BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS034C09

Length=583
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009794901.1|  PREDICTED: heat shock 70 kDa protein 15-like       239   8e-74   Nicotiana sylvestris
ref|XP_011080863.1|  PREDICTED: heat shock 70 kDa protein 14-like       245   3e-72   Sesamum indicum [beniseed]
ref|XP_009610834.1|  PREDICTED: heat shock 70 kDa protein 15-like...    239   6e-70   Nicotiana tomentosiformis
ref|XP_007217050.1|  hypothetical protein PRUPE_ppa001317mg             238   1e-69   Prunus persica
emb|CDO98063.1|  unnamed protein product                                238   1e-69   Coffea canephora [robusta coffee]
ref|XP_010249783.1|  PREDICTED: heat shock 70 kDa protein 15-like       235   1e-68   Nelumbo nucifera [Indian lotus]
ref|XP_008228510.1|  PREDICTED: heat shock 70 kDa protein 15-like       234   2e-68   Prunus mume [ume]
ref|XP_009624163.1|  PREDICTED: heat shock 70 kDa protein 15-like       234   2e-68   Nicotiana tomentosiformis
ref|XP_010254149.1|  PREDICTED: heat shock 70 kDa protein 15-like       233   6e-68   Nelumbo nucifera [Indian lotus]
ref|XP_009801414.1|  PREDICTED: heat shock 70 kDa protein 15-like       233   9e-68   Nicotiana sylvestris
emb|CBI36157.3|  unnamed protein product                                231   3e-67   Vitis vinifera
ref|XP_010098045.1|  Heat shock 70 kDa protein 15                       231   4e-67   Morus notabilis
ref|XP_009610837.1|  PREDICTED: heat shock 70 kDa protein 14-like...    230   4e-67   Nicotiana tomentosiformis
ref|XP_002279789.2|  PREDICTED: heat shock 70 kDa protein 14-like       231   5e-67   Vitis vinifera
ref|XP_002528199.1|  Heat shock 70 kDa protein, putative                230   8e-67   Ricinus communis
ref|XP_004252333.1|  PREDICTED: heat shock 70 kDa protein 15-like       229   1e-66   Solanum lycopersicum
ref|XP_007024112.1|  Heat shock protein 91 isoform 1                    229   1e-66   
ref|XP_006346577.1|  PREDICTED: heat shock 70 kDa protein 15-like...    229   2e-66   Solanum tuberosum [potatoes]
ref|XP_009587742.1|  PREDICTED: heat shock 70 kDa protein 15-like       229   2e-66   Nicotiana tomentosiformis
ref|XP_011072334.1|  PREDICTED: heat shock 70 kDa protein 15-like       227   8e-66   Sesamum indicum [beniseed]
ref|XP_008371663.1|  PREDICTED: heat shock 70 kDa protein 15-like       226   2e-65   
ref|XP_004252334.1|  PREDICTED: heat shock 70 kDa protein 15-like       226   3e-65   Solanum lycopersicum
gb|KDO51190.1|  hypothetical protein CISIN_1g003056mg                   223   6e-65   Citrus sinensis [apfelsine]
gb|KDO51189.1|  hypothetical protein CISIN_1g003056mg                   224   1e-64   Citrus sinensis [apfelsine]
ref|XP_006427039.1|  hypothetical protein CICLE_v10024883mg             224   1e-64   Citrus clementina [clementine]
gb|KJB70511.1|  hypothetical protein B456_011G076800                    223   1e-64   Gossypium raimondii
ref|XP_006465548.1|  PREDICTED: heat shock 70 kDa protein 14-like       224   2e-64   Citrus sinensis [apfelsine]
gb|KJB70509.1|  hypothetical protein B456_011G076800                    224   2e-64   Gossypium raimondii
ref|XP_004302913.1|  PREDICTED: heat shock 70 kDa protein 15-like       223   4e-64   Fragaria vesca subsp. vesca
ref|XP_009358190.1|  PREDICTED: heat shock 70 kDa protein 15-like       222   5e-64   Pyrus x bretschneideri [bai li]
gb|EYU21549.1|  hypothetical protein MIMGU_mgv1a001311mg                221   8e-64   Erythranthe guttata [common monkey flower]
ref|XP_010521527.1|  PREDICTED: heat shock 70 kDa protein 15            221   8e-64   Tarenaya hassleriana [spider flower]
ref|XP_010473008.1|  PREDICTED: heat shock 70 kDa protein 15-like       221   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006842242.1|  hypothetical protein AMTR_s00078p00190750          221   1e-63   Amborella trichopoda
ref|XP_006346576.1|  PREDICTED: heat shock 70 kDa protein 15-like       221   2e-63   Solanum tuberosum [potatoes]
gb|KHG16619.1|  Heat shock 70 kDa 15 -like protein                      221   2e-63   Gossypium arboreum [tree cotton]
ref|XP_003546366.1|  PREDICTED: heat shock 70 kDa protein 14-like       220   3e-63   Glycine max [soybeans]
ref|XP_009358191.1|  PREDICTED: heat shock 70 kDa protein 15-like       220   3e-63   Pyrus x bretschneideri [bai li]
ref|XP_007150665.1|  hypothetical protein PHAVU_005G171400g             220   4e-63   Phaseolus vulgaris [French bean]
ref|XP_010033879.1|  PREDICTED: heat shock 70 kDa protein 14-like       219   5e-63   Eucalyptus grandis [rose gum]
ref|NP_178111.1|  heat shock protein 91                                 219   5e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031305.1|  heat shock protein 91                              219   6e-63   Arabidopsis thaliana [mouse-ear cress]
gb|AAL38353.1|  putative heat-shock protein                             219   6e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850984.4|  Heat shock protein 70                                 219   6e-63   
gb|KDP37205.1|  hypothetical protein JCGZ_06261                         219   6e-63   Jatropha curcas
ref|XP_010033884.1|  PREDICTED: heat shock 70 kDa protein 14-like       219   7e-63   Eucalyptus grandis [rose gum]
ref|NP_178110.6|  Heat shock protein 70                                 219   7e-63   
ref|XP_002887853.1|  hypothetical protein ARALYDRAFT_896005             218   1e-62   Arabidopsis lyrata subsp. lyrata
ref|XP_008354139.1|  PREDICTED: heat shock 70 kDa protein 15-like       218   1e-62   
emb|CAA94389.1|  heat-shock protein                                     218   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008362708.1|  PREDICTED: heat shock 70 kDa protein 15-like       218   1e-62   
ref|XP_010430044.1|  PREDICTED: heat shock 70 kDa protein 15            218   2e-62   
ref|XP_006392781.1|  hypothetical protein EUTSA_v10011242mg             218   2e-62   Eutrema salsugineum [saltwater cress]
gb|KHG16198.1|  Heat shock 70 kDa 15 -like protein                      217   3e-62   Gossypium arboreum [tree cotton]
ref|XP_010538015.1|  PREDICTED: heat shock 70 kDa protein 14            215   1e-61   Tarenaya hassleriana [spider flower]
gb|KJB35056.1|  hypothetical protein B456_006G098500                    215   1e-61   Gossypium raimondii
gb|EYU24688.1|  hypothetical protein MIMGU_mgv1a001324mg                215   2e-61   Erythranthe guttata [common monkey flower]
ref|XP_010430043.1|  PREDICTED: heat shock 70 kDa protein 15-like       214   3e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010473009.1|  PREDICTED: heat shock 70 kDa protein 15-like       214   3e-61   Camelina sativa [gold-of-pleasure]
ref|XP_009147592.1|  PREDICTED: heat shock 70 kDa protein 14            213   6e-61   Brassica rapa
emb|CDY24089.1|  BnaA06g00870D                                          213   7e-61   Brassica napus [oilseed rape]
ref|XP_006287070.1|  hypothetical protein CARUB_v10000229mg             213   1e-60   Capsella rubella
gb|KFK42397.1|  hypothetical protein AALP_AA2G250600                    207   2e-60   Arabis alpina [alpine rockcress]
ref|XP_010539495.1|  PREDICTED: heat shock 70 kDa protein 15-like       212   2e-60   Tarenaya hassleriana [spider flower]
ref|XP_006300740.1|  hypothetical protein CARUB_v10019803mg             211   3e-60   Capsella rubella
emb|CDY45119.1|  BnaC06g06400D                                          211   5e-60   Brassica napus [oilseed rape]
ref|XP_003529646.1|  PREDICTED: heat shock 70 kDa protein 15-like...    211   6e-60   
ref|XP_010417776.1|  PREDICTED: heat shock 70 kDa protein 15-like...    210   7e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010915054.1|  PREDICTED: heat shock 70 kDa protein 14-like       211   7e-60   Elaeis guineensis
ref|XP_010417777.1|  PREDICTED: heat shock 70 kDa protein 15-like...    210   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_003597778.1|  97 kDa heat shock protein                          209   2e-59   Medicago truncatula
ref|XP_008793460.1|  PREDICTED: heat shock 70 kDa protein 14-like       209   3e-59   Phoenix dactylifera
gb|KHN47807.1|  Heat shock 70 kDa protein 14                            208   4e-59   Glycine soja [wild soybean]
ref|XP_003531683.1|  PREDICTED: heat shock 70 kDa protein 14-like...    208   5e-59   Glycine max [soybeans]
ref|XP_004141777.1|  PREDICTED: heat shock 70 kDa protein 15-like       208   5e-59   Cucumis sativus [cucumbers]
ref|XP_008462146.1|  PREDICTED: heat shock 70 kDa protein 15-like       207   1e-58   Cucumis melo [Oriental melon]
ref|XP_006643833.1|  PREDICTED: heat shock 70 kDa protein 14-like       205   7e-58   Oryza brachyantha
emb|CDX76065.1|  BnaA04g03290D                                          204   1e-57   
ref|XP_006585595.1|  PREDICTED: heat shock 70 kDa protein 14-like...    204   1e-57   Glycine max [soybeans]
ref|XP_009139126.1|  PREDICTED: heat shock 70 kDa protein 15            204   1e-57   Brassica rapa
ref|XP_010691292.1|  PREDICTED: heat shock 70 kDa protein 15-like       204   2e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004960855.1|  PREDICTED: heat shock 70 kDa protein 15-like...    204   2e-57   Setaria italica
ref|XP_003543647.1|  PREDICTED: heat shock 70 kDa protein 14-like       202   4e-57   Glycine max [soybeans]
ref|XP_009389931.1|  PREDICTED: heat shock 70 kDa protein 14-like       202   6e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010925584.1|  PREDICTED: heat shock 70 kDa protein 14-like       202   8e-57   Elaeis guineensis
ref|XP_002440718.1|  hypothetical protein SORBIDRAFT_09g005570          202   8e-57   Sorghum bicolor [broomcorn]
ref|XP_008775317.1|  PREDICTED: heat shock 70 kDa protein 14-like       201   1e-56   Phoenix dactylifera
ref|XP_002304187.1|  heat shock protein 70                              201   2e-56   Populus trichocarpa [western balsam poplar]
gb|KEH28782.1|  heat shock 70 kDa protein                               200   3e-56   Medicago truncatula
gb|AAG52244.1|AC011717_12  putative heat-shock protein; 41956-44878     199   4e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CDY43337.1|  BnaC04g25190D                                          200   4e-56   Brassica napus [oilseed rape]
ref|NP_001151579.1|  heat shock 70 kDa protein 4                        199   5e-56   Zea mays [maize]
gb|ACG43420.1|  heat shock 70 kDa protein 4                             199   5e-56   Zea mays [maize]
ref|XP_008655087.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    199   6e-56   Zea mays [maize]
ref|NP_001137020.1|  uncharacterized protein LOC100217188               195   7e-56   
ref|XP_002299641.1|  heat shock protein 70                              199   8e-56   Populus trichocarpa [western balsam poplar]
ref|XP_011000830.1|  PREDICTED: heat shock 70 kDa protein 15-like...    199   1e-55   Populus euphratica
ref|NP_001042210.1|  Os01g0180800                                       198   1e-55   
ref|XP_011000832.1|  PREDICTED: heat shock 70 kDa protein 14-like...    198   1e-55   Populus euphratica
ref|XP_004506857.1|  PREDICTED: heat shock 70 kDa protein 15-like       198   2e-55   Cicer arietinum [garbanzo]
ref|XP_011013254.1|  PREDICTED: heat shock 70 kDa protein 15-like       198   2e-55   Populus euphratica
gb|KHN32604.1|  Heat shock 70 kDa protein 14                            197   3e-55   Glycine soja [wild soybean]
ref|XP_004506856.1|  PREDICTED: heat shock 70 kDa protein 15-like       197   3e-55   Cicer arietinum [garbanzo]
gb|KDO51188.1|  hypothetical protein CISIN_1g003056mg                   197   4e-55   Citrus sinensis [apfelsine]
ref|XP_009399777.1|  PREDICTED: heat shock 70 kDa protein 14-like       196   7e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008647466.1|  PREDICTED: uncharacterized protein LOC100217...    194   4e-54   
ref|XP_007135698.1|  hypothetical protein PHAVU_010G150800g             194   5e-54   Phaseolus vulgaris [French bean]
ref|XP_010231644.1|  PREDICTED: heat shock 70 kDa protein 15-like       194   6e-54   Brachypodium distachyon [annual false brome]
ref|XP_004960853.1|  PREDICTED: heat shock 70 kDa protein 14-like...    193   1e-53   Setaria italica
ref|XP_004960852.1|  PREDICTED: heat shock 70 kDa protein 14-like...    192   2e-53   
ref|XP_008649434.1|  PREDICTED: heat shock 70 kDa protein 14-like       192   2e-53   Zea mays [maize]
ref|XP_010925328.1|  PREDICTED: heat shock 70 kDa protein 14-like       192   4e-53   Elaeis guineensis
ref|XP_008786326.1|  PREDICTED: heat shock 70 kDa protein 15-like       191   5e-53   Phoenix dactylifera
dbj|BAJ90753.1|  predicted protein                                      190   9e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW77408.1|  hypothetical protein ZEAMMB73_835876                    192   1e-52   
gb|EMT31029.1|  Heat shock 70 kDa protein 4L                            189   2e-52   
ref|XP_008654914.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    188   6e-52   
ref|NP_001147805.1|  heat shock 70 kDa protein 4                        188   7e-52   Zea mays [maize]
ref|XP_009408938.1|  PREDICTED: heat shock 70 kDa protein 15-like       187   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002439385.1|  hypothetical protein SORBIDRAFT_09g005580          186   3e-51   Sorghum bicolor [broomcorn]
gb|EMS61926.1|  Heat shock 70 kDa protein 4L                            185   6e-51   Triticum urartu
gb|EMS52665.1|  Heat shock 70 kDa protein 4L                            185   5e-50   Triticum urartu
gb|EMT09857.1|  Heat shock 70 kDa protein 4L                            182   2e-49   
ref|XP_010231645.1|  PREDICTED: heat shock 70 kDa protein 14-like       180   7e-49   
ref|XP_009388669.1|  PREDICTED: heat shock 70 kDa protein 14-like       176   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS57643.1|  hypothetical protein M569_17174                         162   8e-46   Genlisea aurea
emb|CCM07272.1|  Putative 97 kDa heat shock protein                     170   3e-45   Musa balbisiana [starchy banana]
ref|XP_006654112.1|  PREDICTED: heat shock 70 kDa protein 15-like       167   4e-44   Oryza brachyantha
gb|ACN40183.1|  unknown                                                 157   3e-42   Picea sitchensis
gb|ACL53343.1|  unknown                                                 153   5e-41   Zea mays [maize]
gb|EAY72790.1|  hypothetical protein OsI_00654                          157   7e-41   Oryza sativa Indica Group [Indian rice]
ref|NP_001054812.1|  Os05g0181000                                       157   1e-40   
ref|XP_008659628.1|  PREDICTED: heat shock 70 kDa protein 14-like       148   2e-40   
ref|XP_002986462.1|  hypothetical protein SELMODRAFT_124091             154   6e-40   
gb|EAY96776.1|  hypothetical protein OsI_18700                          153   2e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_008659497.1|  PREDICTED: heat shock 70 kDa protein 14-like       150   3e-39   
ref|XP_002978946.1|  hypothetical protein SELMODRAFT_109750             152   5e-39   
ref|XP_001755636.1|  predicted protein                                  148   1e-37   
ref|XP_001760080.1|  predicted protein                                  145   2e-36   
gb|AIL24130.1|  heat shock protein 2                                    136   5e-36   Tamarix hispida
gb|AEA86324.1|  70 kDa heat shock protein                               129   4e-33   Solanum nigrum
gb|EPS62237.1|  hypothetical protein M569_12554                         127   4e-32   Genlisea aurea
ref|XP_001764380.1|  predicted protein                                  132   7e-32   
ref|XP_009372708.1|  PREDICTED: heat shock 70 kDa protein 16-like...    119   3e-27   Pyrus x bretschneideri [bai li]
ref|XP_009372707.1|  PREDICTED: heat shock 70 kDa protein 16-like...    119   4e-27   Pyrus x bretschneideri [bai li]
gb|AEZ00882.1|  putative heat shock protein hsp70                       113   6e-27   Elaeis guineensis
ref|XP_007020850.1|  Heat shock protein 70 family protein               117   1e-26   
ref|XP_009352433.1|  PREDICTED: heat shock 70 kDa protein 16-like       117   2e-26   Pyrus x bretschneideri [bai li]
gb|KDP39123.1|  hypothetical protein JCGZ_00880                         115   4e-26   Jatropha curcas
ref|XP_008348295.1|  PREDICTED: heat shock 70 kDa protein 15-like       110   1e-25   
ref|XP_007020851.1|  Heat shock protein 70 family protein               114   2e-25   
emb|CBI26631.3|  unnamed protein product                                110   5e-25   Vitis vinifera
ref|XP_010278704.1|  PREDICTED: heat shock 70 kDa protein 16            111   1e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010092150.1|  Heat shock 70 kDa protein 16                       110   3e-24   
ref|XP_002522946.1|  Heat-shock protein 105 kDa, putative               109   4e-24   
ref|XP_002278262.1|  PREDICTED: heat shock 70 kDa protein 16            109   7e-24   Vitis vinifera
ref|XP_008226915.1|  PREDICTED: heat shock 70 kDa protein 16            109   8e-24   Prunus mume [ume]
ref|XP_010931798.1|  PREDICTED: heat shock 70 kDa protein 16            108   1e-23   Elaeis guineensis
ref|XP_002317001.1|  hypothetical protein POPTR_0011s14240g             108   2e-23   Populus trichocarpa [western balsam poplar]
emb|CAN63915.1|  hypothetical protein VITISV_004852                     107   2e-23   Vitis vinifera
ref|XP_004294376.1|  PREDICTED: heat shock 70 kDa protein 16            107   2e-23   Fragaria vesca subsp. vesca
ref|XP_007213641.1|  hypothetical protein PRUPE_ppa001697mg             106   6e-23   Prunus persica
ref|XP_008365284.1|  PREDICTED: heat shock 70 kDa protein 16            106   7e-23   
gb|KHG25442.1|  Heat shock 70 kDa 16 -like protein                      105   1e-22   Gossypium arboreum [tree cotton]
gb|KJB22068.1|  hypothetical protein B456_004G027900                    105   1e-22   Gossypium raimondii
ref|XP_011030786.1|  PREDICTED: heat shock 70 kDa protein 16-like...    105   2e-22   Populus euphratica
gb|KHM99573.1|  Heat shock 70 kDa protein 16                            105   2e-22   Glycine soja [wild soybean]
ref|XP_003532123.1|  PREDICTED: heat shock 70 kDa protein 16-like       105   2e-22   Glycine max [soybeans]
gb|AII99889.1|  heat shock protein                                      104   4e-22   Cicer arietinum [garbanzo]
ref|XP_004491392.1|  PREDICTED: heat shock 70 kDa protein 16-like       103   5e-22   Cicer arietinum [garbanzo]
ref|XP_007146461.1|  hypothetical protein PHAVU_006G042400g             103   6e-22   Phaseolus vulgaris [French bean]
ref|XP_009420545.1|  PREDICTED: heat shock 70 kDa protein 16            103   8e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009352450.1|  PREDICTED: heat shock 70 kDa protein 16-like       103   9e-22   Pyrus x bretschneideri [bai li]
ref|XP_007024113.1|  Heat shock protein 91 isoform 2                    101   2e-21   
ref|XP_003553093.1|  PREDICTED: heat shock 70 kDa protein 16-like       102   2e-21   Glycine max [soybeans]
ref|XP_011030785.1|  PREDICTED: heat shock 70 kDa protein 16-like...    102   2e-21   Populus euphratica
ref|XP_006475182.1|  PREDICTED: heat shock 70 kDa protein 16-like...    101   3e-21   
gb|KJB22069.1|  hypothetical protein B456_004G027900                    101   3e-21   Gossypium raimondii
emb|CDP04389.1|  unnamed protein product                                102   3e-21   Coffea canephora [robusta coffee]
ref|XP_006452327.1|  hypothetical protein CICLE_v10007538mg             101   3e-21   Citrus clementina [clementine]
ref|XP_004966217.1|  PREDICTED: heat shock 70 kDa protein 16-like       101   3e-21   
gb|KHN45217.1|  Heat shock 70 kDa protein 16                            101   4e-21   Glycine soja [wild soybean]
ref|XP_008806738.1|  PREDICTED: heat shock 70 kDa protein 16 isof...    101   4e-21   Phoenix dactylifera
ref|XP_003563414.2|  PREDICTED: heat shock 70 kDa protein 16            100   5e-21   Brachypodium distachyon [annual false brome]
gb|KJB35057.1|  hypothetical protein B456_006G098500                    100   6e-21   Gossypium raimondii
gb|AFA36608.1|  70 kDa heat shock protein                             96.7    1e-20   Lolium perenne [perennial ryegrass]
ref|XP_008366399.1|  PREDICTED: heat shock 70 kDa protein 16-like     99.8    2e-20   
ref|XP_008806739.1|  PREDICTED: heat shock 70 kDa protein 16 isof...  99.4    2e-20   Phoenix dactylifera
ref|XP_006595737.1|  PREDICTED: heat shock 70 kDa protein 16-like...  98.6    4e-20   Glycine max [soybeans]
ref|XP_004167874.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...  98.2    5e-20   
ref|XP_004151979.1|  PREDICTED: heat shock 70 kDa protein 16-like     98.2    5e-20   Cucumis sativus [cucumbers]
ref|XP_008465078.1|  PREDICTED: heat shock 70 kDa protein 16          97.8    6e-20   Cucumis melo [Oriental melon]
ref|XP_002973871.1|  hypothetical protein SELMODRAFT_267697           97.8    7e-20   
ref|XP_006657253.1|  PREDICTED: heat shock 70 kDa protein 16-like     97.4    9e-20   Oryza brachyantha
ref|XP_009614255.1|  PREDICTED: heat shock 70 kDa protein 16          97.4    1e-19   Nicotiana tomentosiformis
ref|XP_009760615.1|  PREDICTED: heat shock 70 kDa protein 16          96.7    2e-19   Nicotiana sylvestris
gb|AET00484.2|  heat shock 70 kDa protein                             96.3    2e-19   Medicago truncatula
ref|XP_008648938.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...  95.9    3e-19   
dbj|BAD45483.1|  putative heat-shock protein                          95.5    4e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EYU27799.1|  hypothetical protein MIMGU_mgv1a001740mg              94.7    7e-19   Erythranthe guttata [common monkey flower]
gb|EYU27798.1|  hypothetical protein MIMGU_mgv1a001740mg              94.4    9e-19   Erythranthe guttata [common monkey flower]
ref|XP_007142281.1|  hypothetical protein PHAVU_008G267400g           93.6    1e-18   Phaseolus vulgaris [French bean]
ref|XP_006348107.1|  PREDICTED: heat shock 70 kDa protein 16-like...  94.0    1e-18   Solanum tuberosum [potatoes]
ref|XP_008385666.1|  PREDICTED: heat shock 70 kDa protein 16-like     90.1    2e-18   
ref|XP_002969191.1|  hypothetical protein SELMODRAFT_440676           93.6    2e-18   
ref|XP_007142282.1|  hypothetical protein PHAVU_008G267400g           93.2    3e-18   Phaseolus vulgaris [French bean]
gb|KCW67009.1|  hypothetical protein EUGRSUZ_F00767                   92.4    5e-18   Eucalyptus grandis [rose gum]
gb|KCW67010.1|  hypothetical protein EUGRSUZ_F00767                   92.4    5e-18   Eucalyptus grandis [rose gum]
ref|XP_010060358.1|  PREDICTED: heat shock 70 kDa protein 16          92.4    5e-18   Eucalyptus grandis [rose gum]
ref|XP_006417329.1|  hypothetical protein EUTSA_v10006883mg           92.0    7e-18   Eutrema salsugineum [saltwater cress]
ref|XP_004500055.1|  PREDICTED: heat shock 70 kDa protein 16-like     91.7    8e-18   Cicer arietinum [garbanzo]
ref|XP_003600064.1|  Heat shock 70 kDa protein 4L                     91.7    8e-18   Medicago truncatula
ref|XP_010533816.1|  PREDICTED: heat shock 70 kDa protein 16          91.7    8e-18   Tarenaya hassleriana [spider flower]
gb|AFW68969.1|  hypothetical protein ZEAMMB73_497308                  92.0    8e-18   
gb|AII99893.1|  heat shock protein                                    91.3    1e-17   Cicer arietinum [garbanzo]
ref|XP_003617525.1|  97 kDa heat shock protein                        91.3    1e-17   
dbj|BAK01312.1|  predicted protein                                    90.9    1e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU24689.1|  hypothetical protein MIMGU_mgv1a001324mg              90.5    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_004232717.1|  PREDICTED: heat shock 70 kDa protein 16          90.9    2e-17   Solanum lycopersicum
ref|XP_002305580.2|  hypothetical protein POPTR_0004s01640g           90.1    3e-17   
emb|CDY49794.1|  BnaCnng18070D                                        87.8    2e-16   Brassica napus [oilseed rape]
ref|XP_006858198.1|  hypothetical protein AMTR_s00062p00172210        84.3    2e-16   
ref|XP_011096072.1|  PREDICTED: heat shock 70 kDa protein 16          86.3    6e-16   Sesamum indicum [beniseed]
emb|CEF99759.1|  Heat shock protein 70 family                         85.9    1e-15   Ostreococcus tauri
gb|EAZ02096.1|  hypothetical protein OsI_24183                        82.4    1e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_006468028.1|  PREDICTED: heat shock 70 kDa protein 16-like     85.1    2e-15   Citrus sinensis [apfelsine]
gb|KDO75458.1|  hypothetical protein CISIN_1g004211mg                 84.7    2e-15   Citrus sinensis [apfelsine]
gb|EPS74057.1|  hypothetical protein M569_00693                       84.7    2e-15   Genlisea aurea
