPPICMKF  676

Query  361  LPA  369
            +P+
Sbjct  677  VPS  679



>ref|XP_010448607.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Camelina 
sativa]
Length=685

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ N+++DL+P  +G+++PLP AMAVPFLVGA F
Sbjct  563  AILGVQGFSALPLHCLQMCYGFFGFAVLVNVVRDLTPAKIGRFMPLPTAMAVPFLVGAYF  622

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+LVV+ W ++NRKKA +MVPAVASGLICG+GLW LP ++LALA VK PICM F
Sbjct  623  AIDMCVGTLVVFVWEKMNRKKAEVMVPAVASGLICGEGLWTLPAAVLALAGVKPPICMKF  682

Query  361  LPA  369
            L +
Sbjct  683  LAS  685



>ref|XP_006606419.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X3 [Glycine max]
Length=670

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+GFS LPQHCLQLC+GFF FA+  N+++D +P+ +GKW+PLPM MAVPFLVGA F
Sbjct  548  AIIGVQGFSALPQHCLQLCFGFFAFAIGVNMIRDFAPQKIGKWMPLPMVMAVPFLVGAYF  607

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM +G++VV+ W +L+ KKA LMVPA ASGLICG+GLW LP +ILALA++K PICM F
Sbjct  608  AIDMFIGTVVVFAWQKLDSKKAELMVPAAASGLICGEGLWTLPAAILALARIKPPICMKF  667

Query  361  LPA  369
            +P 
Sbjct  668  VPT  670



>ref|XP_003556427.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X1 [Glycine max]
 ref|XP_006606418.1| PREDICTED: metal-nicotianamine transporter YSL1-like isoform 
X2 [Glycine max]
Length=671

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+GFS LPQHCLQLC+GFF FA+  N+++D +P+ +GKW+PLPM MAVPFLVGA F
Sbjct  549  AIIGVQGFSALPQHCLQLCFGFFAFAIGVNMIRDFAPQKIGKWMPLPMVMAVPFLVGAYF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM +G++VV+ W +L+ KKA LMVPA ASGLICG+GLW LP +ILALA++K PICM F
Sbjct  609  AIDMFIGTVVVFAWQKLDSKKAELMVPAAASGLICGEGLWTLPAAILALARIKPPICMKF  668

Query  361  LPA  369
            +P 
Sbjct  669  VPT  671



>gb|KHN04996.1| Metal-nicotianamine transporter YSL1 [Glycine soja]
Length=662

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+GFS LPQHCLQLC+GFF FA+  N+++D +P+ +GKW+PLPM MAVPFLVGA F
Sbjct  540  AIIGVQGFSALPQHCLQLCFGFFAFAIGVNMIRDFAPQKIGKWMPLPMVMAVPFLVGAYF  599

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM +G++VV+ W +L+ KKA LMVPA ASGLICG+GLW LP +ILALA++K PICM F
Sbjct  600  AIDMFIGTVVVFAWQKLDSKKAELMVPAAASGLICGEGLWTLPAAILALARIKPPICMKF  659

Query  361  LPA  369
            +P 
Sbjct  660  VPT  662



>ref|XP_006283265.1| hypothetical protein CARUB_v10004301mg [Capsella rubella]
 gb|EOA16163.1| hypothetical protein CARUB_v10004301mg [Capsella rubella]
Length=672

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ N+++DL+P  +G+++PLP AMAVPFLVGA F
Sbjct  550  AILGVQGFSALPLHCLQMCYGFFGFAVLVNVVRDLTPAKIGRFMPLPTAMAVPFLVGAYF  609

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+L+V+ W ++NRKKA +MVPAVASGLICG+GLW LP ++LALA VK PICM F
Sbjct  610  AIDMCVGTLIVFVWEKMNRKKAEVMVPAVASGLICGEGLWTLPAAVLALAGVKPPICMKF  669

Query  361  LPA  369
            L +
Sbjct  670  LAS  672



>ref|XP_002869737.1| hypothetical protein ARALYDRAFT_492451 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45996.1| hypothetical protein ARALYDRAFT_492451 [Arabidopsis lyrata subsp. 
lyrata]
Length=673

