BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS035C12

Length=602
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHJ80818.1|  Tua1                                                    368   2e-125   Eragrostis tef [tef]
gb|ACN40426.1|  unknown                                                 368   4e-125   Picea sitchensis
gb|AFP25256.1|  alpha-tubulin                                           368   6e-125   Uronychia sinica
emb|CBI29424.3|  unnamed protein product                                366   7e-125   Vitis vinifera
ref|XP_002263822.2|  PREDICTED: tubulin alpha chain                     367   7e-125   
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     372   8e-125   Nicotiana sylvestris
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   372   1e-124   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     372   1e-124   Nicotiana tomentosiformis
gb|AFO69619.1|  alpha-tubulin                                           368   1e-124   Uronychia sp. SXL2007102501
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     372   1e-124   
gb|AAN33000.1|  alpha-tubulin 4                                         367   1e-124   Gossypium hirsutum [American cotton]
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   371   2e-124   Nicotiana tomentosiformis
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                371   2e-124   Solanum tuberosum [potatoes]
gb|KDO78780.1|  hypothetical protein CISIN_1g037616mg                   369   2e-124   Citrus sinensis [apfelsine]
dbj|BAJ06362.1|  alpha-tubulin                                          371   2e-124   Alopecurus aequalis
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   371   2e-124   Brachypodium distachyon [annual false brome]
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              371   2e-124   Setaria italica
ref|NP_001167663.1|  tubulin alpha-3 chain                              371   2e-124   Zea mays [maize]
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    371   2e-124   Eleusine indica [crabgrass]
gb|AFC88832.1|  putative tubulin alpha-3 chain                          371   2e-124   Miscanthus sinensis
gb|AHJ80822.1|  Tua1                                                    371   2e-124   Eragrostis tef [tef]
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             371   3e-124   Hordeum vulgare [barley]
ref|XP_008372962.1|  PREDICTED: tubulin alpha chain isoform X2          370   3e-124   
ref|XP_008236253.1|  PREDICTED: tubulin alpha chain isoform X2          370   3e-124   
gb|AAP32191.1|  alpha-tubulin                                           368   3e-124   Trifolium repens [creeping white clover]
ref|XP_008236966.1|  PREDICTED: tubulin alpha chain-like isoform X2     370   3e-124   
gb|AGZ90158.1|  tubulin alpha                                           368   4e-124   Litsea cubeba [may chang]
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              370   4e-124   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   370   4e-124   Zea mays [maize]
gb|KJB58756.1|  hypothetical protein B456_009G224800                    369   4e-124   Gossypium raimondii
ref|XP_006466395.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    370   4e-124   
gb|EPS62716.1|  alpha-tubulin                                           369   4e-124   Genlisea aurea
emb|CBI19330.3|  unnamed protein product                                368   4e-124   Vitis vinifera
ref|XP_006486879.1|  PREDICTED: tubulin alpha chain-like isoform X2     369   4e-124   
gb|ABU96695.1|  alpha-tubulin                                           367   5e-124   Uronychia setigera
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              370   5e-124   
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              370   5e-124   Solanum lycopersicum
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              370   5e-124   Nicotiana tomentosiformis
gb|ABR22541.1|  alpha-tubulin                                           363   5e-124   Micromonas pusilla
emb|CAD13176.1|  alpha-tubulin                                          370   5e-124   Nicotiana tabacum [American tobacco]
emb|CBI22190.3|  unnamed protein product                                368   5e-124   Vitis vinifera
gb|ABB02631.1|  unknown                                                 370   5e-124   Solanum tuberosum [potatoes]
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                   369   6e-124   Citrus sinensis [apfelsine]
gb|AHJ80823.1|  Tua1                                                    370   7e-124   Eragrostis tef [tef]
gb|KHN01709.1|  Tubulin alpha chain                                     369   8e-124   Glycine soja [wild soybean]
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   369   8e-124   Citrus sinensis [apfelsine]
emb|CAN62392.1|  hypothetical protein VITISV_016172                     369   8e-124   Vitis vinifera
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             369   8e-124   Citrus clementina [clementine]
gb|AHJ80817.1|  Tua1                                                    369   9e-124   Eragrostis tef [tef]
ref|XP_006472373.1|  PREDICTED: tubulin alpha chain isoform X2          370   9e-124   
ref|XP_006573681.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    369   9e-124   
ref|XP_006606007.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    369   9e-124   
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    369   1e-123   Glycine max [soybeans]
ref|XP_008219157.1|  PREDICTED: tubulin alpha chain-like isoform X2     369   1e-123   
gb|ABF98641.1|  Tubulin alpha-1 chain, putative, expressed              368   1e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                369   1e-123   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC24800.1|  alpha tubulin                                          369   1e-123   Physcomitrella patens
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   369   1e-123   Citrus sinensis [apfelsine]
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          369   1e-123   Citrus sinensis [apfelsine]
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                369   1e-123   Elaeis guineensis
ref|XP_002510010.1|  tubulin alpha chain, putative                      369   1e-123   Ricinus communis
gb|ABX57816.1|  alpha tubulin                                           369   1e-123   Picea wilsonii
gb|AAV92352.1|  alpha tubulin 1                                         369   1e-123   Pseudotsuga menziesii var. menziesii
dbj|BAF96594.1|  tubulin                                                362   1e-123   Rosa hybrid cultivar
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    369   1e-123   Citrus sinensis [apfelsine]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             369   1e-123   Citrus clementina [clementine]
ref|XP_006338461.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    369   1e-123   
dbj|BAG99724.1|  unnamed protein product                                368   1e-123   Oryza sativa Japonica Group [Japonica rice]
gb|AIX10966.1|  tubulin                                                 369   1e-123   Ornithogalum longebracteatum [sea-onion]
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     369   1e-123   Nelumbo nucifera [Indian lotus]
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     369   1e-123   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                369   1e-123   Phoenix dactylifera
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     369   1e-123   Phoenix dactylifera
ref|XP_002522104.1|  tubulin alpha chain, putative                      369   1e-123   Ricinus communis
ref|XP_006589612.1|  PREDICTED: tubulin alpha chain-like isoform X2     369   1e-123   
gb|KJB83377.1|  hypothetical protein B456_013G244600                    365   1e-123   Gossypium raimondii
ref|XP_001764722.1|  predicted protein                                  369   1e-123   
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     369   1e-123   Eucalyptus grandis [rose gum]
ref|XP_007042689.1|  Tubulin alpha-2 chain                              369   1e-123   Theobroma cacao [chocolate]
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             369   1e-123   Populus trichocarpa [western balsam poplar]
ref|XP_007018369.1|  Tubulin alpha-2 chain                              369   1e-123   Theobroma cacao [chocolate]
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     369   1e-123   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     369   1e-123   Pyrus x bretschneideri [bai li]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         369   1e-123   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           369   1e-123   Betula pendula [white birch]
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              369   1e-123   Oryza brachyantha
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    369   1e-123   Glycine max [soybeans]
gb|ABO47736.1|  alpha-tubulin                                           369   1e-123   Gossypium hirsutum [American cotton]
gb|AHJ80816.1|  Tua1                                                    369   1e-123   Eragrostis tef [tef]
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          369   1e-123   Malus domestica [apple tree]
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         369   1e-123   Jatropha curcas
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             369   2e-123   Prunus persica
dbj|BAB19779.1|  alpha tubulin                                          369   2e-123   Nicotiana tabacum [American tobacco]
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     369   2e-123   Glycine max [soybeans]
gb|ABK92552.1|  unknown                                                 369   2e-123   Populus trichocarpa [western balsam poplar]
ref|XP_010531322.1|  PREDICTED: tubulin alpha-4 chain isoform X2        369   2e-123   Tarenaya hassleriana [spider flower]
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          369   2e-123   Tarenaya hassleriana [spider flower]
gb|KHG18997.1|  Tubulin alpha chain                                     369   2e-123   Gossypium arboreum [tree cotton]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                369   2e-123   Pyrus x bretschneideri [bai li]
emb|CAA06619.1|  alpha-tubulin 1                                        369   2e-123   Eleusine indica [crabgrass]
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              369   2e-123   Glycine max [soybeans]
ref|XP_006579968.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    369   2e-123   
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                369   2e-123   Populus euphratica
gb|KEH43997.1|  tubulin beta-1 chain                                    369   2e-123   Medicago truncatula
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                369   2e-123   Cicer arietinum [garbanzo]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   369   2e-123   Fragaria vesca subsp. vesca
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              369   2e-123   Oryza brachyantha
gb|AGG37283.1|  alpha-tubulin 1                                         369   2e-123   Salix arbutifolia
gb|ABO47740.1|  alpha-tubulin                                           369   2e-123   Gossypium hirsutum [American cotton]
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             369   2e-123   Prunus persica
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     369   2e-123   Vitis vinifera
gb|ABK92520.1|  unknown                                                 369   2e-123   Populus trichocarpa [western balsam poplar]
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                369   2e-123   Prunus dulcis [sweet almond]
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   369   2e-123   Populus euphratica
gb|ABQ59633.1|  alpha-tubulin 3                                         369   2e-123   Populus tremuloides
gb|AHJ80815.1|  Tua1                                                    369   2e-123   Eragrostis tef [tef]
gb|ACH68563.1|  alpha-tubulin                                           369   2e-123   Solanum tuberosum [potatoes]
gb|AGG37287.1|  alpha-tubulin 5                                         369   2e-123   Salix arbutifolia
dbj|BAP59012.1|  alpha tubulin                                          369   2e-123   Taxus cuspidata [ichii]
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              369   2e-123   Oryza brachyantha
gb|ACU19580.1|  unknown                                                 369   2e-123   Glycine max [soybeans]
gb|AGG37285.1|  alpha-tubulin 3                                         369   2e-123   Salix arbutifolia
ref|NP_001067613.1|  Os11g0247300                                       369   2e-123   
gb|AFP25227.1|  alpha-tubulin                                           364   2e-123   Leptoamphisiella vermis
ref|XP_010099392.1|  Tubulin alpha chain                                369   2e-123   
gb|AEN19682.1|  alpha-tubulin                                           367   2e-123   Cymbidium faberi
gb|AEQ75493.1|  alpha-tubulin                                           368   2e-123   Rosa multiflora [Japanese rose]
ref|WP_039310890.1|  hypothetical protein                               368   2e-123   
ref|XP_003608582.1|  Tubulin alpha-5 chain                              368   2e-123   Medicago truncatula
gb|ADW83724.1|  alpha-tubulin                                           367   2e-123   Musa acuminata AAA Group [Cavendish banana]
gb|ABU96694.1|  alpha-tubulin                                           365   3e-123   Uronychia binucleata
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                368   3e-123   Tarenaya hassleriana [spider flower]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                368   3e-123   Tarenaya hassleriana [spider flower]
gb|AID52921.1|  tubulin alpha chain                                     368   3e-123   Carthamus tinctorius
gb|ABU96696.1|  alpha-tubulin                                           365   3e-123   Uronychia transfuga
dbj|BAF96589.1|  tubulin                                                361   3e-123   Rosa hybrid cultivar
emb|CDP02221.1|  unnamed protein product                                368   3e-123   Coffea canephora [robusta coffee]
gb|AFP25238.1|  alpha-tubulin                                           363   3e-123   Heterodiophrys zhui
gb|AEN19681.1|  alpha-tubulin                                           366   3e-123   Cymbidium faberi
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    368   3e-123   Glycine max [soybeans]
gb|ABF98643.1|  Tubulin alpha-1 chain, putative, expressed              367   3e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008352751.1|  PREDICTED: tubulin alpha chain isoform X2          368   3e-123   
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 368   3e-123   Populus trichocarpa [western balsam poplar]
emb|CAA62916.1|  alpha-tubulin                                          368   3e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010093625.1|  Tubulin alpha chain                                368   3e-123   Morus notabilis
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     368   3e-123   Sesamum indicum [beniseed]
ref|NP_001291325.1|  tubulin alpha chain-like                           368   3e-123   Sesamum indicum [beniseed]
ref|XP_009357231.1|  PREDICTED: tubulin alpha chain-like isoform X2     368   3e-123   
ref|XP_006578253.1|  PREDICTED: tubulin alpha-4 chain isoform X2        367   4e-123   
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                368   4e-123   Fragaria vesca subsp. vesca
gb|AFO69623.1|  alpha-tubulin                                           363   4e-123   Prodiscocephalus borrori
gb|AFP25259.1|  alpha-tubulin                                           363   4e-123   Diophrys parappendiculata
gb|AAN40715.1|  alpha-tubulin                                           365   4e-123   Strobilidium sp.
ref|XP_010557536.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    368   4e-123   