ref|XP_010665569.1|  PREDICTED: heat shock 70 kDa protein 16          84.0    3e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010476099.1|  PREDICTED: heat shock 70 kDa protein 16          84.0    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_006449031.1|  hypothetical protein CICLE_v10014383mg           83.2    6e-15   
ref|XP_008644888.1|  PREDICTED: heat shock 70 kDa protein 16 isof...  83.2    7e-15   Zea mays [maize]
ref|XP_006449032.1|  hypothetical protein CICLE_v10014383mg           82.8    7e-15   
ref|XP_010458573.1|  PREDICTED: heat shock 70 kDa protein 16-like     82.8    8e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002889885.1|  hypothetical protein ARALYDRAFT_888478           81.6    2e-14   
ref|XP_010493114.1|  PREDICTED: heat shock 70 kDa protein 16-like     81.6    2e-14   Camelina sativa [gold-of-pleasure]
gb|AFW81561.1|  hypothetical protein ZEAMMB73_352123                  80.9    3e-14   
ref|XP_006306833.1|  hypothetical protein CARUB_v10008380mg           80.9    4e-14   
ref|XP_006306834.1|  hypothetical protein CARUB_v10008380mg           80.9    4e-14   Capsella rubella
gb|KJB69295.1|  hypothetical protein B456_011G014900                  80.9    4e-14   Gossypium raimondii
ref|XP_011037663.1|  PREDICTED: heat shock 70 kDa protein 16          79.0    2e-13   Populus euphratica
ref|XP_002505210.1|  heat shock protein 70                            79.0    2e-13   Micromonas commoda
ref|XP_008354138.1|  PREDICTED: heat shock 70 kDa protein 15-like     77.8    3e-13   
ref|XP_006389708.1|  hypothetical protein EUTSA_v100181451mg          77.0    6e-13   
gb|AFW75994.1|  hypothetical protein ZEAMMB73_975582                  70.9    8e-12   
ref|XP_002401154.1|  heat shock protein, putative                     73.6    1e-11   Ixodes scapularis [blacklegged tick]
ref|XP_006389709.1|  hypothetical protein EUTSA_v100181450mg          70.1    1e-11   
ref|XP_008644889.1|  PREDICTED: heat shock 70 kDa protein 16 isof...  72.8    2e-11   Zea mays [maize]
ref|XP_006595736.1|  PREDICTED: heat shock 70 kDa protein 16-like...  72.0    3e-11   Glycine max [soybeans]
ref|XP_009843226.1|  hypothetical protein H257_16484                  71.6    4e-11   Aphanomyces astaci
ref|XP_009525813.1|  hypothetical protein PHYSODRAFT_247517           71.6    4e-11   Phytophthora sojae
ref|XP_008916022.1|  hypothetical protein PPTG_19375                  70.9    7e-11   Phytophthora parasitica INRA-310
ref|XP_008869434.1|  hypothetical protein H310_06229                  70.5    1e-10   Aphanomyces invadans
gb|KDO26758.1|  hypothetical protein SPRG_08060                       70.1    1e-10   Saprolegnia parasitica CBS 223.65
gb|AGW24476.1|  heat shock 70 kDa protein 15                          64.3    2e-10   Avicennia marina subsp. marina
emb|CCI46709.1|  unnamed protein product                              69.7    2e-10   Albugo candida
gb|AGW24482.1|  heat shock 70 kDa protein 14                          64.3    2e-10   Avicennia marina subsp. marina
ref|XP_003082170.1|  heat shock protein 91-Arabidopsis thaliana (...  69.7    2e-10   
ref|XP_003060408.1|  heat shock protein 70                            69.3    3e-10   Micromonas pusilla CCMP1545
gb|KIO09433.1|  hypothetical protein M404DRAFT_14053                  67.8    8e-10   Pisolithus tinctorius Marx 270
ref|XP_009547862.1|  hypothetical protein HETIRDRAFT_385937           67.4    9e-10   Heterobasidion irregulare TC 32-1
ref|XP_008607119.1|  hypothetical protein SDRG_03266                  67.4    1e-09   Saprolegnia diclina VS20
ref|XP_007372709.1|  heat shock protein of HSP70 family               67.0    1e-09   Spathaspora passalidarum NRRL Y-27907
emb|CCA15913.1|  Heat shock protein 70 putative                       67.0    1e-09   Albugo laibachii Nc14
ref|XP_007508733.1|  predicted protein                                67.0    1e-09   Bathycoccus prasinos
ref|XP_004076160.1|  PREDICTED: heat shock 70 kDa protein 4-like      66.6    2e-09   
ref|XP_001387826.1|  heat shock protein of HSP70 family               65.9    3e-09   Scheffersomyces stipitis CBS 6054
ref|XP_004358355.1|  heat shock protein Hsp70 family protein          65.9    3e-09   Cavenderia fasciculata
emb|CDX97975.1|  BnaA06g07260D                                        65.5    4e-09   
ref|XP_009148495.1|  PREDICTED: heat shock 70 kDa protein 16          65.5    4e-09   Brassica rapa
ref|XP_006811344.1|  PREDICTED: LOW QUALITY PROTEIN: 97 kDa heat ...  65.1    6e-09   Saccoglossus kowalevskii
ref|XP_002949519.1|  heat shock protein Hsp70E                        64.7    7e-09   Volvox carteri f. nagariensis
ref|XP_005317131.1|  PREDICTED: heat shock protein 105 kDa isofor...  64.7    7e-09   
ref|XP_005846866.1|  hypothetical protein CHLNCDRAFT_35731            64.7    7e-09   Chlorella variabilis
ref|XP_001909234.1|  hypothetical protein                             64.7    8e-09   Podospora anserina S mat+
gb|KFY09932.1|  hypothetical protein V492_05284                       64.7    8e-09   Pseudogymnoascus sp. VKM F-4246
ref|XP_005317129.1|  PREDICTED: heat shock protein 105 kDa isofor...  64.7    9e-09   Ictidomys tridecemlineatus
ref|XP_009564490.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  64.3    9e-09   Cuculus canorus
ref|XP_002119191.1|  PREDICTED: heat shock 70 kDa protein 4L          64.3    1e-08   Ciona intestinalis [sea vase]
gb|KFX90689.1|  hypothetical protein V490_06333                       63.9    1e-08   
gb|KFY09746.1|  hypothetical protein V491_07994                       63.9    1e-08   
gb|AJP85228.1|  Sse2p                                                 63.9    1e-08   
gb|EIF48037.1|  heat shock protein hsp88                              63.9    1e-08   
ref|NP_989252.1|  heat shock 70kDa protein 4                          63.9    1e-08   
ref|NP_172631.2|  heat shock protein 70 (Hsp 70) family protein       63.9    1e-08   
gb|AJP83310.1|  Sse2p                                                 63.9    1e-08   
ref|XP_007522471.1|  PREDICTED: heat shock protein 105 kDa isofor...  63.9    1e-08   
gb|KIK24778.1|  hypothetical protein PISMIDRAFT_29057                 63.9    1e-08   
gb|AJQ09735.1|  Sse2p                                                 63.9    1e-08   
gb|AJQ12016.1|  Sse2p                                                 63.9    1e-08   
gb|AJQ00169.1|  Sse2p                                                 63.9    1e-08   
ref|NP_009728.1|  adenyl-nucleotide exchange factor SSE2              63.9    1e-08   
gb|AJP88253.1|  Sse2p                                                 63.9    1e-08   
gb|AJP85603.1|  Sse2p                                                 63.9    1e-08   
gb|AJP82141.1|  Sse2p                                                 63.9    1e-08   
gb|EGA83979.1|  Sse2p                                                 63.9    1e-08   
gb|EEU05536.1|  Sse2p                                                 63.9    1e-08   
gb|AJQ08191.1|  Sse2p                                                 63.9    1e-08   
gb|AJP90103.1|  Sse2p                                                 63.9    1e-08   
gb|AJQ09353.1|  Sse2p                                                 63.9    1e-08   
gb|EHN08372.1|  Sse2p                                                 63.9    1e-08   
gb|EKC98889.1|  heat shock protein                                    63.9    1e-08   
gb|AJQ00553.1|  Sse2p                                                 63.9    1e-08   
gb|AJP95925.1|  Sse2p                                                 63.9    1e-08   
gb|EGA87918.1|  Sse2p                                                 63.9    1e-08   
gb|EDN64781.1|  conserved protein                                     63.9    1e-08   
emb|CAA51027.1|  HSP                                                  63.9    1e-08   
gb|EDZ73721.1|  YBR169Cp-like protein                                 63.5    1e-08   
gb|AJP87129.1|  Sse2p                                                 63.9    1e-08   
gb|EJT52956.1|  heat shock protein                                    63.9    1e-08   
gb|AJQ08967.1|  Sse2p                                                 63.5    1e-08   
emb|CCG83006.1|  Heat shock protein Hsp88                             63.5    1e-08   
gb|AJQ13168.1|  Sse2p                                                 63.5    1e-08   
gb|AJP97078.1|  Sse2p                                                 63.5    1e-08   
gb|EGA59718.1|  Sse2p                                                 63.5    2e-08   
dbj|GAA21715.1|  K7_Sse2p                                             63.5    2e-08   
ref|XP_004774860.1|  PREDICTED: heat shock protein 105 kDa isofor...  63.9    2e-08   
gb|KFY75265.1|  hypothetical protein V499_04726                       63.5    2e-08   
ref|XP_007522466.1|  PREDICTED: heat shock protein 105 kDa isofor...  63.5    2e-08   
ref|XP_007522468.1|  PREDICTED: heat shock protein 105 kDa isofor...  63.5    2e-08   
gb|KFZ05416.1|  hypothetical protein V501_08384                       63.5    2e-08   
ref|XP_001597692.1|  hypothetical protein SS1G_01888                  63.5    2e-08   
gb|KFY00255.1|  hypothetical protein O988_03412                       63.5    2e-08   
gb|KIY53620.1|  heat shock protein 70                                 63.5    2e-08   
ref|XP_010196950.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  63.2    2e-08   
ref|XP_003913779.1|  PREDICTED: heat shock protein 105 kDa isofor...  63.5    2e-08   
ref|XP_008590210.1|  PREDICTED: heat shock protein 105 kDa            63.5    2e-08   
gb|KFY52733.1|  hypothetical protein V496_08224                       63.2    2e-08   
ref|XP_003390556.1|  PREDICTED: heat shock 70 kDa protein 4-like      63.2    2e-08   
ref|XP_010007215.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  63.2    2e-08   
ref|XP_002800758.1|  PREDICTED: heat shock protein 105 kDa-like i...  63.2    2e-08   
ref|XP_007958257.1|  PREDICTED: heat shock protein 105 kDa isofor...  63.2    2e-08   
ref|XP_005585648.1|  PREDICTED: heat shock protein 105 kDa isofor...  63.2    2e-08   
ref|XP_568283.1|  heat shock protein                                  63.2    2e-08   
ref|XP_007958255.1|  PREDICTED: heat shock protein 105 kDa isofor...  63.2    3e-08   
gb|EHH58512.1|  hypothetical protein EGM_08381                        63.2    3e-08   
ref|XP_002800757.1|  PREDICTED: heat shock protein 105 kDa-like i...  63.2    3e-08   
gb|KFY90142.1|  hypothetical protein V500_05280                       62.8    3e-08   
ref|XP_002800756.1|  PREDICTED: heat shock protein 105 kDa-like i...  63.2    3e-08   
gb|EHH28932.1|  hypothetical protein EGK_09220                        63.2    3e-08   
ref|XP_007767273.1|  HSP70-domain-containing protein                  62.8    3e-08   
gb|KFZ07767.1|  hypothetical protein V502_09755                       62.8    3e-08   
dbj|BAG63634.1|  unnamed protein product                              62.4    3e-08   
gb|KFP57786.1|  Heat shock 70 kDa protein 4                           62.4    4e-08   
gb|ESZ98678.1|  putative Heat shock protein Hsp88                     62.4    4e-08   
gb|KHE85341.1|  heat shock protein 70                                 62.4    4e-08   
ref|XP_006719820.1|  PREDICTED: heat shock protein 105 kDa isofor...  62.8    4e-08   
ref|XP_001695858.1|  heat shock protein 70E                           62.4    4e-08   
ref|XP_009850105.1|  hypothetical protein NEUTE1DRAFT_100057          62.4    4e-08   
gb|EJW79681.1|  hypothetical protein WUBG_09411                       62.4    4e-08   
ref|XP_009696800.1|  PREDICTED: heat shock 70 kDa protein 4           62.4    4e-08   
dbj|BAG57329.1|  unnamed protein product                              62.4    4e-08   
ref|XP_009647629.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  62.4    4e-08   
ref|XP_011394150.1|  heat shock protein 88                            62.4    4e-08   
gb|EAX08482.1|  heat shock 105kDa/110kDa protein 1, isoform CRA_d     62.4    4e-08   
ref|XP_009015511.1|  hypothetical protein HELRODRAFT_106017           62.4    4e-08   
ref|XP_009467012.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  62.4    4e-08   
ref|XP_004054390.1|  PREDICTED: heat shock protein 105 kDa isoform 4  62.4    4e-08   
gb|AJQ15847.1|  Sse2p                                                 62.4    4e-08   
ref|NP_001273434.1|  heat shock protein 105 kDa isoform 4             62.4    4e-08   
ref|XP_008950457.1|  PREDICTED: heat shock protein 105 kDa isofor...  62.4    4e-08   
ref|XP_009220161.1|  hsp88-like protein                               62.4    4e-08   
gb|AAC18044.1|  antigen NY-CO-25                                      62.4    4e-08   
ref|NP_006635.2|  heat shock protein 105 kDa isoform 1                62.4    4e-08   
ref|NP_001273433.1|  heat shock protein 105 kDa isoform 3             62.4    4e-08   
ref|NP_001126639.1|  heat shock protein 105 kDa                       62.4    5e-08   
gb|KFY42344.1|  hypothetical protein V494_02471                       62.0    5e-08   
dbj|BAA13192.2|  KIAA0201                                             62.4    5e-08   
ref|XP_004406698.1|  PREDICTED: heat shock protein 105 kDa isoform 3  62.0    5e-08   
ref|XP_004054389.1|  PREDICTED: heat shock protein 105 kDa isoform 3  62.0    5e-08   
gb|KIJ60075.1|  hypothetical protein HYDPIDRAFT_32650                 62.0    5e-08   
ref|XP_004406696.1|  PREDICTED: heat shock protein 105 kDa isoform 1  62.0    5e-08   
ref|XP_009699266.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  62.0    5e-08   
ref|XP_005302898.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...  62.0    5e-08   
ref|XP_005302899.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...  62.0    6e-08   
ref|XP_009579841.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  62.0    6e-08   
ref|XP_006158496.1|  PREDICTED: heat shock protein 105 kDa            61.6    6e-08   
ref|XP_010283664.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  61.6    7e-08   
ref|XP_010075291.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  61.6    7e-08   
ref|XP_010308330.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  61.6    7e-08   
gb|ELR04442.1|  hypothetical protein GMDG_06755                       61.6    7e-08   
emb|CCK68023.1|  hypothetical protein KNAG_0A03400                    61.6    7e-08   
gb|KFW08265.1|  Heat shock 70 kDa protein 4L                          61.6    7e-08   
ref|XP_007918647.1|  putative heat shock protein                      61.6    7e-08   
ref|XP_008823260.1|  PREDICTED: heat shock protein 105 kDa            61.6    7e-08   
gb|ELU42477.1|  heat shock protein Hsp88                              61.6    7e-08   
ref|XP_004577610.1|  PREDICTED: heat shock protein 105 kDa isofor...  61.6    8e-08   
ref|XP_011052837.1|  PREDICTED: 97 kDa heat shock protein isoform X2  61.6    8e-08   
ref|XP_004577609.1|  PREDICTED: heat shock protein 105 kDa isofor...  61.6    8e-08   
ref|XP_001493567.1|  PREDICTED: heat shock protein 105 kDa isoform 1  61.6    8e-08   
sp|Q94738.1|HSP97_STRFN  RecName: Full=97 kDa heat shock protein;...  61.6    8e-08   
gb|EOB04289.1|  Heat shock 70 kDa protein 4L                          61.2    8e-08   
ref|XP_008053199.1|  PREDICTED: heat shock protein 105 kDa            61.2    8e-08   
ref|XP_004577611.1|  PREDICTED: heat shock protein 105 kDa isofor...  61.2    9e-08   
gb|KIR84812.1|  heat shock 70kDa protein 4                            61.2    9e-08   
gb|KIM69590.1|  hypothetical protein SCLCIDRAFT_1208046               61.2    9e-08   
dbj|BAD32191.1|  mKIAA0201 protein                                    61.2    9e-08   
ref|XP_001551499.1|  hypothetical protein BC1G_09769                  61.2    9e-08   
ref|XP_009894254.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  61.2    9e-08   
ref|XP_005015634.1|  PREDICTED: heat shock 70 kDa protein 4L          61.2    9e-08   
ref|XP_008493678.1|  PREDICTED: heat shock 70 kDa protein 4           61.2    9e-08   
ref|XP_001896095.1|  Hypothetical 86.9 kDa protein C30C11.4 in ch...  61.2    9e-08   
gb|KIJ23624.1|  hypothetical protein M422DRAFT_39529                  61.2    1e-07   
ref|XP_010365374.1|  PREDICTED: heat shock protein 105 kDa isofor...  61.2    1e-07   
emb|CEF74161.1|  unnamed protein product                              61.2    1e-07   
gb|KFP02118.1|  Heat shock 70 kDa protein 4                           61.2    1e-07   
ref|XP_009579843.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  61.2    1e-07   
ref|XP_006504978.1|  PREDICTED: heat shock protein 105 kDa isofor...  61.2    1e-07   
ref|XP_009889730.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  61.2    1e-07   
ref|XP_006504979.1|  PREDICTED: heat shock protein 105 kDa isofor...  61.2    1e-07   
gb|KIK41598.1|  hypothetical protein CY34DRAFT_85147                  61.2    1e-07   
ref|XP_010365375.1|  PREDICTED: heat shock protein 105 kDa isofor...  61.2    1e-07   
ref|XP_009260564.1|  hypothetical protein FPSE_09172                  61.2    1e-07   
ref|XP_010365378.1|  PREDICTED: heat shock protein 105 kDa isofor...  61.2    1e-07   
ref|XP_003197358.1|  heat shock protein                               61.2    1e-07   
gb|EDL05869.1|  heat shock protein 110, isoform CRA_a                 61.2    1e-07   
ref|NP_038587.2|  heat shock protein 105 kDa                          61.2    1e-07   
ref|XP_011317805.1|  heat shock protein Hsp88                         60.8    1e-07   
dbj|BAC38797.1|  unnamed protein product                              61.2    1e-07   
ref|XP_002748998.1|  PREDICTED: heat shock protein 105 kDa isofor...  61.2    1e-07   
gb|AJP83697.1|  Sse2p                                                 60.8    1e-07   
dbj|BAE38016.1|  unnamed protein product                              60.8    1e-07   
ref|XP_004321099.1|  PREDICTED: heat shock protein 105 kDa-like i...  60.8    1e-07   
gb|EQB53240.1|  hsp70-like protein                                    60.8    1e-07   
gb|KFP11552.1|  Heat shock 70 kDa protein 4L                          60.8    1e-07   
ref|XP_009647627.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  60.8    1e-07   
ref|XP_007941940.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...  60.8    1e-07   
ref|XP_010147843.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  60.8    1e-07   
ref|XP_007286267.1|  heat shock protein hsp88                         60.8    1e-07   
gb|KFV92449.1|  Heat shock 70 kDa protein 4L                          60.8    1e-07   
ref|XP_010332582.1|  PREDICTED: heat shock protein 105 kDa            60.8    1e-07   
gb|KIN08233.1|  hypothetical protein OIDMADRAFT_109190                60.5    1e-07   
emb|CDK29785.1|  unnamed protein product                              60.5    1e-07   
emb|CCO27038.1|  Heat shock protein homolog pss1                      60.5    1e-07   
emb|CEL61000.1|  Heat shock protein homolog pss1 OS=Schizosacchar...  60.5    2e-07   
ref|XP_007063691.1|  PREDICTED: heat shock 70 kDa protein 4           60.5    2e-07   
gb|KFP87183.1|  Heat shock 70 kDa protein 4                           60.5    2e-07   
ref|XP_459172.1|  DEHA2D15840p                                        60.5    2e-07   
gb|EHN03613.1|  Sse2p                                                 60.5    2e-07   
ref|XP_010086248.1|  PREDICTED: heat shock 70 kDa protein 4           60.5    2e-07   
gb|KIR45830.1|  heat shock 70kDa protein 4                            60.5    2e-07   
ref|XP_004178791.1|  hypothetical protein TBLA_0B04350                60.5    2e-07   
gb|KGB79074.1|  heat shock protein Hsp70                              60.5    2e-07   
gb|EMP32246.1|  Heat shock 70 kDa protein 4                           60.5    2e-07   
gb|KFU97482.1|  Heat shock 70 kDa protein 4                           60.5    2e-07   
gb|EMD33816.1|  hypothetical protein CERSUDRAFT_142155                60.5    2e-07   
ref|XP_008944895.1|  PREDICTED: heat shock 70 kDa protein 4L          60.5    2e-07   
ref|XP_004420257.1|  PREDICTED: heat shock 70 kDa protein 4           60.5    2e-07   
gb|AJQ01324.1|  Sse2p                                                 60.5    2e-07   
ref|XP_002914798.1|  PREDICTED: heat shock protein 105 kDa isofor...  60.5    2e-07   
ref|XP_007294557.1|  hsp70-like protein                               60.5    2e-07   
gb|KFO84045.1|  Heat shock 70 kDa protein 4                           60.5    2e-07   
gb|KFM01823.1|  Heat shock 70 kDa protein 4L                          60.5    2e-07   
gb|KIR38796.1|  heat shock 70kDa protein 4                            60.1    2e-07   
ref|XP_009287772.1|  PREDICTED: heat shock 70 kDa protein 4L          60.1    2e-07   
ref|XP_010141782.1|  PREDICTED: heat shock 70 kDa protein 4           60.1    2e-07   
ref|XP_005440738.1|  PREDICTED: heat shock 70 kDa protein 4           60.1    2e-07   
gb|KIR27960.1|  heat shock 70kDa protein 4                            60.1    2e-07   
ref|XP_003687104.1|  hypothetical protein TPHA_0I01660                60.1    2e-07   
gb|KFY28867.1|  hypothetical protein V493_02718                       60.1    2e-07   
ref|XP_010075288.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  60.1    2e-07   
ref|XP_009564489.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  60.1    2e-07   
gb|KFQ96406.1|  Heat shock 70 kDa protein 4                           60.1    2e-07   
gb|KFP08093.1|  Heat shock 70 kDa protein 4L                          60.1    2e-07   
ref|XP_010127319.1|  PREDICTED: heat shock 70 kDa protein 4L          60.1    2e-07   
ref|XP_009462626.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...  60.1    2e-07   
ref|XP_002618557.1|  hypothetical protein CLUG_02016                  60.1    2e-07   
ref|XP_010196949.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  60.1    2e-07   
ref|XP_003639920.2|  PREDICTED: heat shock protein 105 kDa            60.1    2e-07   
gb|KFV09881.1|  Heat shock 70 kDa protein 4L                          60.1    2e-07   
gb|KFP46148.1|  Heat shock 70 kDa protein 4                           60.1    2e-07   
ref|XP_010147845.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  60.1    2e-07   
ref|XP_010007214.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  60.1    2e-07   
gb|KFU86140.1|  Heat shock 70 kDa protein 4L                          60.1    3e-07   
ref|XP_001487209.1|  hypothetical protein PGUG_00586                  57.0    3e-07   
emb|CCU97864.1|  allergen                                             60.1    3e-07   
emb|CAD20981.3|  putative heat shock protein                          60.1    3e-07   
ref|XP_003679077.1|  hypothetical protein TDEL_0A05340                59.7    3e-07   
gb|AFR98435.1|  heat shock 70kDa protein 4                            59.7    3e-07   
ref|XP_004406697.1|  PREDICTED: heat shock protein 105 kDa isoform 2  59.7    3e-07   
gb|KFP38582.1|  Heat shock 70 kDa protein 4L                          59.7    3e-07   
gb|EFX05607.1|  heat shock protein hsp88                              59.7    3e-07   
ref|XP_004604597.1|  PREDICTED: heat shock protein 105 kDa isofor...  59.7    3e-07   
ref|XP_006747419.1|  PREDICTED: heat shock protein 105 kDa-like       59.7    3e-07   
ref|XP_002720618.1|  PREDICTED: heat shock protein 105 kDa isofor...  59.7    3e-07   
ref|XP_008271749.1|  PREDICTED: heat shock protein 105 kDa isofor...  59.7    3e-07   
ref|XP_009467011.1|  PREDICTED: heat shock 70 kDa protein 4L isof...  59.7    3e-07   
gb|ELW48351.1|  Heat shock protein 105 kDa                            59.7    3e-07   
gb|KFR01038.1|  Heat shock 70 kDa protein 4L                          59.7    3e-07   
ref|XP_006629695.1|  PREDICTED: heat shock 70 kDa protein 4L-like...  59.7    3e-07   
ref|XP_004285543.1|  PREDICTED: heat shock protein 105 kDa isoform 2  59.7    3e-07   
ref|XP_006831986.1|  PREDICTED: heat shock protein 105 kDa isofor...  59.7    3e-07   
ref|XP_011102560.1|  sse2p                                            59.3    4e-07   
ref|XP_006927258.1|  PREDICTED: heat shock protein 105 kDa            59.3    4e-07   
gb|KFW94373.1|  Heat shock 70 kDa protein 4L                          59.3    4e-07   
ref|XP_006263488.1|  PREDICTED: heat shock 70 kDa protein 4L          59.3    4e-07   
ref|XP_007258636.1|  PREDICTED: heat shock 70 kDa protein 4-like      59.3    4e-07   
gb|KIP06106.1|  hypothetical protein PHLGIDRAFT_128463                59.3    4e-07   
ref|XP_005877326.1|  PREDICTED: heat shock protein 105 kDa isofor...  59.3    4e-07   
ref|NP_001083317.1|  heat shock 70kDa protein 4                       59.3    4e-07   