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ N+++DL+P  +G+++PLP AMAVPFLVGA F
Sbjct  551  AILGVQGFSALPLHCLQMCYGFFGFAVLVNVVRDLTPAKIGRFMPLPTAMAVPFLVGAYF  610

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+L+V+ W ++NRKKA  MVPAVASGLICG+GLW LP ++LALA VK PICM F
Sbjct  611  AIDMCVGTLIVFVWEKMNRKKAEFMVPAVASGLICGEGLWTLPAAVLALAGVKPPICMKF  670

Query  361  LPA  369
            L +
Sbjct  671  LAS  673



>emb|CDX76329.1| BnaA08g10710D [Brassica napus]
Length=675

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ N+++DL+P  VG+++PLP AMAVPFLVGA F
Sbjct  553  AILGVQGFSALPLHCLQMCYGFFGFAVLVNVVRDLTPAKVGRFMPLPTAMAVPFLVGAYF  612

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+++V+ W ++NRKKA +MVPAVASGLICG+GLW LP +ILALA VK PICM F
Sbjct  613  AIDMCVGTVIVFVWEKMNRKKAEVMVPAVASGLICGEGLWTLPAAILALAGVKPPICMKF  672

Query  361  LPA  369
            L +
Sbjct  673  LAS  675



>emb|CDY03488.1| BnaC01g15940D [Brassica napus]
Length=675

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ N+++DL+P  VG+++PLP AMAVPFLVGA F
Sbjct  553  AILGVQGFSALPLHCLQMCYGFFGFAVLVNVVRDLTPAKVGRFMPLPTAMAVPFLVGAYF  612

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+++V+ W ++NRKKA +MVPAVASGLICG+GLW LP +ILALA VK PICM F
Sbjct  613  AIDMCVGTVIVFVWEKMNRKKAEVMVPAVASGLICGEGLWTLPAAILALAGVKPPICMKF  672

Query  361  LPA  369
            L +
Sbjct  673  LAS  675



>ref|XP_009137708.1| PREDICTED: metal-nicotianamine transporter YSL1 isoform X1 [Brassica 
rapa]
Length=675

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ N+++DL+P  VG+++PLP AMAVPFLVGA F
Sbjct  553  AILGVQGFSALPLHCLQMCYGFFGFAVLVNVVRDLTPAKVGRFMPLPTAMAVPFLVGAYF  612

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+++V+ W ++NRKKA +MVPAVASGLICG+GLW LP +ILALA VK PICM F
Sbjct  613  AIDMCVGTVIVFVWEKMNRKKAEVMVPAVASGLICGEGLWTLPAAILALAGVKPPICMKF  672

Query  361  LPA  369
            L +
Sbjct  673  LAS  675



>ref|NP_567694.2| metal-nicotianamine transporter YSL1 [Arabidopsis thaliana]
 sp|Q6R3L0.2|YSL1_ARATH RecName: Full=Metal-nicotianamine transporter YSL1; AltName: 
Full=Protein YELLOW STRIPE LIKE 1; Short=AtYSL1 [Arabidopsis 
thaliana]
 gb|AEE84852.1| metal-nicotianamine transporter YSL1 [Arabidopsis thaliana]
Length=673

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ N+++DL+P  +G+++PLP AMAVPFLVGA F
Sbjct  551  AILGVQGFSALPLHCLQMCYGFFGFAVLVNVVRDLTPAKIGRFMPLPTAMAVPFLVGAYF  610

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+L+V+ W ++NRKKA  MVPAVASGLICG+GLW LP ++LALA VK PICM F
Sbjct  611  AIDMCVGTLIVFVWEKMNRKKAEFMVPAVASGLICGEGLWTLPAAVLALAGVKPPICMKF  670