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             368   4e-123   Prunus persica
gb|AAN40716.1|  alpha-tubulin                                           365   4e-123   Strobilidium sp.
ref|NP_001051132.1|  Os03g0726100                                       368   4e-123   
ref|XP_008440460.1|  PREDICTED: tubulin alpha chain-like isoform X2     367   4e-123   
gb|AFV46219.1|  hypothetical protein                                    367   4e-123   Scutellaria baicalensis [Baikal skullcap]
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     367   4e-123   Sesamum indicum [beniseed]
gb|AFP25235.1|  alpha-tubulin                                           364   4e-123   Apodiophrys ovalis
gb|AFO69620.1|  alpha-tubulin                                           363   4e-123   Diophrys parappendiculata
ref|XP_008347837.1|  PREDICTED: tubulin alpha-4 chain isoform X2        368   5e-123   
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   367   5e-123   Vitis vinifera
gb|ADW66593.1|  alpha tubulin                                           364   5e-123   Hirschfeldia incana [buchanweed]
gb|AFP25229.1|  alpha-tubulin                                           364   5e-123   Apodiophrys ovalis
gb|AFP25236.1|  alpha-tubulin                                           364   5e-123   Apodiophrys ovalis
gb|AAO23139.1|  alpha tubulin                                           367   5e-123   Populus tremuloides
emb|CAB66336.1|  alpha-tubulin                                          367   5e-123   Betula pendula [white birch]
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                367   5e-123   Elaeis guineensis
gb|ABG78593.1|  alpha-tubulin                                           367   5e-123   Oryza sativa Japonica Group [Japonica rice]
gb|KGN48654.1|  hypothetical protein Csa_6G497050                       366   5e-123   Cucumis sativus [cucumbers]
ref|XP_008455056.1|  PREDICTED: tubulin alpha-4 chain isoform X2        366   5e-123   
gb|ABO47739.1|  alpha-tubulin                                           367   6e-123   Gossypium hirsutum [American cotton]
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    367   6e-123   
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        367   6e-123   Glycine max [soybeans]
gb|AFP25231.1|  alpha-tubulin                                           364   6e-123   Apodiophrys ovalis
ref|XP_007047652.1|  Tubulin alpha-2 chain                              369   6e-123   
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        367   6e-123   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                367   6e-123   Cicer arietinum [garbanzo]
ref|XP_003603670.1|  Tubulin alpha-7 chain                              367   6e-123   Medicago truncatula
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    367   6e-123   Gossypium hirsutum [American cotton]
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             367   6e-123   Selaginella moellendorffii
gb|ACN40181.1|  unknown                                                 367   6e-123   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     367   6e-123   Vitis vinifera
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                367   6e-123   Cucumis sativus [cucumbers]
ref|XP_006581475.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    368   7e-123   
gb|AAN40727.1|  alpha-tubulin                                           364   7e-123   Metacylis angulata
gb|ADF32932.1|  alpha-tubulin                                           364   7e-123   Anteholosticha sp. QDSC04082401
ref|XP_009618479.1|  PREDICTED: tubulin alpha-3 chain-like              367   7e-123   Nicotiana tomentosiformis
gb|AHC92564.1|  alpha tubulin subunit                                   365   7e-123   Colponema vietnamica
emb|CAA64074.1|  alpha-tubulin                                          365   7e-123   Colpoda sp.
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             367   7e-123   Populus trichocarpa [western balsam poplar]
gb|ABJ80973.1|  alpha tubulin                                           364   7e-123   Glaucocystis nostochinearum
gb|AFP25234.1|  alpha-tubulin                                           363   8e-123   Apodiophrys ovalis
gb|AAW57312.1|  alpha-tubulin                                           362   8e-123   Ceratopteris richardii
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             367   8e-123   Selaginella moellendorffii
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    367   8e-123   Tarenaya hassleriana [spider flower]
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                367   8e-123   Solanum lycopersicum
ref|NP_849388.1|  tubulin alpha-6 chain                                 366   8e-123   Arabidopsis thaliana [mouse-ear cress]
gb|AAN40732.1|  alpha-tubulin                                           364   8e-123   Schmidingerella sp. LAK-2008
gb|AAN40733.1|  alpha-tubulin                                           364   8e-123   Schmidingerella sp. LAK-2008
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             367   8e-123   Selaginella moellendorffii
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                367   8e-123   Nicotiana tomentosiformis
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               367   8e-123   Pisum sativum [garden pea]
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              367   8e-123   Fragaria vesca subsp. vesca
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    367   8e-123   Gossypium hirsutum [American cotton]
gb|AAN40726.1|  alpha-tubulin                                           364   8e-123   Metacylis angulata
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                367   9e-123   Nelumbo nucifera [Indian lotus]
gb|AAN40708.1|  alpha-tubulin                                           364   9e-123   Tintinnopsis tubulosoides
gb|AAM89908.1|  alpha-tubulin                                           363   9e-123   Eutintinnus pectinis
gb|AAN40724.1|  alpha-tubulin                                           364   9e-123   Metacylis angulata
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             367   9e-123   Phaseolus vulgaris [French bean]
gb|AFP25239.1|  alpha-tubulin                                           362   9e-123   Discocephalus pararotatorius
gb|AAN40710.1|  alpha-tubulin                                           364   9e-123   Tintinnopsis tubulosoides
gb|AAO73546.1|  alpha-tubulin                                           367   1e-122   Ceratopteris richardii
gb|AHC92565.1|  alpha tubulin subunit                                   364   1e-122   Colponema vietnamica
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             367   1e-122   Prunus persica
gb|ADF32933.1|  alpha-tubulin                                           363   1e-122   Holosticha diademata
gb|ABJ80972.1|  alpha tubulin                                           364   1e-122   Glaucocystis nostochinearum
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             367   1e-122   Phaseolus vulgaris [French bean]
gb|AAN40725.1|  alpha-tubulin                                           364   1e-122   Metacylis angulata
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                367   1e-122   Daucus carota [carrots]
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                367   1e-122   Vitis vinifera
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         367   1e-122   Jatropha curcas
gb|AAS66990.1|  alpha-tubulin                                           364   1e-122   Phacodinium metchnikoffi
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        367   1e-122   Cucumis melo [Oriental melon]
ref|XP_010466127.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    365   1e-122   
ref|XP_009779180.1|  PREDICTED: tubulin alpha-3 chain-like              367   1e-122   Nicotiana sylvestris
gb|ABA41243.1|  alpha-tubulin                                           364   1e-122   Mantoniella squamata
gb|AEO92378.1|  alpha-tubulin                                           362   1e-122   Chilodonella uncinata
ref|XP_009388503.1|  PREDICTED: tubulin alpha chain isoform X2          367   1e-122   
gb|AAN40729.1|  alpha-tubulin                                           363   2e-122   Laboea strobila
gb|KHN42598.1|  Tubulin alpha-2 chain                                   366   2e-122   Glycine soja [wild soybean]
gb|AAL33701.1|  alpha-tubulin                                           362   2e-122   Chilodonella uncinata
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             366   2e-122   Phaseolus vulgaris [French bean]
gb|ABR22539.1|  alpha-tubulin                                           363   2e-122   Mantoniella squamata
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              366   2e-122   Cucumis sativus [cucumbers]
gb|AAN40713.1|  alpha-tubulin                                           363   2e-122   Strombidium sp.
emb|CDY25017.1|  BnaC02g39910D                                          365   2e-122   Brassica napus [oilseed rape]
gb|ADF32935.1|  alpha-tubulin                                           363   2e-122   Parabirojimia multinucleata
gb|ABO47737.1|  alpha-tubulin                                           366   2e-122   Gossypium hirsutum [American cotton]
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              366   2e-122   
gb|ACG69805.1|  alpha-tubulin                                           363   2e-122   Psammomitra retractilis
ref|NP_001275271.1|  alpha-tubulin-like protein                         366   2e-122   Solanum tuberosum [potatoes]
ref|XP_006482577.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    365   2e-122   Citrus sinensis [apfelsine]
gb|AAL33704.1|  alpha-tubulin                                           363   2e-122   Chilodonella uncinata
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    366   2e-122   Arabis alpina [alpine rockcress]
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                366   2e-122   Elaeis guineensis
gb|AAL33706.1|  alpha-tubulin                                           362   2e-122   Chilodonella uncinata
gb|AAL33710.1|  alpha-tubulin                                           363   2e-122   Chilodonella uncinata
gb|AAL33708.1|  alpha-tubulin                                           362   2e-122   Chilodonella uncinata
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                366   2e-122   Erythranthe guttata [common monkey flower]
ref|XP_002508010.1|  alpha tubulin 2                                    366   2e-122   Micromonas commoda
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              366   2e-122   Populus euphratica
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             366   2e-122   Hordeum vulgare [barley]
gb|ABD92930.1|  alpha tubulin-2A                                        366   2e-122   Triticum aestivum [Canadian hard winter wheat]
gb|KJB29387.1|  hypothetical protein B456_005G097800                    366   2e-122   Gossypium raimondii
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     365   2e-122   Cucumis melo [Oriental melon]
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                365   2e-122   Cucumis sativus [cucumbers]
ref|XP_002517492.1|  tubulin alpha chain, putative                      365   2e-122   Ricinus communis
gb|AAL33703.1|  alpha-tubulin                                           363   2e-122   Chilodonella uncinata
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                366   2e-122   Eucalyptus grandis [rose gum]
gb|ABO47742.1|  alpha-tubulin                                           365   2e-122   Gossypium hirsutum [American cotton]
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                365   2e-122   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004231960.1|  PREDICTED: tubulin alpha-3 chain-like              365   3e-122   Solanum lycopersicum
gb|ABP65320.1|  alpha tubulin                                           365   3e-122   Capsicum annuum
ref|XP_006357741.1|  PREDICTED: tubulin alpha-3 chain-like              365   3e-122   Solanum tuberosum [potatoes]
gb|KHG20487.1|  Tubulin alpha chain                                     365   3e-122   Gossypium arboreum [tree cotton]
gb|AAB61232.1|  alpha-tubulin                                           363   3e-122   Blepharisma japonicum
ref|XP_009107245.1|  PREDICTED: tubulin alpha-2 chain isoform X2        366   3e-122   Brassica rapa
gb|AAL33709.1|  alpha-tubulin                                           362   3e-122   Chilodonella uncinata
gb|AAL33705.1|  alpha-tubulin                                           362   3e-122   Chilodonella uncinata
gb|AAL33696.1|  alpha-tubulin                                           362   3e-122   Halteria grandinella
ref|NP_001105440.1|  tubulin alpha-3 chain                              365   3e-122   Zea mays [maize]
gb|AFP25221.1|  alpha-tubulin                                           363   3e-122   Euplotes parabalteatus
gb|ADK26606.1|  alpha-tubulin                                           363   3e-122   Eukaryota sp. ATCC 50646
gb|AAN40712.1|  alpha-tubulin                                           362   3e-122   Strombidium sp.
gb|AAL33693.1|  alpha-tubulin                                           362   3e-122   Halteria grandinella
gb|AAL33691.1|  alpha-tubulin                                           362   3e-122   
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   365   3e-122   
gb|AGE09583.1|  TUA1-like protein                                       364   3e-122   
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             365   3e-122   
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             365   3e-122   
gb|AAL33699.1|  alpha-tubulin                                           362   3e-122   
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                365   3e-122   
ref|XP_010500556.1|  PREDICTED: tubulin alpha-2 chain isoform X2        366   3e-122   
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             365   3e-122   
gb|ABR22540.1|  alpha-tubulin                                           362   3e-122   
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             365   3e-122   
emb|CDY66630.1|  BnaCnng51680D                                          365   4e-122   
gb|ACZ63319.1|  alpha-tubulin                                           362   4e-122   
ref|XP_005651460.1|  tubulin alpha chain                                365   4e-122   
gb|KJB83375.1|  hypothetical protein B456_013G244600                    365   4e-122   
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              365   4e-122   
gb|ABJ80970.1|  alpha tubulin                                           362   4e-122   
gb|ACG69806.1|  alpha-tubulin                                           362   4e-122   
gb|AFC88824.1|  putative tubulin alpha-3 chain                          365   4e-122   
gb|ADF32931.1|  alpha-tubulin                                           362   4e-122   
gb|AHJ80820.1|  Tua3                                                    363   4e-122   
dbj|BAA92148.1|  alpha-tubulin                                          362   4e-122   
emb|CAA62917.1|  alfa-tubulin                                           365   5e-122   
ref|XP_002466376.1|  hypothetical protein SORBIDRAFT_01g006650          365   5e-122   
gb|AEG74028.1|  alpha-tubulin                                           365   5e-122   
dbj|BAJ98211.1|  predicted protein                                      365   5e-122   
dbj|BAJ78230.1|  alpha tubulin                                          362   5e-122   
gb|AIX10773.1|  alpha tubulin                                           365   5e-122   
gb|AHC92566.1|  alpha tubulin subunit                                   362   5e-122   
ref|XP_008240534.1|  PREDICTED: tubulin alpha-3 chain isoform X2        364   5e-122   
emb|CAA90014.1|  alpha-tubulin                                          362   5e-122   
gb|AAB84298.1|  tubulin                                                 365   5e-122   