>ref|XP_009794901.1| PREDICTED: heat shock 70 kDa protein 15-like, partial [Nicotiana 
sylvestris]
Length=371

 Score =   239 bits (609),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 176/200 (88%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSV+SATLLEEEEVEVPVVKE +KE  +M
Sbjct  137  KISTYTIGPFQSAKGERAKLKVKVRLNLHGIVSVDSATLLEEEEVEVPVVKEAVKEPAEM  196

Query  182  ETD----DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            ETD    D  P  +SE+DVNMQD K   DAS  EN V ESGDKPV+METDAK EAPKKKV
Sbjct  197  ETDEASGDAAPSTTSESDVNMQDAKGAGDASGAENGVPESGDKPVKMETDAKVEAPKKKV  256

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKT+VPV+E+VYGA++ ADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  257  KKTSVPVTEIVYGAMAAADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSD  316

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KYQEFV+D+E+EQ +AKLQE
Sbjct  317  KYQEFVIDTEREQFMAKLQE  336



>ref|XP_011080863.1| PREDICTED: heat shock 70 kDa protein 14-like [Sesamum indicum]
Length=856

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 173/198 (87%), Gaps = 4/198 (2%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVS+ESATLLEEEE+EVPVV E  KESTKM
Sbjct  461  KISTYTIGPFQSTKGERAKLKVKVRLNLHGIVSIESATLLEEEEIEVPVVNESSKESTKM  520

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkk  349
            ETD++P    P  ++E+DVNMQD K    A+EN V E GDKPVQMETD K EAPKKKVKK
Sbjct  521  ETDEVPADPAPASTTESDVNMQDAKPDGAAAENGVPELGDKPVQMETDGKVEAPKKKVKK  580

Query  350  TNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKY  529
            TNVPVSE+VYG L+ ADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL+DKY
Sbjct  581  TNVPVSEIVYGGLAAADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLHDKY  640

Query  530  QEFVVDSEKEQLIAKLQE  583
             EFV +SE+EQ IA+LQE
Sbjct  641  HEFVKESEREQFIARLQE  658



>ref|XP_009610834.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610835.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610836.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Nicotiana 
tomentosiformis]
Length=856

 Score =   239 bits (609),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 176/200 (88%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSV+SATLLEEEEVEVPVVKE +KE  +M
Sbjct  461  KISTYTIGPFQSAKGERAKLKVKVRLNLHGIVSVDSATLLEEEEVEVPVVKEAVKEPAEM  520

Query  182  ETD----DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            ETD    D  P  +SE+DVNMQD K   DAS  EN V ESGDKPV+METDAK EAPKKKV
Sbjct  521  ETDEASGDAAPSTTSESDVNMQDAKGAGDASVAENDVPESGDKPVKMETDAKVEAPKKKV  580

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKT+VPV+E+VYGA++ ADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  581  KKTSVPVTEIVYGAMAAADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSD  640

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KYQEFV+DSE+EQ +AKLQE
Sbjct  641  KYQEFVIDSEREQFMAKLQE  660



>ref|XP_007217050.1| hypothetical protein PRUPE_ppa001317mg [Prunus persica]
 gb|EMJ18249.1| hypothetical protein PRUPE_ppa001317mg [Prunus persica]
Length=855

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 173/200 (87%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVK RLNLHGIVS++SATLLEEEE+EVPV KEQ KE+ KM
Sbjct  461  KISTYTIGPFQSTKGERAKLKVKARLNLHGIVSIDSATLLEEEEIEVPVTKEQPKEAAKM  520

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkv  343
            ETD+ P    P  ++ETDVNMQD K T+DA  +EN V ESGDKPVQMETD KA+APK+KV
Sbjct  521  ETDEAPSDAAPPSTNETDVNMQDAKATADALDAENGVPESGDKPVQMETDTKADAPKRKV  580

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTN+PV ELVYG + P+DVQKA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  581  KKTNIPVVELVYGGMPPSDVQKAIEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLND  640

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KYQEFV + E+E  IA+LQE
Sbjct  641  KYQEFVTEPEREAFIARLQE  660



>emb|CDO98063.1| unnamed protein product [Coffea canephora]
Length=858

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 174/200 (87%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQ+ KGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPV KE  KE+ KM
Sbjct  461  KISTYTIGPFQATKGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPVTKEPAKETAKM  520

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkv  343
            ETD++P    P  S+ETDVNMQD K  ++A  +EN V +SGDKPVQMETD+KAEAPKKKV
Sbjct  521  ETDEVPSDAAPPSSTETDVNMQDTKGAAEAPGAENGVPDSGDKPVQMETDSKAEAPKKKV  580

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTN+PVSELVYG L+ ADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  581  KKTNIPVSELVYGGLAAADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLND  640

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            +Y EFV+D E+ Q  AKLQE
Sbjct  641  RYHEFVMDPERGQFAAKLQE  660



>ref|XP_010249783.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
 ref|XP_010249784.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
Length=850

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 171/200 (86%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVK+RLNLHGIVSVESATLLEEEEVEVPVVKE LKE+ KM
Sbjct  461  KISTYTIGPFQSAKGERAKLKVKIRLNLHGIVSVESATLLEEEEVEVPVVKEPLKEAAKM  520

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            ETD++P    P  + E DVNMQD K  ++AS  EN   ESGDKPVQMETDAK EAPKKKV
Sbjct  521  ETDEVPSDAAPTGTGENDVNMQDAKDATNASGVENGAPESGDKPVQMETDAKVEAPKKKV  580

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTNVPV+ELVYG + PADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  581  KKTNVPVAELVYGGMVPADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLND  640

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY EFV  SE+E   AKLQE
Sbjct  641  KYHEFVTASEREDFTAKLQE  660



>ref|XP_008228510.1| PREDICTED: heat shock 70 kDa protein 15-like [Prunus mume]
Length=855

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 171/200 (86%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVK RLNLHGIVSV+SATLLEEEE+EVPV KEQ KE  KM
Sbjct  461  KISTYTIGPFQSTKGERAKLKVKARLNLHGIVSVDSATLLEEEEIEVPVTKEQPKEGAKM  520

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            ETD+ P    P  ++ETDVNMQD K T+DAS  EN V ESGDKPVQMETD KA+APK+KV
Sbjct  521  ETDEAPSDAAPPSTNETDVNMQDAKGTADASGAENGVPESGDKPVQMETDTKADAPKRKV  580

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTN+PV ELVYG + P+DVQKA+EKEFEMALQDR+MEETKDKKNAVEAYVYD RNKL D
Sbjct  581  KKTNIPVVELVYGGMPPSDVQKAIEKEFEMALQDRVMEETKDKKNAVEAYVYDTRNKLND  640

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KYQEFV + E+E  IA+LQE
Sbjct  641  KYQEFVTEPEREAFIARLQE  660



>ref|XP_009624163.1| PREDICTED: heat shock 70 kDa protein 15-like [Nicotiana tomentosiformis]
Length=854

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 173/200 (87%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSV+SATLLEEEEVEVPVVKE +KE  KM
Sbjct  461  KISTYTIGPFQSAKGERAKLKVKVRLNLHGIVSVDSATLLEEEEVEVPVVKEAVKEPAKM  520

Query  182  ETD----DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            ETD    D     +SE+DVNMQD K   DAS  EN V E GD+PV+METDAK E PKKKV
Sbjct  521  ETDEASGDAAAPTTSESDVNMQDAKGAGDASGAENGVPEFGDRPVKMETDAKVEVPKKKV  580

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKT++PV+E+VYGA++ ADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  581  KKTSIPVTEIVYGAMAAADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSD  640

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KYQEFV+DSE+EQ IAKLQE
Sbjct  641  KYQEFVIDSEREQFIAKLQE  660



>ref|XP_010254149.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
 ref|XP_010254150.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
 ref|XP_010254151.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
Length=851

 Score =   233 bits (594),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 169/200 (85%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYT+GPFQS KGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPVVKE  KE TKM
Sbjct  461  KISTYTVGPFQSTKGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPVVKEPAKEDTKM  520

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            ETD+ P    P  + E DVNMQD K  +DA   EN V E+GDKP+QMETD K +APKKKV
Sbjct  521  ETDEAPNDAAPAGTVENDVNMQDAKGATDAPGVENGVPETGDKPMQMETDVKVDAPKKKV  580

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTNVPV+ELVYG ++P DVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  581  KKTNVPVAELVYGGMAPIDVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLND  640

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY  FV DSE+E L AKLQE
Sbjct  641  KYHGFVTDSERETLTAKLQE  660



>ref|XP_009801414.1| PREDICTED: heat shock 70 kDa protein 15-like [Nicotiana sylvestris]
Length=846

 Score =   233 bits (593),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 171/199 (86%), Gaps = 9/199 (5%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS K ERAKLKVKVRLNLHGIVSVESATLLEEEEVEVP+VKE+     KM
Sbjct  461  KISTYTIGPFQSTKSERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPIVKEE---PIKM  517

Query  182  ETD----DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            +TD    D  P  ++ETD NMQD K  +DAS  EN V ESGDKPV+M TD KAE PKKKV
Sbjct  518  DTDNFSADAAPSTTAETDENMQDAKGAADASGVENDVPESGDKPVEMATDTKAEVPKKKV  577

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTNVPV+ELVYGAL+ ADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL+D
Sbjct  578  KKTNVPVTELVYGALAAADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLHD  637

Query  524  KYQEFVVDSEKEQLIAKLQ  580
            KYQEFVVDSE+EQ IAKLQ
Sbjct  638  KYQEFVVDSEREQFIAKLQ  656



>emb|CBI36157.3| unnamed protein product [Vitis vinifera]
Length=784

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 168/199 (84%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS K ERAKLKVKVRLNLHGIVSVESATLLEEEEVE+PVVKE  K++TKM
Sbjct  394  KISTYTIGPFQSTKVERAKLKVKVRLNLHGIVSVESATLLEEEEVEIPVVKEPAKDATKM  453

Query  182  ETDDIP-----PQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvk  346
            +TD+ P     P  +SETD NMQD K  +   EN V ESGDK VQMETD K E PKKKVK
Sbjct  454  DTDETPGDAAAPPGTSETDANMQDAKGDAPGVENGVPESGDKSVQMETDTKVEVPKKKVK  513

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTN+PVSELVYG + PADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL+DK
Sbjct  514  KTNIPVSELVYGTMVPADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLHDK  573

Query  527  YQEFVVDSEKEQLIAKLQE  583
            YQ+FV  SE+++  AKLQE
Sbjct  574  YQDFVTSSERDEFTAKLQE  592



>ref|XP_010098045.1| Heat shock 70 kDa protein 15 [Morus notabilis]
 gb|EXB74482.1| Heat shock 70 kDa protein 15 [Morus notabilis]
Length=860

 Score =   231 bits (589),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 169/200 (85%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS K ER+KLKVKVRLNLHGIVSVESATLLEEEEVEVPV KE  KE+ KM
Sbjct  461  KISTYTIGPFQSTKSERSKLKVKVRLNLHGIVSVESATLLEEEEVEVPVTKEAPKEANKM  520

Query  182  ETD----DIPPQDSSETDVNMQDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkv  343
            ETD    D  P  S++ DVNMQD K   DA  +EN V ESGDKPVQMET+ K +APKKKV
Sbjct  521  ETDEASSDATPPSSTDADVNMQDAKGAGDAPAAENGVPESGDKPVQMETEQKPDAPKKKV  580

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTN+PV+ELVYG L+PAD+QKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  581  KKTNIPVTELVYGGLTPADLQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSD  640

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY+EFV  SEKE+  AKLQE
Sbjct  641  KYEEFVTPSEKEEFFAKLQE  660



>ref|XP_009610837.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Nicotiana 
tomentosiformis]
Length=780

 Score =   230 bits (587),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            K+  + IGPFQS KGERAKLKVKVRLNLHGIVSV+SATLLEEEEVEVPVVKE +KE  +M
Sbjct  385  KVREFQIGPFQSAKGERAKLKVKVRLNLHGIVSVDSATLLEEEEVEVPVVKEAVKEPAEM  444

Query  182  ETD----DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            ETD    D  P  +SE+DVNMQD K   DAS  EN V ESGDKPV+METDAK EAPKKKV
Sbjct  445  ETDEASGDAAPSTTSESDVNMQDAKGAGDASVAENDVPESGDKPVKMETDAKVEAPKKKV  504

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKT+VPV+E+VYGA++ ADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  505  KKTSVPVTEIVYGAMAAADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSD  564

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KYQEFV+DSE+EQ +AKLQE
Sbjct  565  KYQEFVIDSEREQFMAKLQE  584



>ref|XP_002279789.2| PREDICTED: heat shock 70 kDa protein 14-like [Vitis vinifera]
 ref|XP_010654673.1| PREDICTED: heat shock 70 kDa protein 14-like [Vitis vinifera]
 ref|XP_010654674.1| PREDICTED: heat shock 70 kDa protein 14-like [Vitis vinifera]
Length=848

 Score =   231 bits (588),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 168/199 (84%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS K ERAKLKVKVRLNLHGIVSVESATLLEEEEVE+PVVKE  K++TKM
Sbjct  458  KISTYTIGPFQSTKVERAKLKVKVRLNLHGIVSVESATLLEEEEVEIPVVKEPAKDATKM  517

Query  182  ETDDIP-----PQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvk  346
            +TD+ P     P  +SETD NMQD K  +   EN V ESGDK VQMETD K E PKKKVK
Sbjct  518  DTDETPGDAAAPPGTSETDANMQDAKGDAPGVENGVPESGDKSVQMETDTKVEVPKKKVK  577

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTN+PVSELVYG + PADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL+DK
Sbjct  578  KTNIPVSELVYGTMVPADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLHDK  637

Query  527  YQEFVVDSEKEQLIAKLQE  583
            YQ+FV  SE+++  AKLQE
Sbjct  638  YQDFVTSSERDEFTAKLQE  656



>ref|XP_002528199.1| Heat shock 70 kDa protein, putative [Ricinus communis]
 gb|EEF34206.1| Heat shock 70 kDa protein, putative [Ricinus communis]
Length=849

 Score =   230 bits (586),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 166/199 (83%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +ISTYTIGPFQS   ERAK+KVK RLNLHGIVSV+SATLLEEEEVEVPV KE  KE+ KM
Sbjct  461  RISTYTIGPFQSSTSERAKVKVKARLNLHGIVSVDSATLLEEEEVEVPVSKEPSKEAAKM  520

Query  182  ETD----DIPPQDSSETDVNMQDDKVT-SDASENHVLESGDKPVQMETDakaeapkkkvk  346
            ETD    D  P +SSE DVNMQD K   +  +EN V ESGDKP QMETD K EAPKKKVK
Sbjct  521  ETDETSTDAAPPNSSEADVNMQDAKTAEASGAENGVPESGDKPAQMETDTKVEAPKKKVK  580

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTN+PV+ELVYG +SPADVQKA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DK
Sbjct  581  KTNIPVAELVYGGMSPADVQKALEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSDK  640

Query  527  YQEFVVDSEKEQLIAKLQE  583
            +QEFV DSE+E   AKLQE
Sbjct  641  FQEFVTDSEREDFTAKLQE  659



>ref|XP_004252333.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum lycopersicum]
Length=846

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 172/200 (86%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRL LHGIVSVESATLLEEEEV+VPVVKE  K   +M
Sbjct  459  KISTYTIGPFQSSKGERAKLKVKVRLTLHGIVSVESATLLEEEEVDVPVVKETAKGPARM  518

Query  182  ETD----DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            ETD    D  P  +SE+DVNM+D K T+ AS  EN V ESGD+PVQME+DAK EAPKK+V
Sbjct  519  ETDEASADAAPSTTSESDVNMEDAKGTAAASGAENGVPESGDEPVQMESDAKVEAPKKRV  578

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKT+VPV+E+VYGA++ ADVQKAVEKEFEMALQDR+MEETKDKKNAVE+YVYDMRNKL D
Sbjct  579  KKTSVPVTEIVYGAMAAADVQKAVEKEFEMALQDRVMEETKDKKNAVESYVYDMRNKLSD  638

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KYQEFV DSE+EQ +A LQE
Sbjct  639  KYQEFVTDSEREQFMAVLQE  658