Query  361  LPA  369
            L +
Sbjct  671  LAS  673



>gb|AAB63613.1| unknown protein [Arabidopsis thaliana]
Length=667

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ N+++DL+P  +G+++PLP AMAVPFLVGA F
Sbjct  545  AILGVQGFSALPLHCLQMCYGFFGFAVLVNVVRDLTPAKIGRFMPLPTAMAVPFLVGAYF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+L+V+ W ++NRKKA  MVPAVASGLICG+GLW LP ++LALA VK PICM F
Sbjct  605  AIDMCVGTLIVFVWEKMNRKKAEFMVPAVASGLICGEGLWTLPAAVLALAGVKPPICMKF  664

Query  361  LPA  369
            L +
Sbjct  665  LAS  667



>ref|XP_011470187.1| PREDICTED: metal-nicotianamine transporter YSL3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=672

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LPQHCL LCY FF FA+ ANLL+D  PK + K++PLPMAMAVPFLVGA F
Sbjct  548  AILGVQGFSALPQHCLDLCYAFFSFAIAANLLRDFGPKKMSKYVPLPMAMAVPFLVGAYF  607

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKA  342
            AIDMCMGSL+V+ WH+L   KA+LMVPAVASGLICGDGLWILP SILALAK+ +
Sbjct  608  AIDMCMGSLIVFVWHKLKHNKASLMVPAVASGLICGDGLWILPSSILALAKLDS  661



>ref|XP_009137713.1| PREDICTED: metal-nicotianamine transporter YSL1 isoform X2 [Brassica 
rapa]
Length=667

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ N+++DL+P  VG+++PLP AMAVPFLVGA F
Sbjct  545  AILGVQGFSALPLHCLQMCYGFFGFAVLVNVVRDLTPAKVGRFMPLPTAMAVPFLVGAYF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+++V+ W ++NRKKA +MVPAVASGLICG+GLW LP +ILALA VK PICM F
Sbjct  605  AIDMCVGTVIVFVWEKMNRKKAEVMVPAVASGLICGEGLWTLPAAILALAGVKPPICMKF  664

Query  361  LPA  369
            L +
Sbjct  665  LAS  667



>gb|AAS00691.1| metal-nicotianamine transporter YSL1 [Arabidopsis thaliana]
Length=673

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ N+++DL+P  +G+++PLP AMAVPFLVGA F
Sbjct  551  AILGVQGFSALPLHCLQMCYGFFGFAVLVNVVRDLTPAKIGRFMPLPTAMAVPFLVGAYF  610

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+L+V+ W ++NRKKA  MVPAVASGLICG+GLW LP ++LALA VK PICM F
Sbjct  611  AIDMCVGTLIVFVWEKMNRKKAEFMVPAVASGLICGEGLWTLPAAVLALAGVKPPICMKF  670

Query  361  LPA  369
            L +
Sbjct  671  LAS  673



>emb|CDY35455.1| BnaC03g62050D [Brassica napus]
Length=674

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ N+++DL+P+ VG+++PLP AMAVPFLVGA F
Sbjct  552  AILGVQGFSALPLHCLQMCYGFFGFAVLVNVVRDLTPEKVGRFMPLPTAMAVPFLVGAYF  611

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+LVV+ W + NR+KA +MVPAVASGLICG+GLW LP ++LALA VK PICM F
Sbjct  612  AIDMCVGTLVVFIWEKRNRRKAEVMVPAVASGLICGEGLWTLPAAVLALAGVKPPICMKF  671

Query  361  LPA  369
            L +
Sbjct  672  LAS  674



>gb|ADE77032.1| unknown [Picea sitchensis]
Length=210

 Score =   173 bits (438),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGF  LP+HCL +CY FF  A+V NL++D  PK V ++IPLPMAMA+PF +G  F
Sbjct  75   AILGVEGFGALPKHCLTICYCFFAAAIVINLIRDRVPKKVSQYIPLPMAMAIPFYLGGYF  134

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+ +V+ W ++NRK A +MVPAVASGLICGDG+W LP SILALAKV  PICM F
Sbjct  135  AIDMCVGTAIVFVWKKINRKNADIMVPAVASGLICGDGVWTLPSSILALAKVNPPICMKF  194