gb|AHJ80821.1|  Tua3                                                    363   5e-122   
ref|NP_193232.1|  tubulin alpha-6 chain                                 365   5e-122   
dbj|BAJ06403.1|  alpha tubulin                                          362   5e-122   
gb|ABQ59634.1|  alpha-tubulin 5                                         365   5e-122   
ref|XP_003058621.1|  alpha tubulin                                      365   5e-122   
gb|ABA41248.1|  alpha-tubulin                                           363   6e-122   
gb|AAN40728.1|  alpha-tubulin                                           362   6e-122   
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                365   6e-122   
ref|NP_001289660.1|  tubulin alpha chain-like                           365   6e-122   
gb|AAM89909.1|  alpha-tubulin                                           362   6e-122   
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             365   6e-122   
gb|KHN08201.1|  Tubulin alpha chain                                     365   6e-122   
gb|ABA41241.1|  alpha-tubulin                                           363   6e-122   
gb|ABA41242.1|  alpha-tubulin                                           363   6e-122   
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              365   6e-122   
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  365   6e-122   
gb|AHC92560.1|  alpha tubulin subunit                                   362   6e-122   
gb|ABO61420.1|  alpha tubulin                                           362   6e-122   
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                365   7e-122   
sp|P10872.1|TBA_TETPY  RecName: Full=Tubulin alpha chain                364   7e-122   
dbj|BAK61741.1|  alpha tubulin 1                                        363   7e-122   
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   364   7e-122   
gb|AAN40731.1|  alpha-tubulin                                           362   7e-122   
gb|AHX84163.1|  alpha tubulin                                           361   7e-122   
ref|NP_171974.1|  tubulin alpha-4 chain                                 364   7e-122   
ref|XP_005851144.1|  alpha-tubulin                                      364   7e-122   
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          364   7e-122   
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             365   7e-122   
ref|XP_001777081.1|  predicted protein                                  364   8e-122   
gb|ADA57148.1|  alpha-tubulin                                           361   8e-122   
gb|AHX84164.1|  alpha tubulin                                           361   8e-122   
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             364   8e-122   
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              364   8e-122   
gb|AHC92561.1|  alpha tubulin subunit                                   362   8e-122   
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        364   8e-122   
ref|XP_001782790.1|  predicted protein                                  364   8e-122   
gb|AFO69621.1|  alpha-tubulin                                           360   8e-122   
gb|AEI83471.1|  alpha-tubulin                                           361   8e-122   
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                364   8e-122   
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             364   9e-122   
ref|XP_001022424.1|  Tubulin/FtsZ family, GTPase domain containin...    364   9e-122   
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          364   9e-122   
gb|AHC92569.1|  alpha tubulin subunit                                   362   9e-122   
ref|XP_002980240.1|  hypothetical protein SELMODRAFT_419896             363   1e-121   
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   364   1e-121   
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              364   1e-121   
gb|AFB18223.1|  alpha tubulin                                           361   1e-121   
emb|CDY44941.1|  BnaA02g04460D                                          364   1e-121   
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             364   1e-121   
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              364   1e-121   
gb|AGG37289.1|  alpha-tubulin 7                                         364   1e-121   
ref|XP_009126388.1|  PREDICTED: tubulin alpha-3 chain-like              364   1e-121   
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     364   1e-121   
gb|AFB18224.1|  alpha tubulin                                           360   1e-121   
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    364   1e-121   
ref|XP_005643073.1|  tubulin alpha chain                                364   1e-121   
emb|CDP17586.1|  unnamed protein product                                364   1e-121   
emb|CDX88875.1|  BnaA03g07740D                                          364   1e-121   
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   364   1e-121   
ref|NP_197478.1|  tubulin alpha-3                                       364   1e-121   
emb|CDY42294.1|  BnaC02g09000D                                          364   1e-121   
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   364   1e-121   
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             364   1e-121   
dbj|BAK61736.1|  alpha tubulin 1                                        362   1e-121   
emb|CAE52514.1|  alpha tubulin                                          364   1e-121   
gb|AHM94159.1|  alpha-tubulin                                           360   1e-121   
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              364   1e-121   
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              363   1e-121   
dbj|BAK61748.1|  alpha tubulin 1                                        362   1e-121   
emb|CAA71141.1|  alpha-tubulin                                          361   1e-121   
ref|XP_009131752.1|  PREDICTED: tubulin alpha-3 chain-like              363   1e-121   
gb|AFP25216.1|  alpha-tubulin                                           360   1e-121   
gb|AAN40714.1|  alpha-tubulin                                           360   1e-121   
gb|AFP25243.1|  alpha-tubulin                                           359   2e-121   
emb|CAA90013.1|  alpha-tubulin                                          361   2e-121   
gb|AAL33702.1|  alpha-tubulin                                           360   2e-121   
ref|XP_004981594.1|  PREDICTED: tubulin alpha-3 chain-like              363   2e-121   
gb|AFP25219.1|  alpha-tubulin                                           361   2e-121   
gb|ABQ65173.1|  alpha-tubulin                                           362   2e-121   
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              363   2e-121   
gb|ABA41249.1|  alpha-tubulin                                           362   2e-121   
ref|XP_006488931.1|  PREDICTED: tubulin alpha-1 chain-like isofor...    363   2e-121   
emb|CAD26891.1|  alpha-tubulin                                          363   2e-121   
ref|XP_007032501.1|  Tubulin alpha-2 chain                              363   2e-121   
gb|AAN40734.1|  alpha-tubulin                                           360   2e-121   
ref|XP_007515802.1|  alpha-tubulin                                      362   2e-121   
gb|AIA82437.1|  alpha-tubulin-like protein 06                           360   2e-121   
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              363   2e-121   
ref|XP_006584595.1|  PREDICTED: uncharacterized protein LOC100806...    362   2e-121   
ref|NP_001105324.1|  tubulin alpha-5 chain                              363   2e-121   
gb|AAN40711.1|  alpha-tubulin                                           360   2e-121   
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    363   2e-121   
gb|AFP25214.1|  alpha-tubulin                                           360   2e-121   
ref|XP_010535935.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    363   2e-121   
gb|AIA82433.1|  alpha-tubulin-like protein 01                           363   2e-121   
ref|NP_001105588.1|  tubulin alpha-6 chain                              363   2e-121   
gb|AFP25264.1|  alpha-tubulin                                           360   2e-121   
emb|CAD26889.1|  alpha-tubulin                                          363   2e-121   
gb|ACN40824.1|  unknown                                                 363   2e-121   
gb|ADK26608.1|  alpha-tubulin                                           359   3e-121   
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   363   3e-121   
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   363   3e-121   
gb|ABD92943.1|  alpha tubulin-1B                                        363   3e-121   
ref|XP_008240533.1|  PREDICTED: tubulin alpha-3 chain isoform X1        363   3e-121   
emb|CAD26887.1|  alpha-tubulin                                          363   3e-121   
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   363   3e-121   
gb|ABD92942.1|  alpha tubulin-1D                                        363   3e-121   
gb|ACR46957.1|  alpha-tubulin                                           360   3e-121   
ref|NP_001060075.1|  Os07g0574800                                       363   3e-121   
ref|XP_007204346.1|  hypothetical protein PRUPE_ppa005649mg             363   3e-121   
emb|CAD26893.1|  alpha-tubulin                                          363   3e-121   
gb|AAL33698.1|  alpha-tubulin                                           360   3e-121   
gb|AAN40717.1|  alpha-tubulin                                           360   3e-121   
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   363   3e-121   
emb|CDP00974.1|  unnamed protein product                                363   3e-121   
gb|AFP25215.1|  alpha-tubulin                                           360   3e-121   
ref|XP_009124557.1|  PREDICTED: tubulin alpha-6 chain-like isofor...    362   3e-121   
emb|CAD26890.1|  alpha-tubulin                                          363   3e-121   
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   363   3e-121   
gb|AGG37290.1|  alpha-tubulin 8                                         363   3e-121   
ref|XP_011461685.1|  PREDICTED: tubulin alpha-3 chain isoform X2        361   3e-121   
emb|CAD24767.1|  alpha-tubulin                                          363   3e-121   
emb|CAB77671.1|  alpha-tubulin                                          363   3e-121   
gb|AFP25233.1|  alpha-tubulin                                           359   3e-121   
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             363   3e-121   
gb|AAL33697.1|  alpha-tubulin                                           360   3e-121   
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             363   3e-121   
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              363   4e-121   
gb|AAN40718.1|  alpha-tubulin                                           360   4e-121   
emb|CDO97305.1|  unnamed protein product                                363   4e-121   
emb|CAA90015.1|  alpha-tubulin                                          360   4e-121   
gb|AAL33700.1|  alpha-tubulin                                           359   4e-121   
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             363   4e-121   
gb|AAN40721.1|  alpha-tubulin                                           360   4e-121   
gb|ABO61419.1|  alpha tubulin                                           360   4e-121   
gb|AAN40709.1|  alpha-tubulin                                           360   4e-121   
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             362   4e-121   
dbj|BAM28754.1|  tubulin                                                360   4e-121   
ref|XP_004504311.1|  PREDICTED: tubulin alpha-3 chain-like              362   4e-121   
ref|XP_003629736.1|  Alpha-tubulin                                      362   4e-121   
gb|AIC33057.1|  tubulin alpha-1 chain                                   362   4e-121   
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             362   4e-121   
gb|AHM94166.1|  alpha-tubulin                                           359   5e-121   
gb|AAL33694.1|  alpha-tubulin                                           359   5e-121   
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   362   5e-121   
gb|AHM94158.1|  alpha-tubulin                                           359   5e-121   
gb|ABV55999.1|  alpha-tubulin 7                                         362   5e-121   
gb|AFP25262.1|  alpha-tubulin                                           360   5e-121   
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              362   5e-121   
gb|ABC59068.2|  alpha tubulin 1                                         362   5e-121   
gb|AIA82436.1|  alpha-tubulin-like protein 04                           363   5e-121   
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    362   5e-121   
gb|ABA41244.1|  alpha-tubulin                                           360   5e-121   
emb|CDW82295.1|  alpha tubulin                                          362   5e-121   
gb|ABO61408.1|  alpha tubulin                                           360   6e-121   
gb|AHM94154.1|  alpha-tubulin                                           358   6e-121   
gb|AAN40719.1|  alpha-tubulin                                           359   6e-121   
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              362   6e-121   
gb|AHC92563.1|  alpha tubulin subunit                                   360   6e-121   
gb|AFP25242.1|  alpha-tubulin                                           357   6e-121   
gb|AHM94157.1|  alpha-tubulin                                           358   6e-121   
ref|XP_004170946.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    362   6e-121   
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              362   7e-121   
ref|XP_008449886.1|  PREDICTED: tubulin alpha-3 chain isoform X2        362   7e-121   
ref|XP_007014666.1|  Tubulin alpha-5                                    362   7e-121   
gb|AHM94160.1|  alpha-tubulin                                           358   7e-121   
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             362   7e-121   
ref|XP_002951007.1|  alpha tubulin                                      362   7e-121   
gb|ADA57450.1|  alpha-tubulin                                           360   7e-121   
ref|XP_002532068.1|  tubulin alpha chain, putative                      362   7e-121   
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             362   7e-121   
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   362   7e-121   
sp|P09205.1|TBA2_CHLRE  RecName: Full=Tubulin alpha-2 chain             362   7e-121   
gb|ABQ65172.1|  alpha-tubulin                                           360   8e-121   
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    362   8e-121   
gb|ABO47735.1|  alpha-tubulin                                           362   8e-121   
gb|KJB80786.1|  hypothetical protein B456_013G115100                    362   8e-121   
dbj|BAJ97454.1|  predicted protein                                      359   8e-121   
gb|ABA41245.1|  alpha-tubulin                                           360   8e-121   
gb|AGG37286.1|  alpha-tubulin 4                                         362   9e-121   
gb|ADA57447.1|  alpha-tubulin                                           360   9e-121   
gb|ABJ80971.1|  alpha tubulin                                           359   9e-121   
gb|AAN40720.1|  alpha-tubulin                                           358   9e-121   
dbj|BAJ06363.1|  alpha-tubulin                                          362   9e-121   
ref|NP_001237301.1|  tubulin A                                          362   9e-121   
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   362   9e-121   
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   362   9e-121   
gb|ADF32940.1|  alpha-tubulin                                           358   9e-121   
gb|EJY81124.1|  Alpha tubulin,putative                                  362   9e-121   