>ref|XP_007024112.1| Heat shock protein 91 isoform 1 [Theobroma cacao]
 gb|EOY26734.1| Heat shock protein 91 isoform 1 [Theobroma cacao]
Length=860

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 169/200 (85%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPF + + ER KLKVKVRLNLHGIVS+ESATLLEEEEVEVPV KE +KE TKM
Sbjct  459  KISTYTIGPFPTIRSERPKLKVKVRLNLHGIVSLESATLLEEEEVEVPVSKEPVKEDTKM  518

Query  182  ETDDIPPQDSS----ETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            ETD+IP   ++    ETDVNMQD K T+DA   EN V ESGDKPVQMETD K EAPKKKV
Sbjct  519  ETDEIPSDAAAPCANETDVNMQDAKGTADAEGVENGVPESGDKPVQMETDTKVEAPKKKV  578

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTNVPV+ELVYGA+ PADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKL D
Sbjct  579  KKTNVPVAELVYGAMFPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLSD  638

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY +FV   EKE+  AKLQE
Sbjct  639  KYHDFVTAPEKEEFTAKLQE  658



>ref|XP_006346577.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006346578.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X2 [Solanum 
tuberosum]
Length=849

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 173/200 (87%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPVVKE  KE  KM
Sbjct  461  KISTYTIGPFQSTKGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPVVKETAKEPAKM  520

Query  182  ETD----DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            ETD    D  P  +SE+DVNMQD K  + AS  EN V ESGDKPVQMETDAK EAPKKKV
Sbjct  521  ETDEASVDAAPSTTSESDVNMQDAKGAAAASGAENGVPESGDKPVQMETDAKVEAPKKKV  580

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKT+VPV+E+VYGA++ ADVQKAVEKEFEMALQDR+MEETKDKKNAVE+YVYDMRNKL D
Sbjct  581  KKTSVPVTEIVYGAMAAADVQKAVEKEFEMALQDRVMEETKDKKNAVESYVYDMRNKLSD  640

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KYQEFV DSE+EQ +A LQE
Sbjct  641  KYQEFVTDSEREQFMAVLQE  660



>ref|XP_009587742.1| PREDICTED: heat shock 70 kDa protein 15-like [Nicotiana tomentosiformis]
Length=844

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 170/199 (85%), Gaps = 9/199 (5%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS YTIGPFQS KGER+KLKVKVRLNLHGIVSVES TLLEEEEVEVP+VKE+     KM
Sbjct  461  KISAYTIGPFQSNKGERSKLKVKVRLNLHGIVSVESVTLLEEEEVEVPIVKEE---PIKM  517

Query  182  ETD----DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            +TD    D     ++ETD NMQD K  +DAS  EN V ESGDKPV+M TD KAEAPKKKV
Sbjct  518  DTDNASADAAAPTTAETDENMQDAKGAADASGVENGVPESGDKPVEMATDTKAEAPKKKV  577

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTNVPV+ELVYGAL+ ADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL+D
Sbjct  578  KKTNVPVTELVYGALAAADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLHD  637

Query  524  KYQEFVVDSEKEQLIAKLQ  580
            KYQEFVVDSE+EQ IAKLQ
Sbjct  638  KYQEFVVDSEREQFIAKLQ  656



>ref|XP_011072334.1| PREDICTED: heat shock 70 kDa protein 15-like [Sesamum indicum]
 ref|XP_011072335.1| PREDICTED: heat shock 70 kDa protein 15-like [Sesamum indicum]
Length=845

 Score =   227 bits (579),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 168/194 (87%), Gaps = 1/194 (1%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVS+ESATLLEEEEV+VPVVK+  K +TKM
Sbjct  461  KISTYTIGPFQSTKGERAKLKVKVRLNLHGIVSIESATLLEEEEVDVPVVKDSQKNATKM  520

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            ETD+ PP  ++ TD NMQD K     +EN V ESGDK  +M+TD+K EAPKKKVKKTNVP
Sbjct  521  ETDEAPPS-TAGTDENMQDAKNDGAGAENGVPESGDKTSEMDTDSKVEAPKKKVKKTNVP  579

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            VSE+VYG L   DVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL+DKY EFV
Sbjct  580  VSEVVYGGLGATDVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLHDKYHEFV  639

Query  542  VDSEKEQLIAKLQE  583
             +S+++QLI+KLQE
Sbjct  640  TESDRDQLISKLQE  653



>ref|XP_008371663.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=855

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 170/200 (85%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS K ERAKLKVK RLNLHGIVSV+SATLLEEEE+EVPV KEQ KE+ KM
Sbjct  461  KISTYTIGPFQSVKSERAKLKVKARLNLHGIVSVDSATLLEEEEIEVPVTKEQTKEAAKM  520

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkv  343
            ETD+ P    P  + ETDV+MQD K T+DA  +EN V ESG+KPVQMETDAKA+A K KV
Sbjct  521  ETDEAPSDVAPPSTKETDVSMQDAKDTADAPGAENVVPESGEKPVQMETDAKADAKKIKV  580

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            +KTN+PV+ELVYG + P +VQKA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  581  RKTNIPVTELVYGGMPPNEVQKAIEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLND  640

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY EFV +SE+E  IA+LQE
Sbjct  641  KYHEFVTESEREAFIARLQE  660



>ref|XP_004252334.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum lycopersicum]
 ref|XP_010314276.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum lycopersicum]
Length=852

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 173/200 (87%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPVVKE  KE  KM
Sbjct  461  KISTYTIGPFQSMKGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPVVKETAKEPAKM  520

Query  182  ETD----DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            ETD    +  P  ++E+DVNMQD K  + AS  EN V ESGDKPVQMETDAK EAPKKKV
Sbjct  521  ETDESSVNAAPSTTAESDVNMQDAKGAAAASGAENGVPESGDKPVQMETDAKVEAPKKKV  580

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKT+VPV+E+VYGA++ ADVQKAVEKEFEMALQDR+MEETKDKKNAVE+YVYDMRNKL D
Sbjct  581  KKTSVPVTEIVYGAMAAADVQKAVEKEFEMALQDRVMEETKDKKNAVESYVYDMRNKLSD  640

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KYQEFV DSE+EQ +A LQE
Sbjct  641  KYQEFVTDSEREQFMAVLQE  660



>gb|KDO51190.1| hypothetical protein CISIN_1g003056mg [Citrus sinensis]
Length=726

 Score =   223 bits (569),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 168/206 (82%), Gaps = 15/206 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS K ERAK+KVKVRLN+HGIVS+ESATLLEEEEVEVPV KE  KE+ KM
Sbjct  461  KISTYTIGPFQSTKSERAKVKVKVRLNMHGIVSIESATLLEEEEVEVPVTKEPEKEAAKM  520

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDA--------SENHVLESGDKPVQMETDakae  325
            ETD++P    P  SSETDVNMQD K T+DA        +EN V ESGDKP QMET    +
Sbjct  521  ETDEVPSDAAPPSSSETDVNMQDAKGTADAQGTTDAPGAENGVPESGDKPTQMET---DK  577

Query  326  apkkkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDM  505
             PKKKVKKTN+PVSELVYG + P DVQKAVEKEFEMALQDR+MEETKD+KNAVEAYVYDM
Sbjct  578  TPKKKVKKTNIPVSELVYGGMLPVDVQKAVEKEFEMALQDRVMEETKDRKNAVEAYVYDM  637

Query  506  RNKLYDKYQEFVVDSEKEQLIAKLQE  583
            RNKL DKYQ+FV DSE+E   +KLQE
Sbjct  638  RNKLCDKYQDFVTDSERELFTSKLQE  663



>gb|KDO51189.1| hypothetical protein CISIN_1g003056mg [Citrus sinensis]
Length=852

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 168/206 (82%), Gaps = 15/206 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS K ERAK+KVKVRLN+HGIVS+ESATLLEEEEVEVPV KE  KE+ KM
Sbjct  461  KISTYTIGPFQSTKSERAKVKVKVRLNMHGIVSIESATLLEEEEVEVPVTKEPEKEAAKM  520

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDA--------SENHVLESGDKPVQMETDakae  325
            ETD++P    P  SSETDVNMQD K T+DA        +EN V ESGDKP QMET    +
Sbjct  521  ETDEVPSDAAPPSSSETDVNMQDAKGTADAQGTTDAPGAENGVPESGDKPTQMET---DK  577

Query  326  apkkkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDM  505
             PKKKVKKTN+PVSELVYG + P DVQKAVEKEFEMALQDR+MEETKD+KNAVEAYVYDM
Sbjct  578  TPKKKVKKTNIPVSELVYGGMLPVDVQKAVEKEFEMALQDRVMEETKDRKNAVEAYVYDM  637

Query  506  RNKLYDKYQEFVVDSEKEQLIAKLQE  583
            RNKL DKYQ+FV DSE+E   +KLQE
Sbjct  638  RNKLCDKYQDFVTDSERELFTSKLQE  663



>ref|XP_006427039.1| hypothetical protein CICLE_v10024883mg [Citrus clementina]
 gb|ESR40279.1| hypothetical protein CICLE_v10024883mg [Citrus clementina]
Length=852

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 168/206 (82%), Gaps = 15/206 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS K ERAK+KVKVRLN+HGIVS+ESATLLEEEEVEVPV KE  KE+ KM
Sbjct  461  KISTYTIGPFQSTKSERAKVKVKVRLNMHGIVSIESATLLEEEEVEVPVTKEPEKEAAKM  520

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDA--------SENHVLESGDKPVQMETDakae  325
            ETD++P    P  SSETDVNMQD K T+DA        +EN V ESGDKP QMET    +
Sbjct  521  ETDEVPSDTAPPSSSETDVNMQDAKGTADAQGTTDAPGAENGVPESGDKPTQMET---DK  577

Query  326  apkkkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDM  505
             PKKKVKKTN+PVSELVYG + P DVQKAVEKEFEMALQDR+MEETKD+KNAVEAYVYDM
Sbjct  578  TPKKKVKKTNIPVSELVYGGMLPVDVQKAVEKEFEMALQDRVMEETKDRKNAVEAYVYDM  637

Query  506  RNKLYDKYQEFVVDSEKEQLIAKLQE  583
            RNKL DKYQ+FV DSE+E   +KLQE
Sbjct  638  RNKLCDKYQDFVTDSERELFTSKLQE  663



>gb|KJB70511.1| hypothetical protein B456_011G076800 [Gossypium raimondii]
Length=749

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 170/200 (85%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPF + + ER KLKVKVRLNLHGIVSVESATLLEEEEVEVPV KE  K+++KM
Sbjct  459  KISTYTIGPFPTIRSERPKLKVKVRLNLHGIVSVESATLLEEEEVEVPVSKEPEKDNSKM  518

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            ETD+ P       ++ETDVNMQD K T+DA+  +N V +SGDKPV+METD K EAPKKKV
Sbjct  519  ETDEAPGGTAAPSANETDVNMQDAKGTADAAGADNGVAKSGDKPVKMETDTKVEAPKKKV  578

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTNVPV+ELVYGA+ PADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  579  KKTNVPVAELVYGAMLPADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSD  638

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY +FV   EKE+L AKLQE
Sbjct  639  KYHDFVTAPEKEELTAKLQE  658



>ref|XP_006465548.1| PREDICTED: heat shock 70 kDa protein 14-like [Citrus sinensis]
Length=852

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 168/206 (82%), Gaps = 15/206 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS K ERAK+KVKVRLN+HGIVS+ESATLLEEEEVEVPV KE  KE+ KM
Sbjct  461  KISTYTIGPFQSTKSERAKVKVKVRLNMHGIVSIESATLLEEEEVEVPVTKEPEKEAAKM  520

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDA--------SENHVLESGDKPVQMETDakae  325
            ETD++P    P  SSETDVNMQD K T+DA        +EN V ESGDKP QMET    +
Sbjct  521  ETDEVPSDAAPPSSSETDVNMQDAKGTADAQGTTDAPGAENGVPESGDKPTQMET---DK  577

Query  326  apkkkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDM  505
             PKKKVKKTN+PVSELVYG + P DVQKAVEKEFEMALQDR+MEETKD+KNAVEAYVYDM
Sbjct  578  TPKKKVKKTNIPVSELVYGGMLPVDVQKAVEKEFEMALQDRVMEETKDRKNAVEAYVYDM  637

Query  506  RNKLYDKYQEFVVDSEKEQLIAKLQE  583
            RNKL DKYQ+FV DSE+E   +KLQE
Sbjct  638  RNKLCDKYQDFVTDSERELFTSKLQE  663



>gb|KJB70509.1| hypothetical protein B456_011G076800 [Gossypium raimondii]
 gb|KJB70510.1| hypothetical protein B456_011G076800 [Gossypium raimondii]
Length=855

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 170/200 (85%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPF + + ER KLKVKVRLNLHGIVSVESATLLEEEEVEVPV KE  K+++KM
Sbjct  459  KISTYTIGPFPTIRSERPKLKVKVRLNLHGIVSVESATLLEEEEVEVPVSKEPEKDNSKM  518

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            ETD+ P       ++ETDVNMQD K T+DA+  +N V +SGDKPV+METD K EAPKKKV
Sbjct  519  ETDEAPGGTAAPSANETDVNMQDAKGTADAAGADNGVAKSGDKPVKMETDTKVEAPKKKV  578

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTNVPV+ELVYGA+ PADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  579  KKTNVPVAELVYGAMLPADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSD  638

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY +FV   EKE+L AKLQE
Sbjct  639  KYHDFVTAPEKEELTAKLQE  658



>ref|XP_004302913.1| PREDICTED: heat shock 70 kDa protein 15-like [Fragaria vesca 
subsp. vesca]
Length=848

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 166/199 (83%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGER+K+KV+ RLN HGIVSV+SATLLEEEEVEVPV KEQ KE+TKM
Sbjct  459  KISTYTIGPFQSTKGERSKVKVRARLNYHGIVSVDSATLLEEEEVEVPVTKEQPKEATKM  518

Query  182  ETD----DIPPQDSSETDVNMQDDKVTSDAS-ENHVLESGDKPVQMETDakaeapkkkvk  346
            ETD    D+PP  S   DVNMQD      AS EN V ESGDKPVQMETDAKA+APK+KVK
Sbjct  519  ETDEAPSDVPPPSSEAADVNMQDANSNDAASAENGVPESGDKPVQMETDAKADAPKRKVK  578

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTN+PV ELVYG ++ ADVQKA+E E+EMALQDR+MEETKDKKNAVEAYVYDMRNKL DK
Sbjct  579  KTNIPVVELVYGGMAAADVQKAIESEYEMALQDRVMEETKDKKNAVEAYVYDMRNKLSDK  638

Query  527  YQEFVVDSEKEQLIAKLQE  583
             QEFV DSE+E  I KLQE
Sbjct  639  LQEFVTDSEREAFITKLQE  657



>ref|XP_009358190.1| PREDICTED: heat shock 70 kDa protein 15-like [Pyrus x bretschneideri]
Length=855

 Score =   222 bits (566),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 168/200 (84%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS K ERAKLKVK RLNLHGIVSV+SATLLEEEE+EVPV KEQ KE+ KM
Sbjct  461  KISTYTIGPFQSVKSERAKLKVKARLNLHGIVSVDSATLLEEEEIEVPVTKEQTKEAAKM  520

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkv  343
            ETD+ P    P  + ETDVNMQD K T+DA  +E  V ESGDKP QMETDAKA+A K KV
Sbjct  521  ETDEAPSDAAPPSTKETDVNMQDAKDTADAPGAETGVPESGDKPAQMETDAKADAKKIKV  580

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            +KTN+PV+ELVYG + P ++QKA+EKEFEMALQDR+MEETKDKKNAVEAYVY+MR+KL D
Sbjct  581  RKTNIPVTELVYGGMPPNELQKAIEKEFEMALQDRVMEETKDKKNAVEAYVYNMRSKLND  640

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY EFV +SE+E  IA+LQE
Sbjct  641  KYHEFVTESEREAFIARLQE  660



>gb|EYU21549.1| hypothetical protein MIMGU_mgv1a001311mg [Erythranthe guttata]
Length=842

 Score =   221 bits (564),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 169/196 (86%), Gaps = 8/196 (4%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYT+GPFQS K ERAKLKVKVRLNLHGIVS+ESATLLEEEEVEVPVVKE    +TKM
Sbjct  461  KISTYTVGPFQSTKSERAKLKVKVRLNLHGIVSIESATLLEEEEVEVPVVKE----ATKM  516

Query  182  ETDDIPPQ--DSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTN  355
            ETD+ P     ++ETDVNMQD K  +D +EN V ESGDK  QMETD K EAPKKKVKKT+
Sbjct  517  ETDEAPGATPSTTETDVNMQDAK--TDGAENGVPESGDKTAQMETDVKVEAPKKKVKKTS  574

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            VPVSE+VYG ++ ADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVY+MRNKL DKY E
Sbjct  575  VPVSEIVYGGMAAADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYEMRNKLNDKYHE  634

Query  536  FVVDSEKEQLIAKLQE  583
            FV +S+KEQLI++LQE
Sbjct  635  FVTESDKEQLISRLQE  650



>ref|XP_010521527.1| PREDICTED: heat shock 70 kDa protein 15 [Tarenaya hassleriana]
Length=832

 Score =   221 bits (564),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 167/199 (84%), Gaps = 6/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVK RLNLHGIVSVESATLLEEEEVEVPV KEQ +  TKM
Sbjct  461  KISTYTIGPFQSSKGERAKLKVKARLNLHGIVSVESATLLEEEEVEVPVTKEQEE-PTKM  519

Query  182  ETDDIPPQD---SSETDVNMQDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvk  346
            +TD  P +    S  +DVNMQD K   DA  +EN V ES DKPVQMETD K EAPKKKVK
Sbjct  520  DTDKAPGETDPASGGSDVNMQDAKGAGDATGAENGVPESVDKPVQMETDMKTEAPKKKVK  579

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTNVPVSELVYGA+   DVQKAVEKEFEMALQDR+MEETKD+KNAVEAYVYDMRNKL DK
Sbjct  580  KTNVPVSELVYGAMQSVDVQKAVEKEFEMALQDRVMEETKDRKNAVEAYVYDMRNKLSDK  639

Query  527  YQEFVVDSEKEQLIAKLQE  583
            YQE+++DS++E  +AKLQE
Sbjct  640  YQEYIIDSDREAFLAKLQE  658



>ref|XP_010473008.1| PREDICTED: heat shock 70 kDa protein 15-like [Camelina sativa]
Length=830

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 173/199 (87%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHG+VSVESATLLEEEEVEVPV KE+ +E+ KM
Sbjct  461  KISTYTIGPFQSLKGERAKLKVKVRLNLHGVVSVESATLLEEEEVEVPVSKEKSQETAKM  520

Query  182  ETDDIPPQD---SSETDVNMQDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvk  346
            +TD    +    S ++DVNMQD K T+DA  +EN V ES DKPVQMETD+KAEAPKKKVK
Sbjct  521  DTDKASSEAAPASGDSDVNMQDAKETTDAGSTENGVPESADKPVQMETDSKAEAPKKKVK  580

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTNVP+SE+VYGAL   +V+KAVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DK
Sbjct  581  KTNVPLSEVVYGALKSLEVEKAVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDK  640

Query  527  YQEFVVDSEKEQLIAKLQE  583
            YQE+++DSE+E  +AKLQE
Sbjct  641  YQEYIIDSEREAFLAKLQE  659



>ref|XP_006842242.1| hypothetical protein AMTR_s00078p00190750 [Amborella trichopoda]
 gb|ERN03917.1| hypothetical protein AMTR_s00078p00190750 [Amborella trichopoda]
Length=855

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 165/205 (80%), Gaps = 12/205 (6%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeq-----lke  169
            IS+YTIGPFQS KGERAK+KVKVRLNLHGIVSVESATLLEEEEVEVPV   +      KE
Sbjct  462  ISSYTIGPFQSAKGERAKVKVKVRLNLHGIVSVESATLLEEEEVEVPVSPVKEPVKETKE  521

Query  170  STKMETDDIP----PQDSSETDVNMQDDKVTSDAS---ENHVLESGDKPVQMETDakaea  328
            +TKMETDD+P    P  S E +VNM D K   DA    EN + ESGDKPVQMETDAK EA
Sbjct  522  ATKMETDDVPSESGPPPSDENEVNMADAKPAGDAPGGPENGIPESGDKPVQMETDAKPEA  581

Query  329  pkkkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMR  508
             KKKV+K NVPVSE+VYGA+  AD+QK +EKEFEMALQDR+MEETKD+KNAVEAYVYDMR
Sbjct  582  SKKKVRKINVPVSEVVYGAMVTADLQKVIEKEFEMALQDRVMEETKDRKNAVEAYVYDMR  641

Query  509  NKLYDKYQEFVVDSEKEQLIAKLQE  583
            NKLYDKYQEFV +SE+E    KLQE
Sbjct  642  NKLYDKYQEFVTESEREAFSQKLQE  666



>ref|XP_006346576.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum tuberosum]
Length=847

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 170/200 (85%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRL LHGIVSVESATLLEEEEV+VPVVKE  K   +M
Sbjct  459  KISTYTIGPFQSSKGERAKLKVKVRLTLHGIVSVESATLLEEEEVDVPVVKETAKGPARM  518

Query  182  ETD----DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            ETD    D  P  +SE DVNM+D K  + AS  EN V ESGD+PVQME+DAK EAPKKKV
Sbjct  519  ETDEGSADAAPSTTSENDVNMEDAKGAAAASGAENGVPESGDEPVQMESDAKVEAPKKKV  578

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKT+VPV+E+VYGA++ ADVQKAVEKEFEMALQDR+MEETKDKKNAVE+YVYDMRNKL D
Sbjct  579  KKTSVPVTEIVYGAMAAADVQKAVEKEFEMALQDRVMEETKDKKNAVESYVYDMRNKLSD  638

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KYQEFV DSE+EQ +A LQE
Sbjct  639  KYQEFVTDSEREQFMAVLQE  658



>gb|KHG16619.1| Heat shock 70 kDa 15 -like protein [Gossypium arboreum]
Length=855

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 169/200 (85%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPF + + E+ KLKVKVRLNLHGIVSVESATLLEEEEVEVPV KE  K+++KM
Sbjct  459  KISTYTIGPFPTIRSEQPKLKVKVRLNLHGIVSVESATLLEEEEVEVPVSKEPEKDNSKM  518

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
             TD+ P       ++ETDVNMQD K T+DA+  EN V ESGDKPV+METD K EAPKKKV
Sbjct  519  VTDEAPSGTAAPSANETDVNMQDAKGTADAAGAENGVAESGDKPVKMETDTKVEAPKKKV  578

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTNVPV+ELVYGA+ PADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  579  KKTNVPVAELVYGAMLPADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSD  638

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY++FV   EKE+  AKLQE
Sbjct  639  KYRDFVTAPEKEEFTAKLQE  658



>ref|XP_003546366.1| PREDICTED: heat shock 70 kDa protein 14-like [Glycine max]
 gb|KHM98765.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=863