Query  361  L  363
            L
Sbjct  195  L  195



>gb|AAK62460.1|AF387015_1 putative protein [Arabidopsis thaliana]
Length=665

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V GFS LP HCLQ+CYGFF FA++ N+++DL+P  +G+++PLP AMAVPFLVGA F
Sbjct  543  AILGVRGFSALPLHCLQMCYGFFGFAVLVNVVRDLTPAKIGRFMPLPTAMAVPFLVGAYF  602

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+L+V+ W ++NRKKA  MVPAVASGLICG+GLW LP ++LALA VK PICM F
Sbjct  603  AIDMCVGTLIVFVWEKMNRKKAEFMVPAVASGLICGEGLWTLPAAVLALAGVKPPICMKF  662

Query  361  LPA  369
            L +
Sbjct  663  LAS  665



>ref|XP_006849121.1| hypothetical protein AMTR_s00027p00045420 [Amborella trichopoda]
 gb|ERN10702.1| hypothetical protein AMTR_s00027p00045420 [Amborella trichopoda]
Length=651

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQLCYGFF FAM+ NL+KDL P+  G W+PLPMAMAVPFLVGA F
Sbjct  464  AILGVEGFSALPLHCLQLCYGFFAFAMLVNLVKDLVPERFGSWVPLPMAMAVPFLVGAYF  523

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVK  339
             IDMC+G+L+V+ W +++ K+A LMVPAVASGLICG+GLWILP SILALAKVK
Sbjct  524  TIDMCVGTLIVFVWRKIDEKRAELMVPAVASGLICGEGLWILPSSILALAKVK  576



>ref|XP_008437732.1| PREDICTED: metal-nicotianamine transporter YSL1, partial [Cucumis 
melo]
Length=495

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEG S LP+HCLQ+CYGFF FA+  NL+KD   + +GK +PLPM MAVPFLVG  F
Sbjct  373  AILGVEGVSALPKHCLQICYGFFGFAIGVNLVKDFGGRRIGKLMPLPMVMAVPFLVGGYF  432

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC GSL+V+ W ++NR+KA +M+PAVASGLICG+GLW LP S+LALAK+  PICM F
Sbjct  433  AIDMCFGSLIVFVWGKMNREKAEMMLPAVASGLICGEGLWTLPASVLALAKINPPICMKF  492

Query  361  LPA  369
            +P+
Sbjct  493  VPS  495



>gb|KFK28976.1| hypothetical protein AALP_AA7G072600 [Arabis alpina]
Length=671

 Score =   181 bits (460),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ N+++DL+P  +G+++PLP AMAVPFLVGA F
Sbjct  549  AILGVQGFSALPLHCLQMCYGFFGFAVMVNVVRDLTPAKIGRFMPLPTAMAVPFLVGAYF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+L+V+ W ++N+KKA +MVPAVASGLICG+GLW LP ++LALA VK PICM F
Sbjct  609  AIDMCVGTLIVFVWEKMNKKKAEVMVPAVASGLICGEGLWTLPAAVLALAGVKPPICMKF  668

Query  361  LPA  369
            L +
Sbjct  669  LAS  671



>gb|KDP25199.1| hypothetical protein JCGZ_20355 [Jatropha curcas]
Length=662

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+G S LPQHCLQLCYGF  FA+ ANL +DLSP+ +G W+PLPM MAVPFLVGA F
Sbjct  540  AILGVQGVSALPQHCLQLCYGFVGFAVAANLARDLSPRKLGPWMPLPMVMAVPFLVGAYF  599

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM +GS++V+TW+++N KKA LM+PAVASGLICG+GLW LP ++LALAK+  PICM F
Sbjct  600  AIDMFVGSIIVFTWNKINPKKAELMIPAVASGLICGEGLWTLPAAVLALAKISPPICMKF  659

Query  361  LPA  369
            + +
Sbjct  660  VSS  662



>ref|XP_004143842.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Cucumis 
sativus]
 ref|XP_004163573.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Cucumis 
sativus]
 gb|KGN49984.1| hypothetical protein Csa_5G148550 [Cucumis sativus]
Length=664