>gb|AHJ80818.1| Tua1, partial [Eragrostis tef]
Length=291

 Score =   368 bits (944),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+S VISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSXVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ACN40426.1| unknown [Picea sitchensis]
Length=319

 Score =   368 bits (945),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AFP25256.1| alpha-tubulin, partial [Uronychia sinica]
 gb|AFP25258.1| alpha-tubulin, partial [Uronychia multicirrus]
Length=324

 Score =   368 bits (944),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  12   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  71

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  72   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  131

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEAIYDICRR+LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  132  LEHTDVAVMLDNEAIYDICRRNLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  191

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  192  FQTNLVPYPRIHFMLSSYAP  211



>emb|CBI29424.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   366 bits (940),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_002263822.2| PREDICTED: tubulin alpha chain, partial [Vitis vinifera]
Length=322

 Score =   367 bits (943),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_009790136.1| PREDICTED: tubulin alpha chain [Nicotiana sylvestris]
Length=450

 Score =   372 bits (955),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 200/200 (100%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_010680774.1| PREDICTED: tubulin alpha-2 chain [Beta vulgaris subsp. vulgaris]
Length=451

 Score =   372 bits (954),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 199/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQ+STSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQISTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_009620798.1| PREDICTED: tubulin alpha chain [Nicotiana tomentosiformis]
Length=450

 Score =   372 bits (954),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 200/200 (100%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AFO69619.1| alpha-tubulin, partial [Uronychia sp. SXL2007102501]
Length=338

 Score =   368 bits (944),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  10   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  69

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  70   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  129

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEAIYDICRR+LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  130  LEHTDVAVMLDNEAIYDICRRNLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  189

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  190  FQTNLVPYPRIHFMLSSYAP  209



>ref|XP_004238046.1| PREDICTED: tubulin alpha chain [Solanum lycopersicum]
Length=450

 Score =   372 bits (954),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 199/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AAN33000.1| alpha-tubulin 4, partial [Gossypium hirsutum]
Length=311

 Score =   367 bits (941),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_009614122.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009787472.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
 emb|CAD13177.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   371 bits (953),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 199/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_006356798.1| PREDICTED: tubulin alpha chain-like [Solanum tuberosum]
Length=450

 Score =   371 bits (953),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 199/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|KDO78780.1| hypothetical protein CISIN_1g037616mg, partial [Citrus sinensis]
Length=383

 Score =   369 bits (946),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>dbj|BAJ06362.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   371 bits (952),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 198/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_003560377.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=451

 Score =   371 bits (952),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 198/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_004981922.1| PREDICTED: tubulin alpha-1 chain-like [Setaria italica]
 emb|CAE52515.1| alpha tubulin [Setaria viridis]
Length=451

 Score =   371 bits (952),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 198/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|NP_001167663.1| tubulin alpha-3 chain [Zea mays]
 gb|ACG26907.1| tubulin alpha-3 chain [Zea mays]
 gb|AFW67746.1| alpha tubulin4 isoform 1 [Zea mays]
 gb|AFW67747.1| alpha tubulin4 isoform 2 [Zea mays]
Length=451

 Score =   371 bits (952),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 198/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>sp|O22347.1|TBA1_ELEIN RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Eleusine indica]
 gb|AAC05717.1| alpha tubulin 1 [Eleusine indica]
 emb|CAA06618.1| alpha-tubulin 1 [Eleusine indica]
 gb|AFC88823.1| putative tubulin alpha-1 chain [Miscanthus sinensis]
 gb|AFC88833.1| tubulin alpha-1 chain [Miscanthus sinensis]
Length=451

 Score =   371 bits (952),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 198/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AFC88832.1| putative tubulin alpha-3 chain [Miscanthus sinensis]
Length=451

 Score =   371 bits (952),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 198/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AHJ80822.1| Tua1 [Eragrostis tef]
Length=451

 Score =   371 bits (952),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 198/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>sp|Q9ZRR5.1|TBA3_HORVU RecName: Full=Tubulin alpha-3 chain [Hordeum vulgare]
 emb|CAA10663.1| alpha-tubulin 3 [Hordeum vulgare subsp. vulgare]
 gb|ABD92933.1| alpha tubulin-3B [Triticum aestivum]
 gb|ABD92934.1| alpha tubulin-3A [Triticum aestivum]
 gb|ABD92935.1| alpha tubulin-3D [Triticum aestivum]
 dbj|BAJ87680.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS48260.1| Tubulin alpha-3 chain [Triticum urartu]
 gb|EMT18537.1| Tubulin alpha-3 chain [Aegilops tauschii]
Length=451

 Score =   371 bits (952),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 198/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_008372962.1| PREDICTED: tubulin alpha chain isoform X2 [Malus domestica]
Length=438

 Score =   370 bits (950),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_008236253.1| PREDICTED: tubulin alpha chain isoform X2 [Prunus mume]
Length=427