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 168/203 (83%), Gaps = 9/203 (4%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS   E+AK+KVKVRLNLHGIVSVESATLLEEEE+EVPV KE   E+TKM
Sbjct  461  KISTYTIGPFQSTITEKAKVKVKVRLNLHGIVSVESATLLEEEEIEVPVSKEPAGENTKM  520

Query  182  ETDDIP-----PQDSSETDVNMQD--DKVTSDA--SENHVLESGDKPVQMETDakaeapk  334
            ETD+ P     P  +++ DVNMQD   K T+DA  SEN   E+GDKPVQM+TD K EAPK
Sbjct  521  ETDEAPANVAAPPSTNDNDVNMQDANSKATADAPGSENGTPEAGDKPVQMDTDTKVEAPK  580

Query  335  kkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNK  514
            KKVKK N+PV ELVYGA++ ADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYD RNK
Sbjct  581  KKVKKINIPVVELVYGAMAAADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDTRNK  640

Query  515  LYDKYQEFVVDSEKEQLIAKLQE  583
            L DKYQEFVVDSE+E   AKLQE
Sbjct  641  LNDKYQEFVVDSERESFTAKLQE  663



>ref|XP_009358191.1| PREDICTED: heat shock 70 kDa protein 15-like [Pyrus x bretschneideri]
 ref|XP_009358192.1| PREDICTED: heat shock 70 kDa protein 15-like [Pyrus x bretschneideri]
Length=855

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 167/200 (84%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS K ERAKLKVK RLNLHGIVSV+SATLLEEEE+EVPV KEQ KE+ KM
Sbjct  461  KISTYTIGPFQSVKSERAKLKVKARLNLHGIVSVDSATLLEEEEIEVPVTKEQTKEAAKM  520

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkv  343
            ETD+ P    P  + ETDVNMQD K  +DA  +E  V ESGDKP QMETDAKA+A K KV
Sbjct  521  ETDEAPSDAAPPSTKETDVNMQDAKDNADAPGAETGVPESGDKPAQMETDAKADAKKIKV  580

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            +KTN+PV+ELVYG + P ++QKA+EKEFEMALQDR+MEETKDKKNAVEAYVY+MR+KL D
Sbjct  581  RKTNIPVTELVYGGMPPNELQKAIEKEFEMALQDRVMEETKDKKNAVEAYVYNMRSKLND  640

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY EFV +SE+E  IA+LQE
Sbjct  641  KYHEFVTESEREAFIARLQE  660



>ref|XP_007150665.1| hypothetical protein PHAVU_005G171400g [Phaseolus vulgaris]
 gb|ESW22659.1| hypothetical protein PHAVU_005G171400g [Phaseolus vulgaris]
Length=865

 Score =   220 bits (560),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 168/205 (82%), Gaps = 11/205 (5%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGE+AK+KV+VRLNLHGIVS+ESATLLEEEE+EVPV KE   E+TKM
Sbjct  461  KISTYTIGPFQSTKGEKAKIKVRVRLNLHGIVSIESATLLEEEEIEVPVSKESAGENTKM  520

Query  182  ETDDIP-----PQDSSETDVNMQDDKVTSDAS------ENHVLESGDKPVQMETDakaea  328
            ETD+       P  +++ DVNMQD  V ++ S      EN   E+GDKPVQM+TD KAEA
Sbjct  521  ETDEAAADTATPPSANDNDVNMQDANVNANPSADVTGAENGTPEAGDKPVQMDTDTKAEA  580

Query  329  pkkkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMR  508
            PKKKVKK NVPV E+VYGA+S ADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMR
Sbjct  581  PKKKVKKINVPVVEVVYGAMSVADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMR  640

Query  509  NKLYDKYQEFVVDSEKEQLIAKLQE  583
            NKL DKYQEFV+DSE+E    KLQE
Sbjct  641  NKLNDKYQEFVIDSEREAFTTKLQE  665



>ref|XP_010033879.1| PREDICTED: heat shock 70 kDa protein 14-like [Eucalyptus grandis]
 gb|KCW53729.1| hypothetical protein EUGRSUZ_J02987 [Eucalyptus grandis]
 gb|KCW53730.1| hypothetical protein EUGRSUZ_J02987 [Eucalyptus grandis]
Length=851

 Score =   219 bits (559),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 167/201 (83%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeST-K  178
            KIS+YTIGPFQ  K ERAKLKVKVRLNLHGIVS+ESATLLEEEEVEVPV ++   + T K
Sbjct  461  KISSYTIGPFQCAKSERAKLKVKVRLNLHGIVSIESATLLEEEEVEVPVTQDAAAQETNK  520

Query  179  METDDI----PPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkk  340
            M+TD+      P  S E DVNMQD K  +DAS  EN V E+G+KPVQ ETD+KAEAPKKK
Sbjct  521  MDTDETSNAAAPPTSGEADVNMQDAKGATDASGVENGVPETGEKPVQTETDSKAEAPKKK  580

Query  341  vkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLY  520
            VKKTNVPV+ELVYGALS  D+QKA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL 
Sbjct  581  VKKTNVPVTELVYGALSSGDLQKAIEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLN  640

Query  521  DKYQEFVVDSEKEQLIAKLQE  583
            DKY +FV D E+EQLI+ LQE
Sbjct  641  DKYYDFVTDPEREQLISTLQE  661



>ref|NP_178111.1| heat shock protein 91 [Arabidopsis thaliana]
 sp|Q9S7C0.1|HSP7O_ARATH RecName: Full=Heat shock 70 kDa protein 14; AltName: Full=Heat 
shock protein 70-14; Short=AtHsp70-14; AltName: Full=Heat 
shock protein 91 [Arabidopsis thaliana]
 gb|AAD55461.1|AC009322_1 Heat-shock protein [Arabidopsis thaliana]
 gb|AAG52240.1|AC011717_8 putative heat-shock protein; 37113-40399 [Arabidopsis thaliana]
 gb|AAL84971.1| At1g79930/F19K16_11 [Arabidopsis thaliana]
 gb|AAO11541.1| At1g79930/F19K16_11 [Arabidopsis thaliana]
 gb|AEE36327.1| heat shock protein 91 [Arabidopsis thaliana]
Length=831

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 170/199 (85%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPV KE  +E+TKM
Sbjct  461  KISTYTIGPFQSSKGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPVTKEHSEETTKM  520

Query  182  ETDDIPPQD---SSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvk  346
            ++D    +    S + DVNMQD K TSDA+  +N V ES +KPVQMETD+KAEAPKKKVK
Sbjct  521  DSDKASAEAAPASGDCDVNMQDAKDTSDATGTDNGVPESAEKPVQMETDSKAEAPKKKVK  580

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTNVP+SELVYGAL   +V+KAVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DK
Sbjct  581  KTNVPLSELVYGALKTVEVEKAVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDK  640

Query  527  YQEFVVDSEKEQLIAKLQE  583
            YQE++ DSE+E  +A LQE
Sbjct  641  YQEYITDSEREAFLANLQE  659



>ref|NP_001031305.1| heat shock protein 91 [Arabidopsis thaliana]
 dbj|BAE98929.1| putative heat shock protein [Arabidopsis thaliana]
 gb|AEE36328.1| heat shock protein 91 [Arabidopsis thaliana]
Length=789

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 170/199 (85%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPV KE  +E+TKM
Sbjct  461  KISTYTIGPFQSSKGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPVTKEHSEETTKM  520

Query  182  ETDDIPPQD---SSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvk  346
            ++D    +    S + DVNMQD K TSDA+  +N V ES +KPVQMETD+KAEAPKKKVK
Sbjct  521  DSDKASAEAAPASGDCDVNMQDAKDTSDATGTDNGVPESAEKPVQMETDSKAEAPKKKVK  580

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTNVP+SELVYGAL   +V+KAVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DK
Sbjct  581  KTNVPLSELVYGALKTVEVEKAVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDK  640

Query  527  YQEFVVDSEKEQLIAKLQE  583
            YQE++ DSE+E  +A LQE
Sbjct  641  YQEYITDSEREAFLANLQE  659



>gb|AAL38353.1| putative heat-shock protein [Arabidopsis thaliana]
Length=831

 Score =   219 bits (558),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 170/199 (85%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSVESATLLEEEEVEV V K+Q +E+ KM
Sbjct  461  KISTYTIGPFQSSKGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVSVTKDQSEETAKM  520

Query  182  ETDDIPPQD---SSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvk  346
            +TD    +    S ++DVNMQD K TSDA+  +N V ES +KPVQMETD+KAEAPKKKVK
Sbjct  521  DTDKASAEAAPASGDSDVNMQDAKDTSDATGTDNGVPESAEKPVQMETDSKAEAPKKKVK  580

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTNVP+SELVYGAL   +V+KAVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DK
Sbjct  581  KTNVPLSELVYGALKTVEVEKAVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDK  640

Query  527  YQEFVVDSEKEQLIAKLQE  583
            YQE++ DSE+E  +A LQE
Sbjct  641  YQEYITDSEREAFLANLQE  659



>ref|NP_850984.4| Heat shock protein 70 [Arabidopsis thaliana]
 sp|F4HQD4.1|HSP7P_ARATH RecName: Full=Heat shock 70 kDa protein 15; AltName: Full=Heat 
shock protein 70-15; Short=AtHsp70-15 [Arabidopsis thaliana]
 gb|AEE36325.1| Heat shock protein 70 [Arabidopsis thaliana]
Length=831

 Score =   219 bits (558),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 170/199 (85%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSVESATLLEEEEVEV V K+Q +E+ KM
Sbjct  461  KISTYTIGPFQSSKGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVSVTKDQSEETAKM  520

Query  182  ETDDIPPQD---SSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvk  346
            +TD    +    S ++DVNMQD K TSDA+  +N V ES +KPVQMETD+KAEAPKKKVK
Sbjct  521  DTDKASAEAAPASGDSDVNMQDAKDTSDATGTDNGVPESAEKPVQMETDSKAEAPKKKVK  580

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTNVP+SELVYGAL   +V+KAVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DK
Sbjct  581  KTNVPLSELVYGALKTVEVEKAVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDK  640

Query  527  YQEFVVDSEKEQLIAKLQE  583
            YQE++ DSE+E  +A LQE
Sbjct  641  YQEYITDSEREAFLANLQE  659



>gb|KDP37205.1| hypothetical protein JCGZ_06261 [Jatropha curcas]
Length=847

 Score =   219 bits (558),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 164/200 (82%), Gaps = 7/200 (4%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS   +RAK+KVKVRLNLHGIV+VESATLLEEEEVEVPV KE  KE  KM
Sbjct  461  KISTYTIGPFQSSTSDRAKVKVKVRLNLHGIVAVESATLLEEEEVEVPVTKEPAKEE-KM  519

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            +TD+      P  S++ DVNMQD K T DAS  EN V ESGDKP QMET+ K E PKKKV
Sbjct  520  DTDEASNEATPPSSNDADVNMQDAKGTGDASGAENGVPESGDKPTQMETETKVEVPKKKV  579

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTN+PV+E+VYG L PADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  580  KKTNIPVAEVVYGGLPPADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSD  639

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KYQEFV D E+E   AKLQE
Sbjct  640  KYQEFVTDPEREDFTAKLQE  659



>ref|XP_010033884.1| PREDICTED: heat shock 70 kDa protein 14-like [Eucalyptus grandis]
 gb|KCW53736.1| hypothetical protein EUGRSUZ_J02991 [Eucalyptus grandis]
Length=874

 Score =   219 bits (558),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 168/206 (82%), Gaps = 12/206 (6%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS+YTIGPFQ  KGERAKLKVKVRLNLHGIVSVESATL+EEEEVEVPV K+  +E+ KM
Sbjct  461  KISSYTIGPFQCSKGERAKLKVKVRLNLHGIVSVESATLMEEEEVEVPVTKDAAQEANKM  520

Query  182  ETDDIPPQDSS----------ETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakae  325
            +TD+ P   +           E DVNMQD K  +DA   EN V E+G+KPVQMETD K E
Sbjct  521  DTDETPSDAAPPSDAAPPASAEADVNMQDAKGAADAPGVENGVPETGEKPVQMETDIKTE  580

Query  326  apkkkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDM  505
            APKKKVKKTN+PV E+VYGALS  D+QKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDM
Sbjct  581  APKKKVKKTNIPVVEVVYGALSSGDLQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDM  640

Query  506  RNKLYDKYQEFVVDSEKEQLIAKLQE  583
            RNKL DKY +FV DSE+E+LIAKLQE
Sbjct  641  RNKLNDKYHDFVTDSEREELIAKLQE  666



>ref|NP_178110.6| Heat shock protein 70 [Arabidopsis thaliana]
 gb|AEE36326.1| Heat shock protein 70 [Arabidopsis thaliana]
Length=831

 Score =   219 bits (557),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 170/199 (85%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSVESATLLEEEEVEV V K+Q +E+ KM
Sbjct  461  KISTYTIGPFQSSKGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVSVTKDQSEETAKM  520

Query  182  ETDDIPPQD---SSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvk  346
            +TD    +    S ++DVNMQD K TSDA+  +N V ES +KPVQMETD+KA+APKKKVK
Sbjct  521  DTDKASAEAAPASGDSDVNMQDAKDTSDATGTDNGVPESAEKPVQMETDSKAKAPKKKVK  580

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTNVP+SELVYGAL   +V+KAVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DK
Sbjct  581  KTNVPLSELVYGALKTVEVEKAVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDK  640

Query  527  YQEFVVDSEKEQLIAKLQE  583
            YQE++ DSE+E  +A LQE
Sbjct  641  YQEYITDSEREAFLANLQE  659



>ref|XP_002887853.1| hypothetical protein ARALYDRAFT_896005 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64112.1| hypothetical protein ARALYDRAFT_896005 [Arabidopsis lyrata subsp. 
lyrata]
Length=830

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 169/199 (85%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIG FQS KGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPV K+Q  E+TKM
Sbjct  461  KISTYTIGTFQSSKGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPVTKDQSVETTKM  520

Query  182  ETDDIPPQD---SSETDVNMQDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvk  346
            +TD    +    S ++DVNMQD K TSDA  S+N V ES +KPVQMETD KAEAPKKKVK
Sbjct  521  DTDKASAEAAPASGDSDVNMQDAKDTSDAAGSDNGVAESAEKPVQMETDLKAEAPKKKVK  580

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTNVP+SELVYGAL   +V KAVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DK
Sbjct  581  KTNVPLSELVYGALKSVEVDKAVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDK  640

Query  527  YQEFVVDSEKEQLIAKLQE  583
            YQE++ D+E+E  +AKLQE
Sbjct  641  YQEYITDAEREAFLAKLQE  659



>ref|XP_008354139.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=834

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 167/200 (84%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPF S K ERAKLKVK RLNLHGIVSV+SATLLEEEE+EVPV KEQ KE+ KM
Sbjct  461  KISTYTIGPFXSVKSERAKLKVKARLNLHGIVSVDSATLLEEEEIEVPVTKEQTKEAAKM  520

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkv  343
            ETD+ P    P  + ETDV+MQD K T+DA  +EN V ESG+KP QMETDAKA+A K KV
Sbjct  521  ETDEAPSDVAPPSTXETDVSMQDAKDTADAPGAENVVPESGEKPXQMETDAKADAKKIKV  580

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            +KTN+PV+ELVYG +   +VQKA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  581  RKTNIPVTELVYGGMPXNEVQKAIEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLND  640

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY EFV +SE+E  IA+LQE
Sbjct  641  KYHEFVTESEREAFIARLQE  660



>emb|CAA94389.1| heat-shock protein [Arabidopsis thaliana]
Length=831

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 169/199 (85%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPV KE  +E+TKM
Sbjct  461  KISTYTIGPFQSSKGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPVTKEHSEETTKM  520

Query  182  ETDDIPPQD---SSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvk  346
            ++D    +    S + DVNMQD K TSDA+  +N V ES +KPVQMETD+KAEAPKKKVK
Sbjct  521  DSDKASAEAAPASGDCDVNMQDAKDTSDATSTDNGVPESAEKPVQMETDSKAEAPKKKVK  580

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTNVP+SELVYGAL   +V+KAVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DK
Sbjct  581  KTNVPLSELVYGALKTVEVEKAVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDK  640

Query  527  YQEFVVDSEKEQLIAKLQE  583
            YQE++ DSE E  +A LQE
Sbjct  641  YQEYITDSETEAFLANLQE  659



>ref|XP_008362708.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=855

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 167/200 (84%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPF S K ERAKLKVK RLNLHGIVSV+SATLLEEEE+EVPV KEQ KE+ KM
Sbjct  461  KISTYTIGPFPSVKSERAKLKVKARLNLHGIVSVDSATLLEEEEIEVPVTKEQTKEAAKM  520

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkv  343
            ETD+ P    P  + ETDV+MQD K T+DA  +EN V ESG+KP QMETDAKA+A K KV
Sbjct  521  ETDEAPSDVAPPSTEETDVSMQDAKDTADAPGAENVVPESGEKPAQMETDAKADAKKIKV  580

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            +KTN+PV+ELVYG +   +VQKA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  581  RKTNIPVTELVYGGMPLNEVQKAIEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLND  640

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY EFV +SE+E  IA+LQE
Sbjct  641  KYHEFVTESEREAFIARLQE  660



>ref|XP_010430044.1| PREDICTED: heat shock 70 kDa protein 15 [Camelina sativa]
Length=830

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 172/199 (86%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYT GPFQS KGER+KLKVKVRLNLHG+VSVESATLLEEEEVEVPV KE+ +E+ KM
Sbjct  461  KISTYTNGPFQSSKGERSKLKVKVRLNLHGVVSVESATLLEEEEVEVPVSKEKSQETAKM  520

Query  182  ETDDIPPQD---SSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvk  346
            +TD    +    S ++DVNMQD K T+DA+  EN V ES DKPVQMETD+KAEAPKKKVK
Sbjct  521  DTDKASAEAAPASGDSDVNMQDAKETTDATSTENGVPESADKPVQMETDSKAEAPKKKVK  580

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTNVP+SE+VYGAL   +V+KAVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DK
Sbjct  581  KTNVPLSEVVYGALKSLEVEKAVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDK  640

Query  527  YQEFVVDSEKEQLIAKLQE  583
            YQE+++DSE+E  +AKLQE
Sbjct  641  YQEYIIDSEREAFLAKLQE  659



>ref|XP_006392781.1| hypothetical protein EUTSA_v10011242mg [Eutrema salsugineum]
 gb|ESQ30067.1| hypothetical protein EUTSA_v10011242mg [Eutrema salsugineum]
Length=829

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 169/199 (85%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRL LHGIVSVESATLLEEEEVEVPV KEQ  E+TKM
Sbjct  461  KISTYTIGPFQSSKGERAKLKVKVRLTLHGIVSVESATLLEEEEVEVPVTKEQSGEATKM  520

Query  182  ETDDIPPQD---SSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvk  346
            +TD    +    S E+DVNM+D   TSDA+  +N V ES DKPVQMETD+KAEAPKKKVK
Sbjct  521  DTDKASAETAPASGESDVNMRDSNETSDAAGTDNGVPESADKPVQMETDSKAEAPKKKVK  580

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTNVP+SELVYGA+   +VQKAVEKE+EMALQDR+MEETKD+KNAVE+YVYDMRNKL DK
Sbjct  581  KTNVPLSELVYGAMQSGEVQKAVEKEYEMALQDRVMEETKDRKNAVESYVYDMRNKLSDK  640

Query  527  YQEFVVDSEKEQLIAKLQE  583
            Y E++ +SE+E  +AKLQE
Sbjct  641  YHEYITESEREAFLAKLQE  659



>gb|KHG16198.1| Heat shock 70 kDa 15 -like protein [Gossypium arboreum]
Length=856

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 168/200 (84%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPF + + E+ KLKVKVRLNLHGIVSV+SATLLEEEEVEVPV KE  KE  KM
Sbjct  459  KISTYTIGPFPTLRSEKPKLKVKVRLNLHGIVSVDSATLLEEEEVEVPVSKELAKEDAKM  518

Query  182  ETDDIPPQDSS----ETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            ETD+ P   S+    ETDVNMQD K T++A+  EN V +SGDKPVQMETD K EAPKKKV
Sbjct  519  ETDEKPNDTSAPGANETDVNMQDAKGTAEAAGVENGVPQSGDKPVQMETDTKVEAPKKKV  578

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTNVPV+ELVYGA+   D+QKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  579  KKTNVPVAELVYGAMLSGDLQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLCD  638

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY +FV  S+KE+L+AKLQE
Sbjct  639  KYHDFVTASDKEELMAKLQE  658



>ref|XP_010538015.1| PREDICTED: heat shock 70 kDa protein 14 [Tarenaya hassleriana]
 ref|XP_010538016.1| PREDICTED: heat shock 70 kDa protein 14 [Tarenaya hassleriana]
Length=829

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 172/199 (86%), Gaps = 6/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +ISTYTIGPFQS KGERAKLKVK RLNLHGIVS+ESATLLEEEEVEVPV KE ++ +TKM
Sbjct  461  QISTYTIGPFQSSKGERAKLKVKARLNLHGIVSIESATLLEEEEVEVPVTKEHVE-ATKM  519

Query  182  ETDDIPPQDSS---ETDVNMQDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvk  346
            +TD+ P + +    ++DVNMQD K T DA  +EN V ES DKPVQMETD+K +APKKKVK
Sbjct  520  DTDNAPAEAAPASSDSDVNMQDAKGTGDAPGAENGVPESTDKPVQMETDSKVKAPKKKVK  579

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTNVPVSE+VYGA+  ADVQKAVEKEFEMALQDR+MEETKD+KNAVEAYVYDMRNKL DK
Sbjct  580  KTNVPVSEMVYGAMQSADVQKAVEKEFEMALQDRVMEETKDRKNAVEAYVYDMRNKLSDK  639

Query  527  YQEFVVDSEKEQLIAKLQE  583
            YQE++ ++++E  +AKLQE
Sbjct  640  YQEYITETDREAFLAKLQE  658



>gb|KJB35056.1| hypothetical protein B456_006G098500 [Gossypium raimondii]
 gb|KJB35058.1| hypothetical protein B456_006G098500 [Gossypium raimondii]
Length=856

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 167/200 (84%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTY IGPF + + E+ KLKVKVRLNLHGIVSVESATLLEEEEVEVPV KE  KE  KM
Sbjct  459  KISTYMIGPFPTLRSEKPKLKVKVRLNLHGIVSVESATLLEEEEVEVPVSKEPAKEDAKM  518

Query  182  ETDDIPPQDSS----ETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            ETD+ P   S+    ETDVNMQD K T++A+  EN V +SGDKPVQMETD K EAPKKKV
Sbjct  519  ETDEKPNDTSAPGANETDVNMQDAKGTAEAAGVENGVPQSGDKPVQMETDTKVEAPKKKV  578

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTNVPV+ELVYGA+   D+QKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  579  KKTNVPVAELVYGAMVSGDLQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLCD  638

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY +FV  S+KE+L+AKLQE
Sbjct  639  KYHDFVTASDKEELMAKLQE  658



>gb|EYU24688.1| hypothetical protein MIMGU_mgv1a001324mg [Erythranthe guttata]
Length=840