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEG S LP+HCLQ+CYGFF FA+  NL+KD   + +GK +PLPM MAVPFLVG  F
Sbjct  542  AILGVEGVSALPKHCLQICYGFFGFAIGVNLVKDFGGRRIGKLMPLPMVMAVPFLVGGYF  601

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSL+V+ W ++NR+KA +M+PAVASGLICG+GLW LP S+LALAK+  PICM F
Sbjct  602  AIDMCLGSLIVFVWGKMNREKAEMMLPAVASGLICGEGLWTLPASVLALAKINPPICMKF  661

Query  361  LPA  369
            +P+
Sbjct  662  VPS  664



>emb|CDX92615.1| BnaC07g38730D [Brassica napus]
Length=671

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQ+CYGFF FA++ N+++D+SP  VG+++PLP AMAVPFLVGA F
Sbjct  549  AILGVEGFSALPLHCLQMCYGFFGFAVLVNVVRDVSPAKVGRFMPLPTAMAVPFLVGAYF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+L+V+   ++NRKKA +MVPAVASGLICG+GLW LP ++LALA VK PICM F
Sbjct  609  AIDMCVGTLIVFVCEKMNRKKAEVMVPAVASGLICGEGLWTLPAAVLALAGVKPPICMKF  668

Query  361  LPA  369
            L +
Sbjct  669  LAS  671



>ref|XP_010541500.1| PREDICTED: metal-nicotianamine transporter YSL2 isoform X2 [Tarenaya 
hassleriana]
Length=668

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+G S LP HCLQLCYGFF FA  ANL++D  P+  GKWIPLPMAMAVPFLVG +F
Sbjct  545  AILGVQGVSALPGHCLQLCYGFFAFAAAANLVRDTVPRKYGKWIPLPMAMAVPFLVGGAF  604

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV  W+R++R KA +MVPAVASGLICGDGLWILP S+LALA VK PICM F
Sbjct  605  AIDMCVGSLVVLVWNRVSRSKAAVMVPAVASGLICGDGLWILPSSLLALAGVKPPICMNF  664

Query  361  LPA  369
             P+
Sbjct  665  TPS  667



>ref|XP_010541499.1| PREDICTED: metal-nicotianamine transporter YSL2 isoform X1 [Tarenaya 
hassleriana]
Length=706

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+G S LP HCLQLCYGFF FA  ANL++D  P+  GKWIPLPMAMAVPFLVG +F
Sbjct  583  AILGVQGVSALPGHCLQLCYGFFAFAAAANLVRDTVPRKYGKWIPLPMAMAVPFLVGGAF  642

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+GSLVV  W+R++R KA +MVPAVASGLICGDGLWILP S+LALA VK PICM F
Sbjct  643  AIDMCVGSLVVLVWNRVSRSKAAVMVPAVASGLICGDGLWILPSSLLALAGVKPPICMNF  702

Query  361  LPA  369
             P+
Sbjct  703  TPS  705



>ref|XP_009109308.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Brassica 
rapa]
 ref|XP_009109309.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Brassica 
rapa]
 ref|XP_009109310.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Brassica 
rapa]
 ref|XP_009109311.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Brassica 
rapa]
Length=674

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ ++++D++P  VG+++PLP AMAVPFLVGA F
Sbjct  552  AILGVQGFSALPLHCLQMCYGFFGFAVLVSVVRDIAPAKVGRFMPLPTAMAVPFLVGAYF  611

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+LVV+ W + NR+KA +MVPAVASGLICG+GLW LP +ILALA VK PICM F
Sbjct  612  AIDMCVGTLVVFIWEKRNRRKAEVMVPAVASGLICGEGLWTLPAAILALAGVKPPICMKF  671

Query  361  LPA  369
            L +
Sbjct  672  LAS  674



>emb|CDY24797.1| BnaA08g15130D [Brassica napus]
Length=652

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL V+GFS LP HCLQ+CYGFF FA++ ++++D++P  VG+++PLP AMAVPFLVGA F
Sbjct  530  AILGVQGFSALPLHCLQMCYGFFGFAVLVSVVRDIAPAKVGRFMPLPTAMAVPFLVGAYF  589