 Score =   370 bits (949),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AAP32191.1| alpha-tubulin [Trifolium repens]
Length=384

 Score =   368 bits (945),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  49   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  108

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  109  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  168

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  169  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  228

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  229  FQTNLVPYPRIHFMLSSYAP  248



>ref|XP_008236966.1| PREDICTED: tubulin alpha chain-like isoform X2 [Prunus mume]
Length=427

 Score =   370 bits (949),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AGZ90158.1| tubulin alpha, partial [Litsea cubeba]
Length=387

 Score =   368 bits (945),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  48   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  107

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  108  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  167

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  168  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  227

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  228  FQTNLVPYPRIHFMLSSYAP  247



>ref|XP_008665337.1| PREDICTED: tubulin alpha-1 chain-like [Zea mays]
 sp|P14640.1|TBA1_MAIZE RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Zea mays]
 emb|CAA33734.1| alpha1-tubulin [Zea mays]
 tpg|DAA51112.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51113.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51114.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51117.1| TPA: tubulin alpha-1 chain [Zea mays]
Length=451

 Score =   370 bits (951),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_008665339.1| PREDICTED: tubulin alpha-2 chain [Zea mays]
 sp|P14641.1|TBA2_MAIZE RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Zea mays]
 emb|CAA33733.1| alpha2-tubulin [Zea mays]
 tpg|DAA51111.1| TPA: tubulin alpha-2 chain [Zea mays]
Length=451

 Score =   370 bits (951),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|KJB58756.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=415

 Score =   369 bits (947),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  40   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  99

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  100  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  159

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  160  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  219

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  220  FQTNLVPYPRIHFMLSSYAP  239



>ref|XP_006466395.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Citrus sinensis]
Length=447

 Score =   370 bits (950),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|EPS62716.1| alpha-tubulin, partial [Genlisea aurea]
Length=404

 Score =   369 bits (946),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  29   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  88

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  89   FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  148

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICR+SLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  149  LEHTDVAVLLDNEAIYDICRKSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  208

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  209  FQTNLVPYPRIHFMLSSYAP  228



>emb|CBI19330.3| unnamed protein product [Vitis vinifera]
Length=395

 Score =   368 bits (945),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_006486879.1| PREDICTED: tubulin alpha chain-like isoform X2 [Citrus sinensis]
Length=433

 Score =   369 bits (948),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ABU96695.1| alpha-tubulin [Uronychia setigera]
Length=357

 Score =   367 bits (941),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 195/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  29   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  88

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  89   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  148

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVA++LDNEAIYDICRR+LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  149  LEHTDVAIMLDNEAIYDICRRNLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  208

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  209  FQTNLVPYPRIHFMLSSYAP  228



>ref|XP_006362511.1| PREDICTED: tubulin alpha-1 chain-like [Solanum tuberosum]
Length=450

 Score =   370 bits (950),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 198/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_004244533.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   370 bits (950),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 198/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_009605705.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana tomentosiformis]
 ref|XP_009761158.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana sylvestris]
 emb|CAD13178.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   370 bits (950),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 198/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ABR22541.1| alpha-tubulin, partial [Micromonas pusilla]
Length=263

 Score =   363 bits (932),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 192/200 (96%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  49   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  108

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            F+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+VVEPYNSVLSTHSL
Sbjct  109  FMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTMYPSPQVSTAVVEPYNSVLSTHSL  168

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEAIYDICRRSLDIERPTYTNLNRL+ QVISSLTASLRFDGALNVD+ E
Sbjct  169  LEHTDVAVMLDNEAIYDICRRSLDIERPTYTNLNRLVGQVISSLTASLRFDGALNVDITE  228

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  229  FQTNLVPYPRIHFMLSSYAP  248



>emb|CAD13176.1| alpha-tubulin [Nicotiana tabacum]
Length=450

 Score =   370 bits (950),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 199/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNL+RLISQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLSRLISQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>emb|CBI22190.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   368 bits (944),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ABB02631.1| unknown [Solanum tuberosum]
Length=450

 Score =   370 bits (949),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 198/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|KDO49533.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=431

 Score =   369 bits (947),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  56   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  115

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  116  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  175

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  176  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  235

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  236  FQTNLVPYPRIHFMLSSYAP  255



>gb|AHJ80823.1| Tua1 [Eragrostis tef]
Length=451

 Score =   370 bits (949),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGK+SKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKESKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|KHN01709.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   369 bits (948),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|KDO81348.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=447

 Score =   369 bits (948),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  71   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  130

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  131  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  190

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  191  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  250

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  251  FQTNLVPYPRIHFMLSSYAP  270



>emb|CAN62392.1| hypothetical protein VITISV_016172 [Vitis vinifera]
Length=435

 Score =   369 bits (947),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  60   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  119

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  120  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  179

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  180  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  239

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  240  FQTNLVPYPRIHFMLSSYAP  259



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   369 bits (948),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AHJ80817.1| Tua1 [Eragrostis tef]
Length=451

 Score =   369 bits (948),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQ NLVPYPRIHFMLSSYAP
Sbjct  255  FQANLVPYPRIHFMLSSYAP  274



>ref|XP_006472373.1| PREDICTED: tubulin alpha chain isoform X2 [Citrus sinensis]
Length=460

 Score =   370 bits (949),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_006573681.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Glycine max]
Length=424

 Score =   369 bits (946),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDI+RPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_006606007.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=437

 Score =   369 bits (947),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_003524707.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Glycine max]
 gb|KHN47565.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   369 bits (948),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_008219157.1| PREDICTED: tubulin alpha chain-like isoform X2 [Prunus mume]
Length=442

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ABF98641.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG95437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99628.1| unnamed protein product [Oryza sativa Japonica Group]
Length=416

 Score =   368 bits (944),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  40   IDEVRTGCYRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  99

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  100  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  159

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  160  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  219

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  220  FQTNLVPYPRIHFMLSSYAP  239



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   369 bits (948),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|KDO81347.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_006472372.1| PREDICTED: tubulin alpha chain isoform X1 [Citrus sinensis]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>dbj|BAF96594.1| tubulin [Rosa hybrid cultivar]
Length=260

 Score =   362 bits (929),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 191/200 (96%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLDR+RKLADNCTGLQG
Sbjct  29   IDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDRVRKLADNCTGLQG  88

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTH+L
Sbjct  89   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHAL  148

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLT SLRFDGA+NVDV E
Sbjct  149  LEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDVTE  208

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  209  FQTNLVPYPRIHFMLSSYAP  228



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_006338461.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Solanum tuberosum]
Length=434

 Score =   369 bits (946),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  135  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVA+LLDNEAIYDICR+SLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAILLDNEAIYDICRKSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>dbj|BAG99724.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   368 bits (944),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  40   IDEVRTGCYRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  99

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  100  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  159

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  160  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  219

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  220  FQTNLVPYPRIHFMLSSYAP  239



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_006589612.1| PREDICTED: tubulin alpha chain-like isoform X2 [Glycine max]
Length=449

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|KJB83377.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=346

 Score =   365 bits (937),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 194/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR+RKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRVRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQ+ISSLT SLRFDGA+NVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_006662856.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVA+LLDNEAIYDICRRSLDIERP+YTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAILLDNEAIYDICRRSLDIERPSYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_003556001.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
 gb|KHN01573.1| Tubulin alpha-4 chain [Glycine soja]
Length=449

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AHJ80816.1| Tua1 [Eragrostis tef]
Length=451

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEH DVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHIDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>dbj|BAB19779.1| alpha tubulin [Nicotiana tabacum]
Length=450

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 199/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLF PEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFRPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_003536570.1| PREDICTED: tubulin alpha chain-like isoform X1 [Glycine max]
 gb|KHN23177.1| Tubulin alpha chain [Glycine soja]
Length=449

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ABK92552.1| unknown [Populus trichocarpa]
Length=451

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_010531322.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Tarenaya hassleriana]
Length=454

 Score =   369 bits (947),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>emb|CAA06619.1| alpha-tubulin 1 [Eleusine indica]
Length=451

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL ASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLIASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_003539228.1| PREDICTED: tubulin alpha-2 chain-like [Glycine max]
 gb|KHN13032.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDE+RTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEIRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_006579968.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Glycine max]
Length=462

 Score =   369 bits (947),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|KEH43997.1| tubulin beta-1 chain [Medicago truncatula]
Length=450

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_004496862.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=450

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_006650518.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_007205183.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
 ref|XP_008236958.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 gb|EMJ06382.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
Length=451

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AHJ80815.1| Tua1 [Eragrostis tef]
Length=451

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+S VISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSXVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ACH68563.1| alpha-tubulin [Solanum tuberosum]
Length=449

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  74   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  133

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL
Sbjct  134  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  193

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNR ISQVISSLTASLRFDGALNVDVNE
Sbjct  194  LEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRFISQVISSLTASLRFDGALNVDVNE  253

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  254  FQTNLVPYPRIHFMLSSYAP  273



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVD+CLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDICLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_006650524.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ACU19580.1| unknown [Glycine max]
Length=449

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|NP_001067613.1| Os11g0247300 [Oryza sativa Japonica Group]
 sp|Q53M52.1|TBA2_ORYSJ RecName: Full=Tubulin alpha-2 chain [Oryza sativa Japonica Group]
 gb|AAX96762.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|AAX96764.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92352.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA92353.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27976.1| Os11g0247300 [Oryza sativa Japonica Group]
 gb|EAY80511.1| hypothetical protein OsI_35689 [Oryza sativa Indica Group]
 gb|EAZ17981.1| hypothetical protein OsJ_33527 [Oryza sativa Japonica Group]
 dbj|BAG95614.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH85357.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|ADM86870.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|AFI71279.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGDYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AFP25227.1| alpha-tubulin, partial [Leptoamphisiella vermis]
Length=327

 Score =   364 bits (934),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 191/200 (96%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  16   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  75

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            F++FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  76   FIIFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  135

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLI+QVISSLTASLRFDGALNVD+ E
Sbjct  136  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDITE  195

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  196  FQTNLVPYPRIHFMLSSYAP  215



>ref|XP_010099392.1| Tubulin alpha chain [Morus notabilis]
 ref|XP_010105098.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB78237.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC03883.1| Tubulin alpha chain [Morus notabilis]
Length=467

 Score =   369 bits (947),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  91   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  150

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  151  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  210

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  211  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  270

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  271  FQTNLVPYPRIHFMLSSYAP  290



>gb|AEN19682.1| alpha-tubulin [Cymbidium faberi]
Length=401

 Score =   367 bits (941),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  63   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  122

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  123  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  182

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  183  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  242

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  243  FQTNLVPYPRIHFMLSSYAP  262



>gb|AEQ75493.1| alpha-tubulin [Rosa multiflora]
Length=440

 Score =   368 bits (944),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  64   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  123