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 162/194 (84%), Gaps = 5/194 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSVESATLLEEEE EVPVVK   +ESTKM
Sbjct  461  KISTYTIGPFQSAKGERAKLKVKVRLNLHGIVSVESATLLEEEETEVPVVKGSSQESTKM  520

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            ETD++    +  +    +D       +EN V ESGDK VQMETDAK +APKKKVKKTNVP
Sbjct  521  ETDELAADSAPPSTTETEDA-----GAENGVEESGDKSVQMETDAKVDAPKKKVKKTNVP  575

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            VSE++YG L+  DVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVY+MRNKL DKY +FV
Sbjct  576  VSEVIYGGLAAVDVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYEMRNKLNDKYHDFV  635

Query  542  VDSEKEQLIAKLQE  583
            ++SE+EQ IA+LQE
Sbjct  636  MESEREQFIARLQE  649



>ref|XP_010430043.1| PREDICTED: heat shock 70 kDa protein 15-like [Camelina sativa]
Length=829

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 170/198 (86%), Gaps = 5/198 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPV KEQ +E+TKM
Sbjct  461  KISTYTIGPFQSSKGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPVSKEQSEETTKM  520

Query  182  ETD--DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkk  349
            ET   +  P  S ++DVNMQD K + DA+  +N   ES DKPVQMETD+KAEAPKKKVKK
Sbjct  521  ETAPAETAPA-SGDSDVNMQDAKESVDAAGTDNGAPESTDKPVQMETDSKAEAPKKKVKK  579

Query  350  TNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKY  529
            TNVP+SE+VYGAL   +V+KAVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKY
Sbjct  580  TNVPLSEVVYGALKSVEVEKAVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKY  639

Query  530  QEFVVDSEKEQLIAKLQE  583
            QE++ D E+E  +AKLQE
Sbjct  640  QEYITDVEREAFLAKLQE  657



>ref|XP_010473009.1| PREDICTED: heat shock 70 kDa protein 15-like [Camelina sativa]
Length=829

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 170/198 (86%), Gaps = 5/198 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPV KEQ +E+TKM
Sbjct  461  KISTYTIGPFQSSKGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPVSKEQSEETTKM  520

Query  182  ETD--DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkk  349
            ET   +  P  S ++DVNMQD K + DA+  +N   ES DKPVQMETD+KAEAPKKKVKK
Sbjct  521  ETASAETAPA-SGDSDVNMQDAKESVDAAGTDNGAPESTDKPVQMETDSKAEAPKKKVKK  579

Query  350  TNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKY  529
            TNVP+SE+VYGAL   +V+KAVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKY
Sbjct  580  TNVPLSEVVYGALKSVEVEKAVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKY  639

Query  530  QEFVVDSEKEQLIAKLQE  583
            QE++ D E+E  +AKLQE
Sbjct  640  QEYITDVEREAFLAKLQE  657



>ref|XP_009147592.1| PREDICTED: heat shock 70 kDa protein 14 [Brassica rapa]
 ref|XP_009147593.1| PREDICTED: heat shock 70 kDa protein 14 [Brassica rapa]
Length=818

 Score =   213 bits (543),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 164/196 (84%), Gaps = 12/196 (6%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAK+KVKVRL LHGIVSVESATLLEEEEVEVPV       + +M
Sbjct  461  KISTYTIGPFQSSKGERAKVKVKVRLTLHGIVSVESATLLEEEEVEVPVT------TEQM  514

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTN  355
            +TD    + S ETDVNMQD K TSDA+  +N V ES DKPVQMETD+KAEAPKKKVKKTN
Sbjct  515  DTD----KASGETDVNMQDAKETSDAAGADNGVAESADKPVQMETDSKAEAPKKKVKKTN  570

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            VP+SELVYGAL   DVQKAVEKE+EMALQDR+MEETKDKKNAVE+YVYDMRNKL DK  E
Sbjct  571  VPLSELVYGALQSVDVQKAVEKEYEMALQDRVMEETKDKKNAVESYVYDMRNKLSDKLHE  630

Query  536  FVVDSEKEQLIAKLQE  583
            ++ +SE+E  +AKLQE
Sbjct  631  YITESEREAFLAKLQE  646



>emb|CDY24089.1| BnaA06g00870D [Brassica napus]
Length=858

 Score =   213 bits (543),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 164/196 (84%), Gaps = 12/196 (6%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAK+KVKVRL LHGIVSVESATLLEEEEVEVPV       + +M
Sbjct  501  KISTYTIGPFQSSKGERAKVKVKVRLTLHGIVSVESATLLEEEEVEVPVT------TEQM  554

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTN  355
            +TD    + S ETDVNMQD K TSDA+  +N V ES DKPVQMETD+KAEAPKKKVKKTN
Sbjct  555  DTD----KASGETDVNMQDAKETSDAAGADNGVAESADKPVQMETDSKAEAPKKKVKKTN  610

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            VP+SELVYGAL   DVQKAVEKE+EMALQDR+MEETKDKKNAVE+YVYDMRNKL DK  E
Sbjct  611  VPLSELVYGALQSVDVQKAVEKEYEMALQDRVMEETKDKKNAVESYVYDMRNKLSDKLHE  670

Query  536  FVVDSEKEQLIAKLQE  583
            ++ +SE+E  +AKLQE
Sbjct  671  YITESEREAFLAKLQE  686



>ref|XP_006287070.1| hypothetical protein CARUB_v10000229mg [Capsella rubella]
 gb|EOA19968.1| hypothetical protein CARUB_v10000229mg [Capsella rubella]
Length=828

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 169/198 (85%), Gaps = 5/198 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTY+IGPFQS KGERAKLKVKVRLNLHGIVSVESATLLEEE+VEV V KEQ +E+TKM
Sbjct  461  KISTYSIGPFQSSKGERAKLKVKVRLNLHGIVSVESATLLEEEQVEVHVSKEQSEETTKM  520

Query  182  ETD--DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkk  349
            ET   +  P  S ++DVNMQD K  SDA+  +N   ES DKPVQMETD+KAEAPKKKVKK
Sbjct  521  ETTSAETAPA-SGDSDVNMQDAKEISDAAGTDNGAPESADKPVQMETDSKAEAPKKKVKK  579

Query  350  TNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKY  529
            TNVP+SE+VYGAL   +V+KAVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKY
Sbjct  580  TNVPLSEVVYGALKSVEVEKAVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKY  639

Query  530  QEFVVDSEKEQLIAKLQE  583
            QE++ D+++E  + KLQE
Sbjct  640  QEYITDADREAFLVKLQE  657



>gb|KFK42397.1| hypothetical protein AALP_AA2G250600 [Arabis alpina]
Length=481

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 150/204 (74%), Gaps = 30/204 (15%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSVES                    +T +
Sbjct  128  KISTYTIGPFQSSKGERAKLKVKVRLNLHGIVSVES--------------------ATLL  167

Query  182  ETDDIP---PQDSSETDVNMQDDKV-----TSDAS--ENHVLESGDKPVQMETDakaeap  331
            E D+I     ++ SE  ++M  DK      +SDA+   N   ES DKPVQMETD KAEAP
Sbjct  168  EEDEIEVPVSKEQSEETIDMDTDKAPASGDSSDAAGTNNGAPESADKPVQMETDTKAEAP  227

Query  332  kkkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRN  511
            KKKVKKTNVP+SELVYGAL   DVQKAVEKEFEMALQDR+MEETKDKKNAVE+YVYDMRN
Sbjct  228  KKKVKKTNVPLSELVYGALQSVDVQKAVEKEFEMALQDRVMEETKDKKNAVESYVYDMRN  287

Query  512  KLYDKYQEFVVDSEKEQLIAKLQE  583
            KL DKYQE+++DSE+E  +A LQE
Sbjct  288  KLSDKYQEYIIDSEREAFLATLQE  311



>ref|XP_010539495.1| PREDICTED: heat shock 70 kDa protein 15-like [Tarenaya hassleriana]
Length=866

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 161/199 (81%), Gaps = 6/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS K ERAKLKVK RLNLHGIVSVESATLLEEEEVEVPV KE  + +TKM
Sbjct  481  KISTYTIGPFQSAKAERAKLKVKARLNLHGIVSVESATLLEEEEVEVPVTKESEE-ATKM  539

Query  182  ETDDIPPQD---SSETDVNMQDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvk  346
            +TD  P      S E DVNMQD K   DA  +EN V ES  KPV +ETD K EAPKKKVK
Sbjct  540  DTDKAPVDTVPASGEHDVNMQDAKEPGDAPGAENGVQESASKPVHIETDTKVEAPKKKVK  599

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KT +PVSELVYGAL   DVQKAVEKEFEMALQDR+MEETKD+KNAVEAYVYDMRNKL DK
Sbjct  600  KTTIPVSELVYGALQSVDVQKAVEKEFEMALQDRVMEETKDRKNAVEAYVYDMRNKLSDK  659

Query  527  YQEFVVDSEKEQLIAKLQE  583
            YQE++ DS++E  +AKLQE
Sbjct  660  YQEYITDSDREAFLAKLQE  678



>ref|XP_006300740.1| hypothetical protein CARUB_v10019803mg [Capsella rubella]
 gb|EOA33638.1| hypothetical protein CARUB_v10019803mg [Capsella rubella]
Length=828

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 170/198 (86%), Gaps = 5/198 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTY+IGPFQS KGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPV K+Q +E+ KM
Sbjct  461  KISTYSIGPFQSSKGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPVSKDQSEETAKM  520

Query  182  ETD--DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkk  349
            ET   +  P  S ++DVNMQD K TSDA+  +N   ES DKPVQMETD+KAEAPKKKVKK
Sbjct  521  ETASAETAPA-SGDSDVNMQDAKGTSDAAGTDNGAPESADKPVQMETDSKAEAPKKKVKK  579

Query  350  TNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKY  529
            TNVP+SE+VYGAL   +V+KAVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKY
Sbjct  580  TNVPLSEVVYGALKSVEVEKAVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKY  639

Query  530  QEFVVDSEKEQLIAKLQE  583
            +E++ D+++E  + KLQE
Sbjct  640  EEYITDADREAFLVKLQE  657



>emb|CDY45119.1| BnaC06g06400D [Brassica napus]
Length=956

 Score =   211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 163/196 (83%), Gaps = 12/196 (6%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAK+KVKVRL LHGIVSVESATLLEEEEVEVPV       + +M
Sbjct  601  KISTYTIGPFQSSKGERAKVKVKVRLTLHGIVSVESATLLEEEEVEVPVT------TEQM  654

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTN  355
            +TD    + S ETDVNMQD K TSDA+  +N V E  DKPVQMETD+KAEAPKKKVKKTN
Sbjct  655  DTD----KASGETDVNMQDAKETSDAAGADNGVTEPADKPVQMETDSKAEAPKKKVKKTN  710

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            VP+SELVYGAL   DVQKAVEKE+EMALQDR+MEETKDKKNAVE+YVYDMRNKL DK  E
Sbjct  711  VPLSELVYGALQSVDVQKAVEKEYEMALQDRVMEETKDKKNAVESYVYDMRNKLSDKLHE  770

Query  536  FVVDSEKEQLIAKLQE  583
            ++ +SE+E  +AKLQE
Sbjct  771  YITESEREAFLAKLQE  786



>ref|XP_003529646.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Glycine 
max]
 ref|XP_006582999.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X2 [Glycine 
max]
 gb|KHN39337.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=857

 Score =   211 bits (536),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 165/201 (82%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQ+  GE+AK+KVKVRLNLHGIVS+ESATLLEEEEV+VPV KE   E+TKM
Sbjct  461  KISTYTIGPFQTTNGEKAKVKVKVRLNLHGIVSLESATLLEEEEVDVPVSKEAAGENTKM  520

Query  182  ETDDIP-----PQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkk  340
            + D++P     P  S++T  NM++ K + DAS  E+ + ESG KP+Q +TD K +APKKK
Sbjct  521  DIDEVPAEAAAPPSSNDTGANMENGKASIDASGVEDGIPESGGKPLQTDTDTKVQAPKKK  580

Query  341  vkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLY  520
            VKKTN+PV EL+YGA+ P DVQKA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL 
Sbjct  581  VKKTNIPVVELIYGAMVPVDVQKALEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLN  640

Query  521  DKYQEFVVDSEKEQLIAKLQE  583
            DKYQEFV  SE++   AKLQE
Sbjct  641  DKYQEFVTASERDDFTAKLQE  661



>ref|XP_010417776.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Camelina 
sativa]
Length=829

 Score =   210 bits (535),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 169/198 (85%), Gaps = 5/198 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPV KEQL+E++KM
Sbjct  461  KISTYTIGPFQSSKGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPVSKEQLEETSKM  520

Query  182  ET--DDIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkk  349
            ET   +  P  S ++DVNMQD K   DA+  +N   ES DKPV METD+KAEAPKKKVKK
Sbjct  521  ETASSETAPA-SGDSDVNMQDAKEAIDAAGTDNGAPESTDKPVHMETDSKAEAPKKKVKK  579

Query  350  TNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKY  529
            TNVP+SE+VYGAL   +V+KAVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKY
Sbjct  580  TNVPLSEVVYGALKSVEVEKAVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKY  639

Query  530  QEFVVDSEKEQLIAKLQE  583
            QE++ D E+E  +AKLQE
Sbjct  640  QEYITDVEREAFLAKLQE  657



>ref|XP_010915054.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
Length=853

 Score =   211 bits (536),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 164/200 (82%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeq--lkeST  175
            KIS+YTIGPF+S KGERAKLK+KVRLNLHGIVS+ESA +LEEEEVEVPV   +   KE+T
Sbjct  461  KISSYTIGPFKSSKGERAKLKLKVRLNLHGIVSIESAIMLEEEEVEVPVSDAKEPSKEAT  520

Query  176  KMETDDIPPQDSSETDVNMQDDKVTSDAS----ENHVLESGDKPVQMETDakaeapkkkv  343
            KMETD+      +E D NMQD K  ++ S    EN   E+ +KPVQMETDAK E PKKKV
Sbjct  521  KMETDETSDPSRTENDENMQDVKTAAENSGAGVENGAPEAEEKPVQMETDAKVEVPKKKV  580

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTN+PVSELVYG +   D+QKAVE+EFEMALQDR+MEETKDKKNAVEAYVYDMRNKLYD
Sbjct  581  KKTNIPVSELVYGGMLAEDLQKAVEREFEMALQDRVMEETKDKKNAVEAYVYDMRNKLYD  640

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KYQ+FV  +EK++LIAKLQE
Sbjct  641  KYQDFVTATEKDELIAKLQE  660



>ref|XP_010417777.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X2 [Camelina 
sativa]
Length=829

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 169/198 (85%), Gaps = 5/198 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHG+VSVESATLLEEEEVEVPV KEQL+E++KM
Sbjct  461  KISTYTIGPFQSSKGERAKLKVKVRLNLHGVVSVESATLLEEEEVEVPVSKEQLEETSKM  520

Query  182  ET--DDIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkk  349
            ET   +  P  S ++DVNMQD K   DA+  +N   ES DKPV METD+KAEAPKKKVKK
Sbjct  521  ETASSETAPA-SGDSDVNMQDAKEAIDAAGTDNGAPESTDKPVHMETDSKAEAPKKKVKK  579

Query  350  TNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKY  529
            TNVP+SE+VYGAL   +V+KAVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKY
Sbjct  580  TNVPLSEVVYGALKSVEVEKAVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKY  639

Query  530  QEFVVDSEKEQLIAKLQE  583
            QE++ D E+E  +AKLQE
Sbjct  640  QEYITDVEREAFLAKLQE  657



>ref|XP_003597778.1| 97 kDa heat shock protein [Medicago truncatula]
 ref|XP_003597784.1| 97 kDa heat shock protein [Medicago truncatula]
 gb|AES68029.1| heat shock 70 kDa protein [Medicago truncatula]
Length=858

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 166/202 (82%), Gaps = 8/202 (4%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQ+  G++ K+K KVRLNLHGIVSVESATL EEEE+EVPV KE  +E+ KM
Sbjct  459  KISTYTIGPFQTKNGDKGKVKAKVRLNLHGIVSVESATLFEEEEIEVPVTKEFAEENAKM  518

Query  182  ETDDIPPQ------DSSETDVNMQDDKVTSD--ASENHVLESGDKPVQMETDakaeapkk  337
            ETD+ P         S++ DVNMQD K T+D   +EN + ++GDKPVQM+TD K EAPKK
Sbjct  519  ETDEAPADAAAPPPSSNDNDVNMQDAKATADTPGAENGLPDAGDKPVQMDTDTKVEAPKK  578

Query  338  kvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKL  517
            KVKKTN+PV+E+VYGA++  DVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL
Sbjct  579  KVKKTNIPVAEVVYGAMATVDVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKL  638

Query  518  YDKYQEFVVDSEKEQLIAKLQE  583
             DKYQEFVV SE++  I KLQE
Sbjct  639  NDKYQEFVVASERDGFITKLQE  660



>ref|XP_008793460.1| PREDICTED: heat shock 70 kDa protein 14-like [Phoenix dactylifera]
Length=854

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 166/201 (83%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeq--lkeST  175
            +IS+YTIGPFQS KGERAKLKVKVRLNLHGIVS+ESAT+LEEEEVEVPV   +   KE+T
Sbjct  461  RISSYTIGPFQSSKGERAKLKVKVRLNLHGIVSIESATMLEEEEVEVPVSDAKEPSKEAT  520

Query  176  KMETDDIPPQDSSETDVNMQDDK-VTSDAS----ENHVLESGDKPVQMETDakaeapkkk  340
            KM+TD+      +E   NMQD K V +D S    EN   E+ +KPVQMETDAK E PKKK
Sbjct  521  KMDTDETSDSSRTENHENMQDVKTVAADNSGAGVENGAPEAEEKPVQMETDAKVEVPKKK  580

Query  341  vkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLY  520
            VKKTN+PVSELVYG +S  D+QKAVE+EFEMALQDR+MEETKDKKNAVEAYVYDMRNKL+
Sbjct  581  VKKTNIPVSELVYGGMSAEDLQKAVEREFEMALQDRVMEETKDKKNAVEAYVYDMRNKLH  640

Query  521  DKYQEFVVDSEKEQLIAKLQE  583
            DKYQ+FV  SEK++LIAKLQ+
Sbjct  641  DKYQDFVTASEKDELIAKLQD  661



>gb|KHN47807.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=816

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 166/201 (83%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQ+  GERAK+KVKVRLNLHGIVS+ESATLLEEE+VEVPV KE   E+TKM
Sbjct  425  KISTYTIGPFQTTNGERAKVKVKVRLNLHGIVSLESATLLEEEKVEVPVTKEAAGENTKM  484

Query  182  ETDDIPPQD-----SSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkk  340
            + D++P +      S++T  NM+  K ++DAS  EN + E GDKP+Q +TD K +APKKK
Sbjct  485  DIDEVPAEAAAPPASNDTGANMEGAKASTDASGVENGIPEGGDKPLQKDTDTKVQAPKKK  544

Query  341  vkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLY  520
            VKKTN+PV+ELVYGA+ P DVQKA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL 
Sbjct  545  VKKTNIPVAELVYGAMVPVDVQKALEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLN  604

Query  521  DKYQEFVVDSEKEQLIAKLQE  583
            D+YQEFV  SE++   AKLQE
Sbjct  605  DEYQEFVTASERDDFTAKLQE  625



>ref|XP_003531683.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X1 [Glycine 
max]
Length=852

 Score =   208 bits (529),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 165/201 (82%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQ+  GERAK+KVKVRLNLHGIVS+ESATLLEEE+V VPV KE   E+TKM
Sbjct  461  KISTYTIGPFQTTNGERAKVKVKVRLNLHGIVSLESATLLEEEKVGVPVTKEAAGENTKM  520

Query  182  ETDDIPPQD-----SSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkk  340
            + D++P +      S++T  NM+  K ++DAS  EN + E GDKP+Q +TD K +APKKK
Sbjct  521  DIDEVPAEAAAPPASNDTGANMEGAKASTDASGVENGIPEGGDKPLQKDTDTKVQAPKKK  580

Query  341  vkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLY  520
            VKKTN+PV+ELVYGA+ P DVQKA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL 
Sbjct  581  VKKTNIPVAELVYGAMVPVDVQKALEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLN  640

Query  521  DKYQEFVVDSEKEQLIAKLQE  583
            D+YQEFV  SE++   AKLQE
Sbjct  641  DEYQEFVTASERDDFTAKLQE  661



>ref|XP_004141777.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis sativus]
 ref|XP_004168280.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis sativus]
 gb|KGN45354.1| hypothetical protein Csa_7G446710 [Cucumis sativus]
Length=843

 Score =   208 bits (529),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 167/200 (84%), Gaps = 10/200 (5%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KG R+K+KVKVRLNLHGIVSVESATLLEEE+V++PV +EQ     KM
Sbjct  458  KISTYTIGPFQSSKGGRSKVKVKVRLNLHGIVSVESATLLEEEDVDIPVTREQ---PAKM  514

Query  182  ETDDIP-----PQDSSETDVNMQDDKVTSDA-SENHVLESGDKPVQMETDakaeapkkkv  343
            ETD+ P     P  S+E DVNMQD K T+DA +EN   ES +  VQMETD+K EA KKKV
Sbjct  515  ETDEAPAETAAPPSSNENDVNMQDAKGTTDAGAENGSAES-EHSVQMETDSKVEAQKKKV  573

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTN+PV E++YG L+ ADVQKAVEKEFEMALQDR+MEETK+KKNAVEAYVY+MRNKL+D
Sbjct  574  KKTNIPVVEMIYGGLAAADVQKAVEKEFEMALQDRVMEETKEKKNAVEAYVYEMRNKLHD  633

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KYQ+FV +S++E+L AKLQE
Sbjct  634  KYQDFVTESQREELSAKLQE  653



>ref|XP_008462146.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis melo]
 ref|XP_008462147.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis melo]
Length=844

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 168/200 (84%), Gaps = 9/200 (5%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KG R+K+KVKVRLNLHGIVSVESATLLEEE+V++PV KEQ     KM
Sbjct  458  KISTYTIGPFQSSKGGRSKVKVKVRLNLHGIVSVESATLLEEEDVDIPVTKEQ---PAKM  514

Query  182  ETDDIPPQ-----DSSETDVNMQDDKVTSDA-SENHVLESGDKPVQMETDakaeapkkkv  343
            ETD+ P        S+E DVNMQD K T+DA +EN   ESG++ VQMETD+K EAPKKKV
Sbjct  515  ETDEAPADAAAPPSSNENDVNMQDAKGTTDAGAENGSAESGEQSVQMETDSKVEAPKKKV  574

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTN+PV EL+YG L+ ADVQKAVEKEFEMALQDR+MEETK+KKNAVEAYVY+MRNKL+D
Sbjct  575  KKTNIPVVELIYGGLAAADVQKAVEKEFEMALQDRVMEETKEKKNAVEAYVYEMRNKLHD  634

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KYQ+FV +S++E+L  KLQE
Sbjct  635  KYQDFVTESQREELSGKLQE  654



>ref|XP_006643833.1| PREDICTED: heat shock 70 kDa protein 14-like [Oryza brachyantha]
Length=843