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+LVV+ W + NR+KA +MVPAVASGLICG+GLW LP +ILALA VK PICM F
Sbjct  590  AIDMCVGTLVVFIWEKRNRRKAEVMVPAVASGLICGEGLWTLPAAILALAGVKPPICMKF  649

Query  361  LPA  369
            L +
Sbjct  650  LAS  652



>gb|KHN14758.1| Metal-nicotianamine transporter YSL1 [Glycine soja]
Length=674

 Score =   179 bits (453),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+GFS LP HCL+LC+GFF FA+  N+++D +P+ +GKW+PLPM MAVPFLVGA F
Sbjct  552  AIIGVQGFSALPLHCLKLCFGFFAFAIGVNMIRDFAPQKIGKWMPLPMVMAVPFLVGAYF  611

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM +G++VV+ W +L+ KKA LMVPA ASGLICG+GLW LP +ILALA++K PICM F
Sbjct  612  AIDMFIGTVVVFAWQKLDSKKAELMVPAAASGLICGEGLWTLPAAILALARIKPPICMKF  671

Query  361  LPA  369
            +P 
Sbjct  672  VPT  674



>ref|XP_010240193.1| PREDICTED: probable metal-nicotianamine transporter YSL16 isoform 
X1 [Brachypodium distachyon]
Length=704

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP+HC+QLC  FF FA++AN+ +D  P+ +G+++PLPMAMAVPFLVGASF
Sbjct  581  AILGVEGFSALPRHCMQLCAAFFAFAVLANVARDFLPRRLGRYVPLPMAMAVPFLVGASF  640

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC GSLVV+ WH+L+ KKA L+VPAVASGLICGDG+WI P S+LALAKVK PICM F
Sbjct  641  AIDMCAGSLVVFLWHKLDGKKAALLVPAVASGLICGDGIWIFPSSLLALAKVKPPICMKF  700

Query  361  LPAK  372
             P  
Sbjct  701  TPGS  704



>ref|XP_003536174.2| PREDICTED: metal-nicotianamine transporter YSL1-like [Glycine 
max]
Length=725

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AI+ V+GFS LP HCL+LC+GFF FA+  N+++D +P+ +GKW+PLPM MAVPFLVGA F
Sbjct  603  AIIGVQGFSALPLHCLKLCFGFFAFAIGVNMIRDFAPQKIGKWMPLPMVMAVPFLVGAYF  662

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDM +G++VV+ W +L+ KKA LMVPA ASGLICG+GLW LP +ILALA++K PICM F
Sbjct  663  AIDMFIGTVVVFAWQKLDSKKAELMVPAAASGLICGEGLWTLPAAILALARIKPPICMKF  722

Query  361  LPA  369
            +P 
Sbjct  723  VPT  725



>ref|XP_009137417.1| PREDICTED: metal-nicotianamine transporter YSL1-like [Brassica 
rapa]
 emb|CDY10987.1| BnaA03g46460D [Brassica napus]
Length=671

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    AILAVEGFSTLPQHCLQLCYGFFVFAMVANLLKDLSPKNVGKWIPLPMAMAVPFLVGASF  180
            AIL VEGFS LP HCLQ+CYGFF FA++ N+++D+SP  VG+++PLP AMAVPFLVGA F
Sbjct  549  AILGVEGFSALPLHCLQMCYGFFGFAVLVNVVRDVSPAKVGRFMPLPTAMAVPFLVGAYF  608

Query  181  AIDMCMGSLVVYTWHRLNRKKATLMVPAVASGLICGDGLWILPQSILALAKVKAPICMTF  360
            AIDMC+G+L+V+   ++NRKKA +MVPAVASGLICG+GLW LP ++LALA VK PICM F
Sbjct  609  AIDMCVGTLIVFVCEKMNRKKAEVMVPAVASGLICGEGLWTLPAAVLALAGVKPPICMKF  668

Query  361  LPA  369
              +
Sbjct  669  FAS  671



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510