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  124  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  183

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  184  LEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  243

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  244  FQTNLVPYPRIHFMLSSYAP  263



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   368 bits (945),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  79   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  138

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQ+STSVVEPYNSVLSTHSL
Sbjct  139  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQISTSVVEPYNSVLSTHSL  198

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  199  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  258

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  259  FQTNLVPYPRIHFMLSSYAP  278



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   368 bits (945),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVD+CLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDVCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ADW83724.1| alpha-tubulin [Musa acuminata AAA Group]
Length=423

 Score =   367 bits (943),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  47   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  106

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  107  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  166

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  167  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  226

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  227  FQTNLVPYPRIHFMLSSYAP  246



>gb|ABU96694.1| alpha-tubulin [Uronychia binucleata]
Length=357

 Score =   365 bits (936),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 194/200 (97%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPE+LISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  29   IDEVRTGTYRQLFHPERLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  88

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  89   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  148

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVA++LDNEAIYDICRR+LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  149  LEHTDVAIMLDNEAIYDICRRNLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  208

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  209  FQTNLVPYPRIHFMLSSYAP  228



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   368 bits (945),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   368 bits (945),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   368 bits (945),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ABU96696.1| alpha-tubulin [Uronychia transfuga]
Length=357

 Score =   365 bits (936),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 198/199 (99%), Gaps = 0/199 (0%)
 Frame = +1

Query  4    DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGF  183
            DEVRTGTYRQLFHPEQ+ISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGF
Sbjct  30   DEVRTGTYRQLFHPEQIISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGF  89

Query  184  LVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSLL  363
            LVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSLL
Sbjct  90   LVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLL  149

Query  364  EHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNEF  543
            EHTDVAV+LDNEAIYDICRR+LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV EF
Sbjct  150  EHTDVAVMLDNEAIYDICRRNLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTEF  209

Query  544  QTNLVPYPRIHFMLSSYAP  600
            QTNLVPYPRIHFMLSSYAP
Sbjct  210  QTNLVPYPRIHFMLSSYAP  228



>dbj|BAF96589.1| tubulin [Rosa hybrid cultivar]
Length=260

 Score =   361 bits (927),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 190/200 (95%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLDR+RKLADNCTGLQG
Sbjct  29   IDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDRVRKLADNCTGLQG  88

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTH+L
Sbjct  89   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHAL  148

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLT SLRFDGA+NVD+ E
Sbjct  149  LEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDITE  208

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  209  FQTNLVPYPRIHFMLSSYAP  228



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   368 bits (945),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  135  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICR+SLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRKSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AFP25238.1| alpha-tubulin, partial [Heterodiophrys zhui]
Length=323

 Score =   363 bits (933),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 192/200 (96%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  12   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  71

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FL+FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  72   FLIFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  131

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV++DNEA+YDICRR+LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  132  LEHTDVAVMIDNEAVYDICRRNLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  191

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSY P
Sbjct  192  FQTNLVPYPRIHFMLSSYGP  211



>gb|AEN19681.1| alpha-tubulin [Cymbidium faberi]
 gb|AEN19683.1| alpha-tubulin [Cymbidium faberi]
 gb|AEN19684.1| alpha-tubulin [Cymbidium faberi]
Length=401

 Score =   366 bits (940),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  63   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  122

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  123  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  182

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  183  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  242

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  243  FQTNLVPYPRIHFMLSSYAP  262



>ref|XP_003517369.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Glycine max]
Length=451

 Score =   368 bits (945),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDI+RPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ABF98643.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=433

 Score =   367 bits (943),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGCYRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_008352751.1| PREDICTED: tubulin alpha chain isoform X2 [Malus domestica]
Length=449

 Score =   368 bits (944),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   368 bits (944),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>emb|CAA62916.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   368 bits (944),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGCYRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   368 bits (944),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 195/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGL SLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLASLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   368 bits (944),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|NP_001291325.1| tubulin alpha chain-like [Sesamum indicum]
 gb|AFJ42573.1| alpha-tubulin [Sesamum indicum]
Length=450

 Score =   368 bits (944),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  135  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICR+SLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRKSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_009357231.1| PREDICTED: tubulin alpha chain-like isoform X2 [Pyrus x bretschneideri]
Length=446

 Score =   368 bits (944),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_006578253.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Glycine max]
Length=432

 Score =   367 bits (942),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   368 bits (944),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AFO69623.1| alpha-tubulin, partial [Prodiscocephalus borrori]
Length=332

 Score =   363 bits (933),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 191/200 (96%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  15   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  74

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            F++FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  75   FIIFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  134

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLI+QVISSLTASLRFDGALNVD+ E
Sbjct  135  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDITE  194

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  195  FQTNLVPYPRIHFMLSSYAP  214



>gb|AFP25259.1| alpha-tubulin, partial [Diophrys parappendiculata]
Length=324

 Score =   363 bits (932),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 192/200 (96%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLAD CTGLQG
Sbjct  12   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADQCTGLQG  71

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+VVEPYNSVLSTHSL
Sbjct  72   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSL  131

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  132  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLLSQVISSLTASLRFDGALNVDVTE  191

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  192  FQTNLVPYPRIHFMLSSYAP  211



>gb|AAN40715.1| alpha-tubulin [Strobilidium sp.]
Length=365

 Score =   365 bits (936),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 194/200 (97%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            +DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  37   VDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  96

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  97   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  156

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEAIYDICRR+LDIERPTYTNLNRLI+QVISSLTASLRFDGALNVDV E
Sbjct  157  LEHTDVAVILDNEAIYDICRRNLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDVTE  216

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  217  FQTNLVPYPRIHFMLSSYAP  236



>ref|XP_010557536.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Tarenaya hassleriana]
Length=455

 Score =   368 bits (944),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_007223365.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
 ref|XP_008219156.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 ref|XP_008347836.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_008352750.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_009357230.1| PREDICTED: tubulin alpha chain-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009335481.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
 gb|EMJ24564.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
Length=451

 Score =   368 bits (944),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AAN40716.1| alpha-tubulin [Strobilidium sp.]
Length=369

 Score =   365 bits (936),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 194/200 (97%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            +DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  38   VDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  97

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  98   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  157

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEAIYDICRR+LDIERPTYTNLNRLI+QVISSLTASLRFDGALNVDV E
Sbjct  158  LEHTDVAVILDNEAIYDICRRNLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDVTE  217

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  218  FQTNLVPYPRIHFMLSSYAP  237



>ref|NP_001051132.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|AAG16905.1|AF182523_1 alpha-tubulin [Oryza sativa]
 gb|AAS07163.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|AAT77077.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|ABF98642.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG78592.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF13046.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|EAY91719.1| hypothetical protein OsI_13361 [Oryza sativa Indica Group]
 gb|EAZ28437.1| hypothetical protein OsJ_12419 [Oryza sativa Japonica Group]
 gb|AFI71265.1| alpha tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   368 bits (944),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGCYRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_008440460.1| PREDICTED: tubulin alpha chain-like isoform X2 [Cucumis melo]
Length=437

 Score =   367 bits (942),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDI+RPTY NLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIDRPTYQNLNRLISQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AFV46219.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=440

 Score =   367 bits (943),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  112  IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  171

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  172  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  231

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICR+SLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  232  LEHTDVAVLLDNEAIYDICRKSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  291

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  292  FQTNLVPYPRIHFMLSSYAP  311



>ref|XP_011098608.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   367 bits (943),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  135  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICR+SLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRKSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AFP25235.1| alpha-tubulin, partial [Apodiophrys ovalis]
 gb|AFP25237.1| alpha-tubulin, partial [Apodiophrys ovalis]
Length=357

 Score =   364 bits (935),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 192/200 (96%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  29   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  88

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            F++FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  89   FIIFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  148

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLI+QVISSLTASLRFDGALNVDV E
Sbjct  149  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDVTE  208

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  209  FQTNLVPYPRIHFMLSSYAP  228



>gb|AFO69620.1| alpha-tubulin, partial [Diophrys parappendiculata]
Length=323

 Score =   363 bits (932),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 192/200 (96%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLAD CTGLQG
Sbjct  11   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADQCTGLQG  70

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+VVEPYNSVLSTHSL
Sbjct  71   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSL  130

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  131  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLLSQVISSLTASLRFDGALNVDVTE  190

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  191  FQTNLVPYPRIHFMLSSYAP  210



>ref|XP_008347837.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Malus domestica]
Length=459

 Score =   368 bits (944),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score =   367 bits (943),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ADW66593.1| alpha tubulin [Hirschfeldia incana]
Length=355

 Score =   364 bits (934),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 194/200 (97%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  73   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  132

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  133  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  192

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV++LLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  193  LEHTDVSILLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  252

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  253  FQTNLVPYPRIHFMLSSYAP  272



>gb|AFP25229.1| alpha-tubulin, partial [Apodiophrys ovalis]
 gb|AFP25230.1| alpha-tubulin, partial [Apodiophrys ovalis]
 gb|AFP25232.1| alpha-tubulin, partial [Apodiophrys ovalis]
Length=357

 Score =   364 bits (935),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 192/200 (96%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  29   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  88

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            F++FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  89   FIIFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  148

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLI+QVISSLTASLRFDGALNVDV E
Sbjct  149  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDVTE  208

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  209  FQTNLVPYPRIHFMLSSYAP  228



>gb|AFP25236.1| alpha-tubulin, partial [Apodiophrys ovalis]
Length=357

 Score =   364 bits (934),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 192/200 (96%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  29   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  88

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            F++FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  89   FIIFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  148

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLI+QVISSLTASLRFDGALNVDV E
Sbjct  149  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDVTE  208

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  209  FQTNLVPYPRIHFMLSSYAP  228



>gb|AAO23139.1| alpha tubulin [Populus tremuloides]
Length=451

 Score =   367 bits (943),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>emb|CAB66336.1| alpha-tubulin [Betula pendula]
 gb|AJA29683.1| tubulin alpha chain [Betula luminifera]
Length=451

 Score =   367 bits (943),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   367 bits (943),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ABG78593.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   367 bits (943),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHY+IGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGDYRQLFHPEQLISGKEDAANNFARGHYSIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|KGN48654.1| hypothetical protein Csa_6G497050 [Cucumis sativus]
Length=415

 Score =   366 bits (940),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  40   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  99

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  100  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  159

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDI+RPTY NLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  160  LEHTDVAVLLDNEAIYDICRRSLDIDRPTYQNLNRLISQVISSLTASLRFDGALNVDVTE  219

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  220  FQTNLVPYPRIHFMLSSYAP  239



>ref|XP_008455056.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Cucumis melo]
Length=406

 Score =   366 bits (939),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   367 bits (943),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   367 bits (943),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   367 bits (943),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AFP25231.1| alpha-tubulin, partial [Apodiophrys ovalis]
Length=357