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 160/199 (80%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlke-STK  178
            KISTYTIGPF   KG++AKLKVKVRLN+HG+VSVESAT+LEEEEVE+PVV     + STK
Sbjct  455  KISTYTIGPFHPSKGDKAKLKVKVRLNIHGVVSVESATMLEEEEVEIPVVATTEAKDSTK  514

Query  179  METDDIPPQDSSETDVNMQDDKVTSDAS----ENHVLESGDKPVQMETDakaeapkkkvk  346
            METD+ P + ++ TDVNMQ+ K ++DA+    EN    S +K V METDAK E  KKKVK
Sbjct  515  METDEAPNEAAAGTDVNMQEAKTSADAAAEGAENGTTNSEEKSVPMETDAKVEPSKKKVK  574

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            K NVPV+ELVYGAL   ++ KAVEKEFEMALQDR+MEETKDKKNAVE+YVYDMRNKLYDK
Sbjct  575  KINVPVAELVYGALGTKELDKAVEKEFEMALQDRVMEETKDKKNAVESYVYDMRNKLYDK  634

Query  527  YQEFVVDSEKEQLIAKLQE  583
            Y +FV   +KE LIAKLQE
Sbjct  635  YNDFVTSEDKEALIAKLQE  653



>emb|CDX76065.1| BnaA04g03290D [Brassica napus]
Length=814

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 162/196 (83%), Gaps = 16/196 (8%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRL LHGIVSVESATLLEEEEVEV V       + +M
Sbjct  461  KISTYTIGPFQSSKGERAKLKVKVRLTLHGIVSVESATLLEEEEVEVKVT------TEQM  514

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTN  355
            +TD    + S E+DVNMQD K TSDA+  +N V E    PVQMETD+KAEAPKKKVKKTN
Sbjct  515  DTD----KASGESDVNMQDAKETSDAAGTDNGVPE----PVQMETDSKAEAPKKKVKKTN  566

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            VP+SELVYGAL   +VQKAVEKE+EMALQDR+MEETKDKKNAVE+YVYDMRNKL DKY E
Sbjct  567  VPLSELVYGALQSVEVQKAVEKEYEMALQDRVMEETKDKKNAVESYVYDMRNKLSDKYHE  626

Query  536  FVVDSEKEQLIAKLQE  583
            ++++SE+E  +AKLQE
Sbjct  627  YIIESEREAFLAKLQE  642



>ref|XP_006585595.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Glycine 
max]
Length=850

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 159/201 (79%), Gaps = 9/201 (4%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQ+  GERAK+KVKVRLNLHGIVS+ESATLLEEE+V VPV KE   E+TKM
Sbjct  461  KISTYTIGPFQTTNGERAKVKVKVRLNLHGIVSLESATLLEEEKVGVPVTKEAAGENTKM  520

Query  182  ETDDIPPQD-----SSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkk  340
            + D++P +      S++T  NM+  K ++DAS  EN + E GDKP+Q +TD KA   K K
Sbjct  521  DIDEVPAEAAAPPASNDTGANMEGAKASTDASGVENGIPEGGDKPLQKDTDTKAPKKKVK  580

Query  341  vkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLY  520
               TN+PV+ELVYGA+ P DVQKA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL 
Sbjct  581  K--TNIPVAELVYGAMVPVDVQKALEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLN  638

Query  521  DKYQEFVVDSEKEQLIAKLQE  583
            D+YQEFV  SE++   AKLQE
Sbjct  639  DEYQEFVTASERDDFTAKLQE  659



>ref|XP_009139126.1| PREDICTED: heat shock 70 kDa protein 15 [Brassica rapa]
 ref|XP_009139127.1| PREDICTED: heat shock 70 kDa protein 15 [Brassica rapa]
Length=814

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 162/196 (83%), Gaps = 16/196 (8%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRL LHGIVSVESATLLEEEEVEV V       + +M
Sbjct  461  KISTYTIGPFQSSKGERAKLKVKVRLTLHGIVSVESATLLEEEEVEVKVT------AEQM  514

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTN  355
            +TD    + S E+DVNMQD K TSDA+  +N V E    PVQMETD+KAEAPKKKVKKTN
Sbjct  515  DTD----KASGESDVNMQDAKETSDAAGTDNGVPE----PVQMETDSKAEAPKKKVKKTN  566

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            VP+SELVYGAL   +VQKAVEKE+EMALQDR+MEETKDKKNAVE+YVYDMRNKL DKY E
Sbjct  567  VPLSELVYGALQSVEVQKAVEKEYEMALQDRVMEETKDKKNAVESYVYDMRNKLSDKYHE  626

Query  536  FVVDSEKEQLIAKLQE  583
            ++++SE+E  +AKLQE
Sbjct  627  YIIESEREAFLAKLQE  642



>ref|XP_010691292.1| PREDICTED: heat shock 70 kDa protein 15-like [Beta vulgaris subsp. 
vulgaris]
Length=850

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 167/205 (81%), Gaps = 11/205 (5%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS+YTIGPFQS  G+RAKLKV+VRLNLHGIV++ESATLLEEEEVEVPVVKE  KE+TKM
Sbjct  461  KISSYTIGPFQSSGGDRAKLKVRVRLNLHGIVAIESATLLEEEEVEVPVVKETTKEATKM  520

Query  182  ETDDIPPQDSS-ETDVNMQD--DKVTSDASENHVLESGDK--------PVQMETDakaea  328
            ETDD P + S+ E DVNMQD  D   + ++EN   ESG+K        PVQM+TDAKA+A
Sbjct  521  ETDDAPNETSTGEADVNMQDARDAAGAPSAENGAPESGEKSTPEADEKPVQMDTDAKADA  580

Query  329  pkkkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMR  508
             KKKVKKT VP+SE VYG LS  DVQKAVEKEFEMALQDR+MEETKD+KNAVEAYVYDMR
Sbjct  581  LKKKVKKTTVPLSETVYGGLSQGDVQKAVEKEFEMALQDRVMEETKDRKNAVEAYVYDMR  640

Query  509  NKLYDKYQEFVVDSEKEQLIAKLQE  583
            NKL DK  EFV  ++K+Q IA+LQE
Sbjct  641  NKLNDKLYEFVTPADKDQFIARLQE  665



>ref|XP_004960855.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Setaria 
italica]
Length=845

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 161/199 (81%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevev--pvvkeqlkeST  175
            KISTYTIGPFQS  GE+AKLK+KVRLN+HGIVSVESAT+LEEEEVEV      E  KE+T
Sbjct  455  KISTYTIGPFQSSNGEKAKLKLKVRLNIHGIVSVESATMLEEEEVEVPVSATNEAQKEAT  514

Query  176  KMETDDIPPQDSSETDVNMQDDKV---TSDASENHVLESGDKPVQMETDakaeapkkkvk  346
            KM+TDD P   +S TDVNMQ+ K    T++ +EN    S +K V M+TDAKAE  KKKVK
Sbjct  515  KMDTDDAPNDPASGTDVNMQESKGATDTAEGAENGAPTSEEKTVPMDTDAKAEPSKKKVK  574

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTNVPVSELVYGAL  A++ KAVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDK
Sbjct  575  KTNVPVSELVYGALGAAELDKAVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDK  634

Query  527  YQEFVVDSEKEQLIAKLQE  583
            Y +FV   +KE LI+KLQE
Sbjct  635  YGDFVTPEDKEGLISKLQE  653



>ref|XP_003543647.1| PREDICTED: heat shock 70 kDa protein 14-like [Glycine max]
Length=863

 Score =   202 bits (515),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 164/207 (79%), Gaps = 13/207 (6%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvv-keqlkeSTK  178
            KISTYTIGPFQS K E+AK+KVKVRLN+HGI+SVESATLLEEEE     V KE   E++K
Sbjct  461  KISTYTIGPFQSTKNEKAKVKVKVRLNVHGIISVESATLLEEEEEIEVPVYKEPAGENSK  520

Query  179  METDDIPPQ--------DSSETDVNMQD--DKVTSDA--SENHVLESGDKPVQMETDaka  322
            METD+ P           +++ DV+MQD   K T++A  +EN   E+GDKPVQM+TD K 
Sbjct  521  METDEAPADAAAAAATPSTNDNDVSMQDANTKATANAPGAENGTPEAGDKPVQMDTDTKV  580

Query  323  eapkkkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYD  502
            EAPKKKVKK N+PV ELVYGA++  DVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYD
Sbjct  581  EAPKKKVKKINIPVVELVYGAMAATDVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYD  640

Query  503  MRNKLYDKYQEFVVDSEKEQLIAKLQE  583
            MRNKL DKYQEFV+DSE+E   AKLQE
Sbjct  641  MRNKLNDKYQEFVIDSEREAFTAKLQE  667



>ref|XP_009389931.1| PREDICTED: heat shock 70 kDa protein 14-like [Musa acuminata 
subsp. malaccensis]
Length=849

 Score =   202 bits (514),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 163/201 (81%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeql--keST  175
            KISTYTIGPF S KGE+AKLKVKV LNLHGIVS+ESAT+LEEEEVEVPV       KEST
Sbjct  461  KISTYTIGPFLSSKGEKAKLKVKVHLNLHGIVSIESATMLEEEEVEVPVSAAVEPPKEST  520

Query  176  KMETDDIPPQDS-SETDVNMQDDKVTSDASENHV----LESGDKPVQMETDakaeapkkk  340
            KM+ D++    S +ETDV M+D K  ++ S   V     ES +KP QMETD K EAP+KK
Sbjct  521  KMDMDELTNDVSKTETDVKMEDSKNAANNSSGEVDTAVPESDEKPAQMETDNKVEAPRKK  580

Query  341  vkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLY  520
            VKKTNVPV ELVYG +S  D+QKAVEKEFEMALQDR+MEETK+KKNAVEAYVYD+RNKLY
Sbjct  581  VKKTNVPVVELVYGGMSAEDLQKAVEKEFEMALQDRVMEETKEKKNAVEAYVYDIRNKLY  640

Query  521  DKYQEFVVDSEKEQLIAKLQE  583
            DKYQEFV+ SEK++LIAKLQE
Sbjct  641  DKYQEFVMPSEKDELIAKLQE  661



>ref|XP_010925584.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
 ref|XP_010932975.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
Length=852

 Score =   202 bits (513),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 156/200 (78%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlle--eeevevpvvkeqlkeST  175
            KISTYTIGPFQS  G RAKLKVKVRLNLHGI+SVESAT+LE  E EV V   KE  KEST
Sbjct  461  KISTYTIGPFQSTTGARAKLKVKVRLNLHGIISVESATMLEDEEVEVPVSAAKEPPKEST  520

Query  176  KMETDDIPPQDSSETDVNMQDDKVTSDAS----ENHVLESGDKPVQMETDakaeapkkkv  343
            KM+TD+      +E   NMQD K T++ S    EN    SG+K VQMETDAK E  KKKV
Sbjct  521  KMDTDEATNNSVTENGANMQDAKSTTEVSDAGVENGASVSGEKCVQMETDAKVEPSKKKV  580

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKT+V V+ELVYG L+  D+QKAVEKE EMALQDR+MEETKDKKNAVEAYVYDMRNKL+D
Sbjct  581  KKTDVQVAELVYGGLAADDLQKAVEKELEMALQDRVMEETKDKKNAVEAYVYDMRNKLHD  640

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KYQ+FV +SE+EQ  AKLQE
Sbjct  641  KYQDFVTESEREQFTAKLQE  660



>ref|XP_002440718.1| hypothetical protein SORBIDRAFT_09g005570 [Sorghum bicolor]
 gb|EES19148.1| hypothetical protein SORBIDRAFT_09g005570 [Sorghum bicolor]
Length=851

 Score =   202 bits (513),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 152/200 (76%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlke-STK  178
            KISTYTIGPFQ  KGE+AKLKVKVRLN+HGIV+V+SAT+LEE+         +  + +TK
Sbjct  455  KISTYTIGPFQPSKGEKAKLKVKVRLNIHGIVTVDSATMLEEDVEVPVSSANEAPKDTTK  514

Query  179  METDDIPPQDSSETDVNMQDDKVT-----SDASENHVLESGDKPVQMETDakaeapkkkv  343
            M+TDD P    S TDVNM + K       + A+EN   +  +K V METDAK E  K+KV
Sbjct  515  MDTDDAPSDPVSGTDVNMHEPKSADTTEAAPAAENGAQDPEEKSVPMETDAKVEPSKRKV  574

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKT+VPV ELVYGAL+  D+QKAVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYD
Sbjct  575  KKTSVPVHELVYGALAAVDLQKAVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYD  634

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY +FV   EKE LIAKLQE
Sbjct  635  KYSDFVTSEEKEGLIAKLQE  654



>ref|XP_008775317.1| PREDICTED: heat shock 70 kDa protein 14-like [Phoenix dactylifera]
Length=852

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 158/200 (79%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlle--eeevevpvvkeqlkeST  175
            KISTYTIGPFQ   GERAKLKVKVRLNLHGI+SVESAT+LE  E EV V   KE  KEST
Sbjct  461  KISTYTIGPFQLTTGERAKLKVKVRLNLHGIISVESATMLEDEEVEVPVSATKEPPKEST  520

Query  176  KMETDDIPPQDSSETDVNMQDDKVTSDASENHVLE----SGDKPVQMETDakaeapkkkv  343
            KM+TD+      +E DVNMQD K T++ S+  V      S +K VQMETDAK E  KKKV
Sbjct  521  KMDTDEATNNSVTENDVNMQDAKSTTEVSDAGVQNGEPVSEEKLVQMETDAKVEPSKKKV  580

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKT+VPV+EL+YG L+ A++QKAVEKE EMALQDR+MEETKDKKNAVE YVYDMRNKL+D
Sbjct  581  KKTDVPVAELIYGGLAAAELQKAVEKELEMALQDRVMEETKDKKNAVETYVYDMRNKLHD  640

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KYQ+FV +SE+EQ  AKLQE
Sbjct  641  KYQDFVTESEREQFTAKLQE  660



>ref|XP_002304187.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE79166.1| heat shock protein 70 [Populus trichocarpa]
Length=858

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 161/200 (81%), Gaps = 7/200 (4%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQ  K ERAK+KVKVRL+LHGIVSVESATLLEEEEVEVPVVKE  KE TKM
Sbjct  461  KISTYTIGPFQCTKSERAKVKVKVRLSLHGIVSVESATLLEEEEVEVPVVKEPAKEPTKM  520

Query  182  ETD----DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            +TD    D      +E D NMQD+K  +DAS  EN V ES DKP QMETD K EAPKKKV
Sbjct  521  DTDESLSDATTTGPNEADDNMQDEKAAADASGTENGVPES-DKPTQMETDTKVEAPKKKV  579

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTN+PVSE+VYG +  A+VQK +EKE+EMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  580  KKTNIPVSEVVYGGIPAAEVQKLLEKEYEMALQDRVMEETKDKKNAVEAYVYDMRNKLSD  639

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY EFV D E+E   AKLQE
Sbjct  640  KYHEFVPDLEREGFTAKLQE  659



>gb|KEH28782.1| heat shock 70 kDa protein [Medicago truncatula]
Length=851

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 155/201 (77%), Gaps = 8/201 (4%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +ISTYTIGPF++ + E+AK+KVKVRLN+HGI SV+ AT+LEEEEVE  V KE  KE TKM
Sbjct  461  RISTYTIGPFEAKQSEKAKVKVKVRLNVHGIASVDLATVLEEEEVEASVSKESAKEPTKM  520

Query  182  ETDDIPPQ-----DSSETDVNMQDDKVTSD--ASENHVLESGDKPVQMETDakaeapkkk  340
            E D+ P       + ++ DVNMQD K  +D    EN V E+GDKP QM+ D      KK 
Sbjct  521  EADEAPADPAAPPNGNDADVNMQDAKANADTPGVENGVPETGDKPAQMDVDDTKAPKKKV  580

Query  341  vkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLY  520
             K TNVPV+ELVYGA++P DVQKAVEKE+EMALQDR+MEETKDKKNAVEAYVYDMRNKL 
Sbjct  581  KK-TNVPVAELVYGAMAPVDVQKAVEKEYEMALQDRVMEETKDKKNAVEAYVYDMRNKLN  639

Query  521  DKYQEFVVDSEKEQLIAKLQE  583
            DKYQEFV+ SE+E L AKLQE
Sbjct  640  DKYQEFVIASEREGLTAKLQE  660



>gb|AAG52244.1|AC011717_12 putative heat-shock protein; 41956-44878 [Arabidopsis thaliana]
Length=736

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 157/182 (86%), Gaps = 5/182 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSVESATLLEEEEVEV V K+Q +E+ KM
Sbjct  461  KISTYTIGPFQSSKGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVSVTKDQSEETAKM  520

Query  182  ETDDIPPQD---SSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvk  346
            +TD    +    S ++DVNMQD K TSDA+  +N V ES +KPVQMETD+KA+APKKKVK
Sbjct  521  DTDKASAEAAPASGDSDVNMQDAKDTSDATGTDNGVPESAEKPVQMETDSKAKAPKKKVK  580

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTNVP+SELVYGAL   +V+KAVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DK
Sbjct  581  KTNVPLSELVYGALKTVEVEKAVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDK  640

Query  527  YQ  532
            YQ
Sbjct  641  YQ  642



>emb|CDY43337.1| BnaC04g25190D [Brassica napus]
Length=889

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 161/196 (82%), Gaps = 16/196 (8%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRL LHGIVSVESATLLEEEEVEV V       + +M
Sbjct  536  KISTYTIGPFQSSKGERAKLKVKVRLTLHGIVSVESATLLEEEEVEVKVT------AEQM  589

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTN  355
            +TD    + S E+DVNMQD K TSDA+  +N V E    PVQMETD+KAEAPKKKVKKTN
Sbjct  590  DTD----KASGESDVNMQDAKETSDAAGTDNGVPE----PVQMETDSKAEAPKKKVKKTN  641

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            VP+SELVYGAL   +VQKAVEKE+EMALQDR+MEETKDKKNAVE+YVYDMRNKL +KY E
Sbjct  642  VPLSELVYGALQSVEVQKAVEKEYEMALQDRVMEETKDKKNAVESYVYDMRNKLSEKYHE  701

Query  536  FVVDSEKEQLIAKLQE  583
            ++ +SE+E  +AKLQE
Sbjct  702  YMTESEREAFLAKLQE  717



>ref|NP_001151579.1| heat shock 70 kDa protein 4 [Zea mays]
 gb|ACN33614.1| unknown [Zea mays]
Length=848

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 149/197 (76%), Gaps = 3/197 (2%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlke-STK  178
            KISTYTIGPFQ  KGERAKLKVKVRLN+HGIV+V+SA +LEE+         +  + +TK
Sbjct  455  KISTYTIGPFQPSKGERAKLKVKVRLNIHGIVTVDSAMMLEEDVAVPVSSANEAPKDTTK  514

Query  179  METDDIPPQDSSETDVNMQDDKVT--SDASENHVLESGDKPVQMETDakaeapkkkvkkT  352
            M+TDD P    S TDVN+ +   T  + A+EN      +K V METDAK E  K+KVK+T
Sbjct  515  MDTDDAPSDPVSGTDVNVHEPDTTEAAPAAENGTQNPEEKSVPMETDAKVEPSKRKVKRT  574

Query  353  NVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQ  532
            +VPV  LVYGAL+ AD+QKAVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYD+Y 
Sbjct  575  SVPVHALVYGALAAADLQKAVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDRYN  634

Query  533  EFVVDSEKEQLIAKLQE  583
            +FV   EKE LI KLQE
Sbjct  635  DFVTPEEKEGLIGKLQE  651



>gb|ACG43420.1| heat shock 70 kDa protein 4 [Zea mays]
 gb|ACL52695.1| unknown [Zea mays]
 gb|AFW81562.1| heat shock protein 4 [Zea mays]
Length=848

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 149/197 (76%), Gaps = 3/197 (2%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlke-STK  178
            KISTYTIGPFQ  KGERAKLKVKVRLN+HGIV+V+SA +LEE+         +  + +TK
Sbjct  455  KISTYTIGPFQPSKGERAKLKVKVRLNIHGIVTVDSAMMLEEDVAVPVSSANEAPKDTTK  514

Query  179  METDDIPPQDSSETDVNMQDDKVT--SDASENHVLESGDKPVQMETDakaeapkkkvkkT  352
            M+TDD P    S TDVN+ +   T  + A+EN      +K V METDAK E  K+KVK+T
Sbjct  515  MDTDDAPSDPVSGTDVNVHEPDTTEAAPAAENGTQNPEEKSVPMETDAKVEPSKRKVKRT  574

Query  353  NVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQ  532
            +VPV  LVYGAL+ AD+QKAVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYD+Y 
Sbjct  575  SVPVHALVYGALAAADLQKAVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDRYN  634

Query  533  EFVVDSEKEQLIAKLQE  583
            +FV   EKE LI KLQE
Sbjct  635  DFVTPEEKEGLIGKLQE  651



>ref|XP_008655087.1| PREDICTED: heat shock 70 kDa protein 4 isoform X1 [Zea mays]
Length=875

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 149/197 (76%), Gaps = 3/197 (2%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlke-STK  178
            KISTYTIGPFQ  KGERAKLKVKVRLN+HGIV+V+SA +LEE+         +  + +TK
Sbjct  455  KISTYTIGPFQPSKGERAKLKVKVRLNIHGIVTVDSAMMLEEDVAVPVSSANEAPKDTTK  514

Query  179  METDDIPPQDSSETDVNMQDDKVT--SDASENHVLESGDKPVQMETDakaeapkkkvkkT  352
            M+TDD P    S TDVN+ +   T  + A+EN      +K V METDAK E  K+KVK+T
Sbjct  515  MDTDDAPSDPVSGTDVNVHEPDTTEAAPAAENGTQNPEEKSVPMETDAKVEPSKRKVKRT  574

Query  353  NVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQ  532
            +VPV  LVYGAL+ AD+QKAVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYD+Y 
Sbjct  575  SVPVHALVYGALAAADLQKAVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDRYN  634

Query  533  EFVVDSEKEQLIAKLQE  583
            +FV   EKE LI KLQE
Sbjct  635  DFVTPEEKEGLIGKLQE  651



>ref|NP_001137020.1| uncharacterized protein LOC100217188 [Zea mays]
 gb|ACF83092.1| unknown [Zea mays]
Length=479

 Score =   195 bits (495),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 148/200 (74%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeST-K  178
            KISTYTIGPFQ+ KGE+AKLKVKVRLN+HG V+V+SA +LE++         +    T K
Sbjct  92   KISTYTIGPFQTSKGEKAKLKVKVRLNIHGTVTVDSAIMLEDDVEVPVSSANEAPNDTMK  151

Query  179  METDDIPPQDSSETDVNMQDDKVTSDASENHVLESG-----DKPVQMETDakaeapkkkv  343
            M+TDD P   +  +DVNMQ+ K    A   H  E+G     +K V METDAK E  KKKV
Sbjct  152  MDTDDAPSDPAVASDVNMQEPKSADTAEAAHAAENGPQDTEEKSVPMETDAKVEPSKKKV  211