 Score =   364 bits (934),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 192/200 (96%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  29   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  88

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            F++FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  89   FIIFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  148

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLI+QVISSLTASLRFDGALNVDV E
Sbjct  149  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDVTE  208

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  209  FQTNLVPYPRIHFMLSSYAP  228



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   369 bits (947),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 197/200 (99%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  125  IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  184

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  185  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  244

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  245  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  304

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  305  FQTNLVPYPRIHFMLSSYAP  324



>ref|XP_009388502.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=451

 Score =   367 bits (943),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score =   367 bits (943),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   367 bits (943),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   367 bits (942),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   367 bits (942),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   367 bits (942),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   367 bits (942),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_004150268.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004156870.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_008454421.1| PREDICTED: tubulin alpha chain [Cucumis melo]
 gb|ADN33817.1| tubulin alpha chain [Cucumis melo subsp. melo]
 gb|KGN52737.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   367 bits (942),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 195/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERP Y+NLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPNYSNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_006581475.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=466

 Score =   368 bits (944),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AAN40727.1| alpha-tubulin [Metacylis angulata]
Length=366

 Score =   364 bits (934),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 193/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLAD CTGLQG
Sbjct  38   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADQCTGLQG  97

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+VVEPYNSVLSTHSL
Sbjct  98   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSL  157

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  158  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  217

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  218  FQTNLVPYPRIHFMLSSYAP  237



>gb|ADF32932.1| alpha-tubulin [Anteholosticha sp. QDSC04082401]
Length=357

 Score =   364 bits (934),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 193/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLAD CTGLQG
Sbjct  29   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADQCTGLQG  88

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  89   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  148

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLISQVISSLTASLRFDGALNVD+ E
Sbjct  149  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDITE  208

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  209  FQTNLVPYPRIHFMLSSYAP  228



>ref|XP_009618479.1| PREDICTED: tubulin alpha-3 chain-like [Nicotiana tomentosiformis]
Length=451

 Score =   367 bits (942),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 195/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AHC92564.1| alpha tubulin subunit, partial [Colponema sp. Vietnam]
Length=384

 Score =   365 bits (936),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 194/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  47   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  106

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  107  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  166

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEAIYDICRR LDIERPTYTNLNRLI+QVISSLTASLRFDGALNVD+ E
Sbjct  167  LEHTDVAVMLDNEAIYDICRRQLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDITE  226

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  227  FQTNLVPYPRIHFMLSSYAP  246



>emb|CAA64074.1| alpha-tubulin [Colpoda sp.]
Length=380

 Score =   365 bits (936),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 193/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            +DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  43   VDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  102

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFN+VGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  103  FLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  162

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEAIYDICRR LDIERPTYTNLNRLI+QVISSLTASLRFDGALNVDV E
Sbjct  163  LEHTDVAVMLDNEAIYDICRRQLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDVTE  222

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  223  FQTNLVPYPRIHFMLSSYAP  242



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   367 bits (942),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ABJ80973.1| alpha tubulin, partial [Glaucocystis nostochinearum]
Length=378

 Score =   364 bits (935),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 193/200 (97%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANN+ARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  47   IDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  106

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  107  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  166

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRRSLDIERPTYTNLNRL++QVISSLTASLRFDGALNVDV E
Sbjct  167  LEHTDVAVMLDNEAVYDICRRSLDIERPTYTNLNRLVAQVISSLTASLRFDGALNVDVTE  226

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  227  FQTNLVPYPRIHFMLSSYAP  246



>gb|AFP25234.1| alpha-tubulin, partial [Apodiophrys ovalis]
Length=357

 Score =   363 bits (933),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 191/200 (96%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  29   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  88

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            F++FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+VVEPYNSVLSTHSL
Sbjct  89   FIIFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSL  148

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLI+QVISSLTASLRFDGALNVDV E
Sbjct  149  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDVTE  208

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  209  FQTNLVPYPRIHFMLSSYAP  228



>gb|AAW57312.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=325

 Score =   362 bits (930),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 193/200 (97%), Positives = 197/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGT+RQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  68   IDEVRTGTFRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  127

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGL SLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  128  FLVFHAVGGGTGSGLASLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  187

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTY NLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  188  LEHTDVAVLLDNEAIYDICRRSLDIERPTYNNLNRLISQVISSLTASLRFDGALNVDVTE  247

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  248  FQTNLVPYPRIHFMLSSYAP  267



>ref|XP_002976230.1| hypothetical protein SELMODRAFT_105136 [Selaginella moellendorffii]
 ref|XP_002987138.1| hypothetical protein SELMODRAFT_125554 [Selaginella moellendorffii]
 gb|EFJ11714.1| hypothetical protein SELMODRAFT_125554 [Selaginella moellendorffii]
 gb|EFJ22490.1| hypothetical protein SELMODRAFT_105136 [Selaginella moellendorffii]
Length=451

 Score =   367 bits (942),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 194/200 (97%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FL+FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+VVEPYNSVLSTHSL
Sbjct  135  FLIFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVD+ E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDITE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_010557535.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   367 bits (942),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_004232226.1| PREDICTED: tubulin alpha chain-like [Solanum lycopersicum]
 ref|XP_006338460.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Solanum tuberosum]
Length=450

 Score =   367 bits (942),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  135  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVA+LLDNEAIYDICR+SLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAILLDNEAIYDICRKSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|NP_849388.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 dbj|BAH19475.1| AT4G14960 [Arabidopsis thaliana]
 gb|AEE83529.1| tubulin alpha-6 chain [Arabidopsis thaliana]
Length=427

 Score =   366 bits (940),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 194/200 (97%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV++LLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVSILLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AAN40732.1| alpha-tubulin, partial [Schmidingerella sp. LAK-2008]
Length=366

 Score =   364 bits (934),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 193/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLAD CTGLQG
Sbjct  36   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADQCTGLQG  95

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+VVEPYNSVLSTHSL
Sbjct  96   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSL  155

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  156  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  215

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  216  FQTNLVPYPRIHFMLSSYAP  235



>gb|AAN40733.1| alpha-tubulin, partial [Schmidingerella sp. LAK-2008]
Length=365

 Score =   364 bits (934),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 193/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLAD CTGLQG
Sbjct  37   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADQCTGLQG  96

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+VVEPYNSVLSTHSL
Sbjct  97   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSL  156

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  157  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  216

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  217  FQTNLVPYPRIHFMLSSYAP  236



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score =   367 bits (942),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_009626810.1| PREDICTED: tubulin alpha chain-like [Nicotiana tomentosiformis]
 ref|XP_009785294.1| PREDICTED: tubulin alpha chain-like [Nicotiana sylvestris]
Length=450

 Score =   367 bits (942),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  135  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVA+LLDNEAIYDICR+SLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAILLDNEAIYDICRKSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>sp|P46259.1|TBA1_PEA RecName: Full=Tubulin alpha-1 chain [Pisum sativum]
 gb|AAA79910.1| alpha-tubulin [Pisum sativum]
Length=452

 Score =   367 bits (942),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   367 bits (942),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   367 bits (942),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AAN40726.1| alpha-tubulin [Metacylis angulata]
Length=366

 Score =   364 bits (934),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 193/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLAD CTGLQG
Sbjct  38   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADQCTGLQG  97

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+VVEPYNSVLSTHSL
Sbjct  98   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSL  157

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  158  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  217

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  218  FQTNLVPYPRIHFMLSSYAP  237



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   367 bits (942),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGQYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AAN40708.1| alpha-tubulin [Tintinnopsis tubulosoides]
Length=367

 Score =   364 bits (934),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 193/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLAD CTGLQG
Sbjct  36   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADQCTGLQG  95

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+VVEPYNSVLSTHSL
Sbjct  96   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSL  155

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  156  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  215

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  216  FQTNLVPYPRIHFMLSSYAP  235



>gb|AAM89908.1| alpha-tubulin [Eutintinnus pectinis]
Length=363

 Score =   363 bits (933),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 193/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLAD CTGLQG
Sbjct  33   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADQCTGLQG  92

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+VVEPYNSVLSTHSL
Sbjct  93   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSL  152

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  153  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  212

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  213  FQTNLVPYPRIHFMLSSYAP  232



>gb|AAN40724.1| alpha-tubulin [Metacylis angulata]
Length=369

 Score =   364 bits (934),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 193/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLAD CTGLQG
Sbjct  37   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADQCTGLQG  96

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+VVEPYNSVLSTHSL
Sbjct  97   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSL  156

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  157  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  216

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  217  FQTNLVPYPRIHFMLSSYAP  236



>ref|XP_007156677.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
 gb|ESW28671.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
Length=451

 Score =   367 bits (941),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 195/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR+RKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRVRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AFP25239.1| alpha-tubulin, partial [Discocephalus pararotatorius]
Length=325

 Score =   362 bits (930),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 188/200 (94%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  12   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  71

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            F++FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQ+ST+VVEPYNSVLSTHSL
Sbjct  72   FIIFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQISTAVVEPYNSVLSTHSL  131

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVA++LDNEA+YDICRR+LDIERPTYTNLNRLI+Q+ISSLTASLRFDGALNVD+ E
Sbjct  132  LEHTDVAIMLDNEAVYDICRRNLDIERPTYTNLNRLIAQIISSLTASLRFDGALNVDITE  191

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  192  FQTNLVPYPRIHFMLSSYAP  211



>gb|AAN40710.1| alpha-tubulin [Tintinnopsis tubulosoides]
Length=367

 Score =   364 bits (934),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 193/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLAD CTGLQG
Sbjct  36   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADQCTGLQG  95

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+VVEPYNSVLSTHSL
Sbjct  96   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSL  155

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  156  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  215

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  216  FQTNLVPYPRIHFMLSSYAP  235



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   367 bits (941),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDI+RPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AHC92565.1| alpha tubulin subunit, partial [Colponema sp. Vietnam]
Length=384

 Score =   364 bits (935),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 194/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  47   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  106

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  107  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  166

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEAIYDICRR LDIERPTYTNLNRLI+QVISSLTASLRFDGALNVD+ E
Sbjct  167  LEHTDVAVMLDNEAIYDICRRQLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDITE  226

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  227  FQTNLVPYPRIHFMLSSYAP  246



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score =   367 bits (941),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ADF32933.1| alpha-tubulin [Holosticha diademata]
Length=357

 Score =   363 bits (932),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 192/200 (96%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLAD CTGLQG
Sbjct  29   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADQCTGLQG  88

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            F+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  89   FIVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  148

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLISQVISSLTASLRFDGALNVD+ E
Sbjct  149  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDITE  208

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  209  FQTNLVPYPRIHFMLSSYAP  228



>gb|ABJ80972.1| alpha tubulin, partial [Glaucocystis nostochinearum]
Length=378

 Score =   364 bits (934),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 193/200 (97%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANN+ARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  47   IDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  106

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  107  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  166

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRRSLDIERPTYTNLNRL++QVISSLTASLRFDGALNVDV E
Sbjct  167  LEHTDVAVMLDNEAVYDICRRSLDIERPTYTNLNRLVAQVISSLTASLRFDGALNVDVTE  226

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  227  FQTNLVPYPRIHFMLSSYAP  246



>ref|XP_007155784.1| hypothetical protein PHAVU_003G231500g [Phaseolus vulgaris]
 gb|ESW27778.1| hypothetical protein PHAVU_003G231500g [Phaseolus vulgaris]
Length=450

 Score =   367 bits (941),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AAN40725.1| alpha-tubulin [Metacylis angulata]
Length=371

 Score =   364 bits (934),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 193/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLAD CTGLQG
Sbjct  38   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADQCTGLQG  97

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+VVEPYNSVLSTHSL
Sbjct  98   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSL  157

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  158  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  217

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  218  FQTNLVPYPRIHFMLSSYAP  237



>sp|Q9FT36.1|TBA_DAUCA RecName: Full=Tubulin alpha chain [Daucus carota]
 gb|AAG02564.1| alpha-tubulin [Daucus carota]
Length=451

 Score =   367 bits (941),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 194/200 (97%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQ+STSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQISTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV+VLLDNEAIYDIC+RSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVSVLLDNEAIYDICKRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   367 bits (941),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FL FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLGFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score =   367 bits (941),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AAS66990.1| alpha-tubulin [Phacodinium metchnikoffi]
Length=381

 Score =   364 bits (934),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 192/200 (96%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            +DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  44   VDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  103

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQ+ST+VVEPYNSVLSTHSL
Sbjct  104  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQISTAVVEPYNSVLSTHSL  163

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLI+QVISSLTASLRFDGALNVDV E
Sbjct  164  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDVTE  223

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  224  FQTNLVPYPRIHFMLSSYAP  243



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   367 bits (941),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_010466127.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Camelina sativa]
Length=423

 Score =   365 bits (938),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 193/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLT SLRFDGALNVD+ E
Sbjct  195  LEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTTSLRFDGALNVDITE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_009779180.1| PREDICTED: tubulin alpha-3 chain-like [Nicotiana sylvestris]
Length=451

 Score =   367 bits (941),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 194/200 (97%), Positives = 200/200 (100%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLDRIRKLAD+CTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLDRIRKLADSCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDVNE
Sbjct  195  LEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ABA41243.1| alpha-tubulin, partial [Mantoniella squamata]
Length=395

 Score =   364 bits (935),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 193/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  56   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  115

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            F+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  116  FMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  175

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEAIYDICRRSLDIERPTYTNLNRL+ QVISSLTASLRFDGALNVD+ E
Sbjct  176  LEHTDVAVMLDNEAIYDICRRSLDIERPTYTNLNRLVGQVISSLTASLRFDGALNVDITE  235

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  236  FQTNLVPYPRIHFMLSSYAP  255



>gb|AEO92378.1| alpha-tubulin, partial [Chilodonella uncinata]
 gb|AEO92379.1| alpha-tubulin, partial [Chilodonella uncinata]
 gb|AEO92380.1| alpha-tubulin, partial [Chilodonella uncinata]
 gb|AEO92381.1| alpha-tubulin, partial [Chilodonella uncinata]
Length=340

 Score =   362 bits (930),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 190/200 (95%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            +DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLDRIRKLADNCTGLQG
Sbjct  31   VDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLDRIRKLADNCTGLQG  90

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQ+ST+VVEPYNS+LSTHSL
Sbjct  91   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQISTAVVEPYNSILSTHSL  150

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEAIYD+CRR LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  151  LEHTDVAVMLDNEAIYDVCRRQLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  210

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  211  FQTNLVPYPRIHFMLSSYAP  230



>ref|XP_009388503.1| PREDICTED: tubulin alpha chain isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=465

 Score =   367 bits (942),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AAN40729.1| alpha-tubulin [Laboea strobila]
Length=369

 Score =   363 bits (932),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 194/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLAD CTGLQG
Sbjct  38   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADQCTGLQG  97

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+VVEPYNSVLSTHSL
Sbjct  98   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSL  157

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEAIYDICRR+LDIERPTYTNLNRLI+QVISSLTASLRFDGALNVDV E
Sbjct  158  LEHTDVAVILDNEAIYDICRRNLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDVTE  217

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  218  FQTNLVPYPRIHFMLSSYAP  237



>gb|KHN42598.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   366 bits (940),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 195/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVNLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDI+RPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AAL33701.1| alpha-tubulin, partial [Chilodonella uncinata]
Length=346

 Score =   362 bits (930),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 190/200 (95%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            +DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLDRIRKLADNCTGLQG
Sbjct  37   VDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLDRIRKLADNCTGLQG  96

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQ+ST+VVEPYNS+LSTHSL
Sbjct  97   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQISTAVVEPYNSILSTHSL  156

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEAIYD+CRR LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  157  LEHTDVAVMLDNEAIYDVCRRQLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  216

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  217  FQTNLVPYPRIHFMLSSYAP  236



>ref|XP_007143142.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
 gb|ESW15136.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
Length=449

 Score =   366 bits (939),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ABR22539.1| alpha-tubulin, partial [Mantoniella squamata]
Length=372

 Score =   363 bits (932),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 192/200 (96%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  49   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  108

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            F+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYP+PQVST+VVEPYNSVLSTHSL
Sbjct  109  FMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPTPQVSTAVVEPYNSVLSTHSL  168

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEAIYDICRRSLDIERPTYTNLNRL+ QVISSLTASLRFDGALNVD+ E
Sbjct  169  LEHTDVAVMLDNEAIYDICRRSLDIERPTYTNLNRLVGQVISSLTASLRFDGALNVDITE  228

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  229  FQTNLVPYPRIHFMLSSYAP  248



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   366 bits (940),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AAN40713.1| alpha-tubulin [Strombidium sp.]
Length=363

 Score =   363 bits (931),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 193/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLAD CTGLQG
Sbjct  36   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADQCTGLQG  95

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+VVEPYNSVLSTHSL
Sbjct  96   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSL  155

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEAIYDICRR+LDIERPTYTNLNRLI+QVISSLTASLRFDGALNVDV E
Sbjct  156  LEHTDVAVILDNEAIYDICRRNLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDVTE  215

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  216  FQTNLVPYPRIHFMLSSYAP  235



>emb|CDY25017.1| BnaC02g39910D [Brassica napus]
Length=410

 Score =   365 bits (936),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 194/200 (97%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV++LLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVSILLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ADF32935.1| alpha-tubulin [Parabirojimia multinucleata]
Length=357

 Score =   363 bits (931),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 192/200 (96%), Positives = 197/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLAD CTGLQG
Sbjct  29   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADQCTGLQG  88

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+VVEPYNSVLSTHSL
Sbjct  89   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSL  148

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA YDICRR+LDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  149  LEHTDVAVMLDNEAAYDICRRNLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  208

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  209  FQTNLVPYPRIHFMLSSYAP  228



>gb|ABO47737.1| alpha-tubulin [Gossypium hirsutum]
Length=451

 Score =   366 bits (939),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 195/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_008341563.1| PREDICTED: tubulin alpha-2 chain-like [Malus domestica]
Length=450

 Score =   366 bits (939),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 196/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|ACG69805.1| alpha-tubulin [Psammomitra retractilis]
Length=357

 Score =   363 bits (931),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 192/200 (96%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLAD CTGLQG
Sbjct  29   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADQCTGLQG  88

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFN+VGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+VVEPYNSVLSTHSL
Sbjct  89   FLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSL  148

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEA+YDICRR+LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  149  LEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  208

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  209  FQTNLVPYPRIHFMLSSYAP  228



>ref|NP_001275271.1| alpha-tubulin-like protein [Solanum tuberosum]
 gb|ABB72803.1| alpha-tubulin-like protein [Solanum tuberosum]
Length=452

 Score =   366 bits (939),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 195/200 (98%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKL+DNCTGLQG
Sbjct  76   IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLSDNCTGLQG  135

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSP VSTSVVEPYNSVLSTHSL
Sbjct  136  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPHVSTSVVEPYNSVLSTHSL  195

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVA+LLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSLT SLRFDGALNVDVNE
Sbjct  196  LEHTDVAILLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSLTTSLRFDGALNVDVNE  255

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  256  FQTNLVPYPRIHFMLSSYAP  275



>ref|XP_006482577.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Citrus sinensis]
Length=425

 Score =   365 bits (937),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 194/200 (97%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AAL33704.1| alpha-tubulin, partial [Chilodonella uncinata]
 gb|AAL33707.1| alpha-tubulin, partial [Chilodonella uncinata]
Length=360

 Score =   363 bits (931),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 190/200 (95%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            +DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLDRIRKLADNCTGLQG
Sbjct  32   VDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLDRIRKLADNCTGLQG  91

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQ+ST+VVEPYNS+LSTHSL
Sbjct  92   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQISTAVVEPYNSILSTHSL  151

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEAIYD+CRR LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  152  LEHTDVAVMLDNEAIYDVCRRQLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  211

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  212  FQTNLVPYPRIHFMLSSYAP  231



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   366 bits (939),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 195/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDE+RTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEIRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   366 bits (939),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 195/200 (98%), Positives = 199/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            IDEVRTGT+RQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG
Sbjct  75   IDEVRTGTFRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  134

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVVEPYNSVLSTHSL
Sbjct  135  FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSL  194

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSLTASLRFDGALNVDV E
Sbjct  195  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTE  254

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  255  FQTNLVPYPRIHFMLSSYAP  274



>gb|AAL33706.1| alpha-tubulin, partial [Chilodonella uncinata]
Length=351

 Score =   362 bits (930),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 190/200 (95%), Positives = 198/200 (99%), Gaps = 0/200 (0%)
 Frame = +1

Query  1    IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQG  180
            +DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLDRIRKLADNCTGLQG
Sbjct  30   VDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLDRIRKLADNCTGLQG  89

Query  181  FLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVVEPYNSVLSTHSL  360
            FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQ+ST+VVEPYNS+LSTHSL
Sbjct  90   FLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQISTAVVEPYNSILSTHSL  149

Query  361  LEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNE  540
            LEHTDVAV+LDNEAIYD+CRR LDIERPTYTNLNRLISQVISSLTASLRFDGALNVDV E
Sbjct  150  LEHTDVAVMLDNEAIYDVCRRQLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTE  209

Query  541  FQTNLVPYPRIHFMLSSYAP  600
            FQTNLVPYPRIHFMLSSYAP
Sbjct  210  FQTNLVPYPRIHFMLSSYAP  229



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940