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KK  VPV ELVYGAL+ AD+QKAVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYD
Sbjct  212  KKITVPVHELVYGALAAADLQKAVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYD  271

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY +FV   +KE LIAKLQE
Sbjct  272  KYSDFVTSEDKEGLIAKLQE  291



>ref|XP_002299641.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE84446.1| heat shock protein 70 [Populus trichocarpa]
Length=852

 Score =   199 bits (506),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 161/200 (81%), Gaps = 7/200 (4%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS K ERAK+KVKVRLNLHGIVSVESATLLEEEEVEVPV KE  KE  KM
Sbjct  461  KISTYTIGPFQSTKSERAKVKVKVRLNLHGIVSVESATLLEEEEVEVPVTKEPAKEPAKM  520

Query  182  ETDDIPPQDSS----ETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            +TD+ P   ++    E D NM+++K  +D S  EN V E+ DKP QMETD K E PKKKV
Sbjct  521  DTDEAPSDAATKGPKEADANMEEEKSAADVSGAENGVPEA-DKPTQMETDTKVEVPKKKV  579

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTN+PVSE+VYG +  A+V+K +EKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKL D
Sbjct  580  KKTNIPVSEVVYGGILAAEVEKLLEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLSD  639

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            +YQEFV D E+E   AKLQE
Sbjct  640  RYQEFVTDPEREGFTAKLQE  659



>ref|XP_011000830.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Populus 
euphratica]
 ref|XP_011000831.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Populus 
euphratica]
Length=859

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 161/200 (81%), Gaps = 7/200 (4%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQ  K ERAK+KVKVRL+LHG+VSVESATLLEEEEVEVPVVKE  KE TKM
Sbjct  461  KISTYTIGPFQCTKSERAKVKVKVRLSLHGVVSVESATLLEEEEVEVPVVKEPAKEPTKM  520

Query  182  ETD----DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            +TD    D      +E D NMQ++K  +DAS  EN V ES DKP QMETD K EAPKKKV
Sbjct  521  DTDESLSDAATTGPNEADDNMQEEKAAADASGAENGVPES-DKPTQMETDTKVEAPKKKV  579

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTN+PVSE+VYG +  A+VQK +EKE+EMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  580  KKTNIPVSEVVYGGIPAAEVQKLLEKEYEMALQDRVMEETKDKKNAVEAYVYDMRNKLSD  639

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY EFV D E+E   AKLQE
Sbjct  640  KYHEFVPDLEREGFTAKLQE  659



>ref|NP_001042210.1| Os01g0180800 [Oryza sativa Japonica Group]
 dbj|BAB32902.1| putative heat shock protein [Oryza sativa Japonica Group]
 dbj|BAB33024.1| putative heat shock protein [Oryza sativa Japonica Group]
 dbj|BAF04124.1| Os01g0180800 [Oryza sativa Japonica Group]
 gb|EAZ10794.1| hypothetical protein OsJ_00630 [Oryza sativa Japonica Group]
 gb|ADR66977.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=845

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 158/200 (79%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlke--ST  175
            KISTYT+GPF  GKG++AKLKVKVRLN+HG+V+VESAT+LEEEEVEVPV         S 
Sbjct  455  KISTYTVGPFNPGKGDKAKLKVKVRLNIHGVVTVESATMLEEEEVEVPVAATTEPPKDSA  514

Query  176  KMETDDIPPQDSSETDVNMQDDKVTSDAS----ENHVLESGDKPVQMETDakaeapkkkv  343
            KMETDD P + +S TDVNMQ+ K  +DA+    EN    S +K V METDAK E  KKKV
Sbjct  515  KMETDDAPNEAASGTDVNMQEAKAPADAAADGAENGAPNSEEKSVPMETDAKVEPSKKKV  574

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTNVPV+ELVYGAL   ++QKAVEKE+EMALQDR+MEETKDKKNAVE+YVYDMRNKLYD
Sbjct  575  KKTNVPVAELVYGALGTTELQKAVEKEYEMALQDRVMEETKDKKNAVESYVYDMRNKLYD  634

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY +FV   +KE  IAKLQE
Sbjct  635  KYNDFVTAEDKEAFIAKLQE  654



>ref|XP_011000832.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Populus 
euphratica]
Length=789

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 161/200 (81%), Gaps = 7/200 (4%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQ  K ERAK+KVKVRL+LHG+VSVESATLLEEEEVEVPVVKE  KE TKM
Sbjct  461  KISTYTIGPFQCTKSERAKVKVKVRLSLHGVVSVESATLLEEEEVEVPVVKEPAKEPTKM  520

Query  182  ETD----DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            +TD    D      +E D NMQ++K  +DAS  EN V ES DKP QMETD K EAPKKKV
Sbjct  521  DTDESLSDAATTGPNEADDNMQEEKAAADASGAENGVPES-DKPTQMETDTKVEAPKKKV  579

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTN+PVSE+VYG +  A+VQK +EKE+EMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  580  KKTNIPVSEVVYGGIPAAEVQKLLEKEYEMALQDRVMEETKDKKNAVEAYVYDMRNKLSD  639

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY EFV D E+E   AKLQE
Sbjct  640  KYHEFVPDLEREGFTAKLQE  659



>ref|XP_004506857.1| PREDICTED: heat shock 70 kDa protein 15-like [Cicer arietinum]
Length=849

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 154/203 (76%), Gaps = 10/203 (5%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +ISTYTIGPF++ + E+AK+KVK RLN+HGIVSV+ ATLLEEEEVEV V KE  +E+TK 
Sbjct  461  RISTYTIGPFETKQNEKAKVKVKARLNVHGIVSVDLATLLEEEEVEVSVSKESARETTKT  520

Query  182  ETDDIPP-------QDSSETDVNMQDDKVTSD--ASENHVLESGDKPVQMETDakaeapk  334
            + D+ P         + ++ DVNMQD K  +D    EN V E+GDKPVQM+ D      K
Sbjct  521  DADETPADVAAPPTSNDNDADVNMQDAKANADNPGVENGVPETGDKPVQMDVDDTKAPKK  580

Query  335  kkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNK  514
            K  K TNVP++ELVYGA++P DVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYD RNK
Sbjct  581  KVKK-TNVPIAELVYGAMAPVDVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDTRNK  639

Query  515  LYDKYQEFVVDSEKEQLIAKLQE  583
            L DKY +FV  SE+E L AKLQE
Sbjct  640  LNDKYHDFVTASEREDLTAKLQE  662



>ref|XP_011013254.1| PREDICTED: heat shock 70 kDa protein 15-like [Populus euphratica]
Length=852

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 161/200 (81%), Gaps = 7/200 (4%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS K ERAK+KVKVRLNLHGIVSVESATLLEEEEVEVPV KE  KE  KM
Sbjct  461  KISTYTIGPFQSTKSERAKVKVKVRLNLHGIVSVESATLLEEEEVEVPVTKEPAKEPAKM  520

Query  182  ETDDIPPQDSS----ETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            +TD+ P   ++    E D NM++ K  +D S  EN V E+ DKP QMETD K EAPKKKV
Sbjct  521  DTDEAPSDAATKGPEEADANMEEAKPAADVSGAENGVPEA-DKPTQMETDTKVEAPKKKV  579

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTN+PVSE+VYG +  A+V+K +EKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKL D
Sbjct  580  KKTNIPVSEVVYGGILAAEVEKLLEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLSD  639

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            +YQEFV D E+E   AKLQE
Sbjct  640  RYQEFVTDPEREGFTAKLQE  659



>gb|KHN32604.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=862

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 164/206 (80%), Gaps = 12/206 (6%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvv-keqlkeSTK  178
            KISTYTIGPFQS K E+AK+KVKVRLN+HGI+SVESATLLEEEE     V KE   E++K
Sbjct  461  KISTYTIGPFQSTKNEKAKVKVKVRLNVHGIISVESATLLEEEEEIEVPVYKEPAGENSK  520

Query  179  METDDIPPQ-------DSSETDVNMQD--DKVTSDA--SENHVLESGDKPVQMETDakae  325
            METD+ P          +++ DV+MQD   K T++A  +EN   E+GDKPVQM+TD K E
Sbjct  521  METDEAPADAAAAATPSTNDNDVSMQDANTKATANAPGAENGTPEAGDKPVQMDTDTKVE  580

Query  326  apkkkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDM  505
            APKKKVKK N+PV ELVYGA++  DVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDM
Sbjct  581  APKKKVKKINIPVVELVYGAMAATDVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDM  640

Query  506  RNKLYDKYQEFVVDSEKEQLIAKLQE  583
            RNKL DKYQEFV+DSE+E   AKLQE
Sbjct  641  RNKLNDKYQEFVIDSEREAFTAKLQE  666



>ref|XP_004506856.1| PREDICTED: heat shock 70 kDa protein 15-like [Cicer arietinum]
Length=851

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 156/203 (77%), Gaps = 10/203 (5%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +ISTYTIGPF++ + E+AK+KVK RLN+HGIVSV+ ATLLEEEEVEV V KE  +E+TK+
Sbjct  461  RISTYTIGPFETKQNEKAKVKVKARLNVHGIVSVDLATLLEEEEVEVSVSKESARETTKI  520

Query  182  ETDDIPP-------QDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapk  334
              D+ P         ++S+ DVNMQD K ++D    EN V E+G+KPVQM+ D      K
Sbjct  521  NADEAPADASAPPTSNNSDGDVNMQDAKASADTPVVENGVPETGEKPVQMDVDETKAPKK  580

Query  335  kkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNK  514
            K  K TNVP++ELVYGA++P DVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVY+ RNK
Sbjct  581  KVKK-TNVPIAELVYGAMAPVDVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYETRNK  639

Query  515  LYDKYQEFVVDSEKEQLIAKLQE  583
            L DKY +FV  SE+E L AKLQE
Sbjct  640  LNDKYHDFVTASEREDLTAKLQE  662



>gb|KDO51188.1| hypothetical protein CISIN_1g003056mg [Citrus sinensis]
Length=833

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 155/191 (81%), Gaps = 15/191 (8%)
 Frame = +2

Query  47   ERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP----PQDSS  214
            ERAK+KVKVRLN+HGIVS+ESATLLEEEEVEVPV KE  KE+ KMETD++P    P  SS
Sbjct  457  ERAKVKVKVRLNMHGIVSIESATLLEEEEVEVPVTKEPEKEAAKMETDEVPSDAAPPSSS  516

Query  215  ETDVNMQDDKVTSDA--------SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSE  370
            ETDVNMQD K T+DA        +EN V ESGDKP QMET    + PKKKVKKTN+PVSE
Sbjct  517  ETDVNMQDAKGTADAQGTTDAPGAENGVPESGDKPTQMET---DKTPKKKVKKTNIPVSE  573

Query  371  LVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDS  550
            LVYG + P DVQKAVEKEFEMALQDR+MEETKD+KNAVEAYVYDMRNKL DKYQ+FV DS
Sbjct  574  LVYGGMLPVDVQKAVEKEFEMALQDRVMEETKDRKNAVEAYVYDMRNKLCDKYQDFVTDS  633

Query  551  EKEQLIAKLQE  583
            E+E   +KLQE
Sbjct  634  ERELFTSKLQE  644



>ref|XP_009399777.1| PREDICTED: heat shock 70 kDa protein 14-like [Musa acuminata 
subsp. malaccensis]
Length=851

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 167/201 (83%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvke--qlkeST  175
            KISTYTIGPFQS KGER KLKVKVRL+LHGI+SVESA +LEEEEVEVPV       KEST
Sbjct  461  KISTYTIGPFQSSKGERVKLKVKVRLSLHGIISVESAVMLEEEEVEVPVSAAPELPKEST  520

Query  176  KMETDDIPPQDS-SETDVNMQDDKVTSDAS----ENHVLESGDKPVQMETDakaeapkkk  340
            KM+TD+   + S +ETD+NM+D K  S++S    +N V ES DKPV+METD K EA KKK
Sbjct  521  KMDTDEAVNEASKTETDLNMEDAKSASNSSASGVDNGVPESNDKPVEMETDNKVEATKKK  580

Query  341  vkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLY  520
            VKKTNVPV ELVYG +S  ++QKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKLY
Sbjct  581  VKKTNVPVVELVYGGMSAEELQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLY  640

Query  521  DKYQEFVVDSEKEQLIAKLQE  583
            DKYQEFV  SEK++LIAKLQ+
Sbjct  641  DKYQEFVTPSEKDELIAKLQQ  661



>ref|XP_008647466.1| PREDICTED: uncharacterized protein LOC100217188 isoform X1 [Zea 
mays]
 gb|AFW77385.1| heat shock protein 4 [Zea mays]
Length=841

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 146/200 (73%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHG-IvsvesatlleeeevevpvvkeqlkeSTK  178
            KISTYTIGPFQ+ KGE+AKLKVKVRLN+HG +    +  L ++ EV V    E   ++ K
Sbjct  454  KISTYTIGPFQTSKGEKAKLKVKVRLNIHGTVTVDSAIMLEDDVEVPVSSANEAPNDTMK  513

Query  179  METDDIPPQDSSETDVNMQDDKVTSDASENHVLESG-----DKPVQMETDakaeapkkkv  343
            M+TDD P   +  +DVNMQ+ K    A   H  E+G     +K V METDAK E  KKKV
Sbjct  514  MDTDDAPSDPAVASDVNMQEPKSADTAEAAHAAENGPQDTEEKSVPMETDAKVEPSKKKV  573

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KK  VPV ELVYGAL+ AD+QKAVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYD
Sbjct  574  KKITVPVHELVYGALAAADLQKAVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYD  633

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY +FV   +KE LIAKLQE
Sbjct  634  KYSDFVTSEDKEGLIAKLQE  653



>ref|XP_007135698.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
 ref|XP_007135699.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
 gb|ESW07692.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
 gb|ESW07693.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
Length=841

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 152/198 (77%), Gaps = 6/198 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQ+   ER K+KVKVRLN+HGIVS+ESA LLEE+EVEVP+ KE   E+TK 
Sbjct  461  KISTYTIGPFQTANSERTKVKVKVRLNIHGIVSLESAMLLEEKEVEVPITKEAAGENTKP  520

Query  182  ETDDI---PPQDSSETDVNMQDDKV-TSDASENHVLESGDKPVQMETDakaeapkkkvkk  349
                +    P  S++T  N+QD+KV T+  +EN V E+GDKP Q  TD KA   K K   
Sbjct  521  NEAPVEVATPPASNDTSANVQDEKVSTASGAENGVPENGDKPSQTNTDTKAPKKKVKK--  578

Query  350  TNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKY  529
            T++ +SE+VYGA+ P DVQKA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKY
Sbjct  579  TSISISEVVYGAMVPLDVQKAIEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDKY  638

Query  530  QEFVVDSEKEQLIAKLQE  583
            QEFV+ SE+E   AKLQE
Sbjct  639  QEFVIASEREDFTAKLQE  656



>ref|XP_010231644.1| PREDICTED: heat shock 70 kDa protein 15-like [Brachypodium distachyon]
Length=836

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 161/198 (81%), Gaps = 9/198 (5%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KG++AKLKVKVRLN+HGIVS+ESAT+LEEEEVEVPV  E  K++TKM
Sbjct  455  KISTYTIGPFQSSKGDKAKLKVKVRLNIHGIVSLESATMLEEEEVEVPVTSEVPKDATKM  514

Query  182  ETDDIPPQDSSETDVNMQDDKVTSD----ASENHVLESGDKPVQMETDakaeapkkkvkk  349
            +TDD     ++ TDVNMQ+ K  +D    A+EN   +S +K V M+TD K E  KKKVKK
Sbjct  515  DTDD-----ATGTDVNMQESKGATDTAEGAAENGAQDSEEKSVPMDTDTKVEPSKKKVKK  569

Query  350  TNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKY  529
            TNVPV+ELVYGA+S A+++KAVEKE+EMALQDR+MEETKDKKN+VEAYVYDMRNKL +KY
Sbjct  570  TNVPVTELVYGAMSAAELEKAVEKEYEMALQDRVMEETKDKKNSVEAYVYDMRNKLSEKY  629

Query  530  QEFVVDSEKEQLIAKLQE  583
             +FV+  + E L  KLQE
Sbjct  630  NDFVMSEDMEGLRVKLQE  647



>ref|XP_004960853.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Setaria 
italica]
Length=850

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 155/202 (77%), Gaps = 9/202 (4%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatllee--eevevpvvkeqlkeST  175
            KISTYTIGPFQ  KGE+AKLKVKVRLN+HGIV+V+SA +LEE   EV V  V E  K++T
Sbjct  455  KISTYTIGPFQPSKGEKAKLKVKVRLNIHGIVTVDSALMLEEDDVEVPVSSVNEAPKDAT  514

Query  176  KMETDDIPPQDSSETDVNMQDDKVTSDASENHVLESG------DKPVQMETDakaeapkk  337
            KM+TDD P   SS TDVNMQ+ K ++D +E             +K V METDAK E  KK
Sbjct  515  KMDTDDAPSDPSSGTDVNMQEPK-SADTTEGAAAAENGAQDPEEKSVPMETDAKVEPSKK  573

Query  338  kvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKL  517
            KVKKT VPV ELVYGAL  A+++KAVEKE+EMALQDRIMEETK+KKNAVEAYVYDMRNKL
Sbjct  574  KVKKTAVPVHELVYGALPAAELEKAVEKEYEMALQDRIMEETKEKKNAVEAYVYDMRNKL  633

Query  518  YDKYQEFVVDSEKEQLIAKLQE  583
            YDKY +FV   EKE LI++LQE
Sbjct  634  YDKYNDFVTPEEKEGLISRLQE  655



>ref|XP_004960852.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X1 [Setaria 
italica]
Length=878

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 155/202 (77%), Gaps = 9/202 (4%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatllee--eevevpvvkeqlkeST  175
            KISTYTIGPFQ  KGE+AKLKVKVRLN+HGIV+V+SA +LEE   EV V  V E  K++T
Sbjct  455  KISTYTIGPFQPSKGEKAKLKVKVRLNIHGIVTVDSALMLEEDDVEVPVSSVNEAPKDAT  514

Query  176  KMETDDIPPQDSSETDVNMQDDKVTSDASENHVLESG------DKPVQMETDakaeapkk  337
            KM+TDD P   SS TDVNMQ+ K ++D +E             +K V METDAK E  KK
Sbjct  515  KMDTDDAPSDPSSGTDVNMQEPK-SADTTEGAAAAENGAQDPEEKSVPMETDAKVEPSKK  573

Query  338  kvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKL  517
            KVKKT VPV ELVYGAL  A+++KAVEKE+EMALQDRIMEETK+KKNAVEAYVYDMRNKL
Sbjct  574  KVKKTAVPVHELVYGALPAAELEKAVEKEYEMALQDRIMEETKEKKNAVEAYVYDMRNKL  633

Query  518  YDKYQEFVVDSEKEQLIAKLQE  583
            YDKY +FV   EKE LI++LQE
Sbjct  634  YDKYNDFVTPEEKEGLISRLQE  655



>ref|XP_008649434.1| PREDICTED: heat shock 70 kDa protein 14-like [Zea mays]
 gb|AFW77407.1| hypothetical protein ZEAMMB73_835876 [Zea mays]
Length=843

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 147/198 (74%), Gaps = 4/198 (2%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlke-STK  178
            KISTYTIGPFQ  K E+ KLKVKV L++HGIV+V+SA +LEE+         +  + +TK
Sbjct  455  KISTYTIGPFQPSKCEKTKLKVKVCLSIHGIVTVDSAMMLEEDVEVPVSSANEALKDTTK  514

Query  179  METDDIPPQDSSETDVNMQDDK---VTSDASENHVLESGDKPVQMETDakaeapkkkvkk  349
            M+TDD P    S TD NM + +    T   +EN   +S +K V METDAK E  K+K+KK
Sbjct  515  MDTDDAPSDHVSGTDANMHEHRSADTTEAPAENGAQDSEEKSVPMETDAKVEPSKRKIKK  574

Query  350  TNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKY  529
            T+VP+ ELVYGALS  D+QKAVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDKY
Sbjct  575  TSVPIHELVYGALSATDLQKAVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDKY  634

Query  530  QEFVVDSEKEQLIAKLQE  583
             +FV   EKE LIAKLQE
Sbjct  635  NDFVTPEEKEGLIAKLQE  652



>ref|XP_010925328.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
Length=851

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 158/201 (79%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeql--keST  175
            KIS  TIGPFQS K ERAKLKVKVRLN+HGI+++ESAT+LEEEEVEVPV       KE+T
Sbjct  461  KISACTIGPFQSSKDERAKLKVKVRLNIHGILTIESATMLEEEEVEVPVSAAMEPPKEAT  520

Query  176  KMETDDIPPQDSSETDVNMQDDKV-----TSDASENHVLESGDKPVQMETDakaeapkkk  340
            KMETD+      +E DVNMQD K      +    EN   E+  KP QMETDAK E PKKK
Sbjct  521  KMETDETSDSSRTEADVNMQDAKTAATDNSGSGVENGAPEAEGKPAQMETDAKVEVPKKK  580

Query  341  vkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLY  520
            VKKTNVPVS LVYG +S  D+QKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKLY
Sbjct  581  VKKTNVPVSVLVYGGVSAEDLQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLY  640

Query  521  DKYQEFVVDSEKEQLIAKLQE  583
            +KYQ+FV  +EK++LIAKLQE
Sbjct  641  EKYQDFVTATEKDELIAKLQE  661



>ref|XP_008786326.1| PREDICTED: heat shock 70 kDa protein 15-like [Phoenix dactylifera]
Length=854

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 163/201 (81%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeql--keST  175
            KIS+ TIGPFQS K ERAKLKVKVRLN+HGIVS+ESAT+LEEEE+EVPV   +   KE+ 
Sbjct  461  KISSCTIGPFQSSKEERAKLKVKVRLNIHGIVSIESATMLEEEEIEVPVTAAKEPPKEAA  520

Query  176  KMETDDIPPQDSSETDVNMQDDK-VTSDAS----ENHVLESGDKPVQMETDakaeapkkk  340
            KM+TD+      +E DVNMQD K  T+D S    EN   E+ +KP QMETDAK E PKKK
Sbjct  521  KMDTDETSVSSRTEADVNMQDAKTATTDNSGSGVENGAPEAEEKPAQMETDAKVEVPKKK  580

Query  341  vkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLY  520
            VKKTNVPVS LVYG +S  D+QKAVEKEFE+ALQDR+MEETKDKKNAVEAYVYDMRNKLY
Sbjct  581  VKKTNVPVSVLVYGGMSAEDLQKAVEKEFELALQDRVMEETKDKKNAVEAYVYDMRNKLY  640

Query  521  DKYQEFVVDSEKEQLIAKLQE  583
            DKYQ+FV  +EK++LIAKLQE
Sbjct  641  DKYQDFVTATEKDELIAKLQE  661



>dbj|BAJ90753.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=835

 Score =   190 bits (483),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 155/200 (78%), Gaps = 14/200 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlke--ST  175
            KISTYTIGPFQS KGE+AKLKVKVRLN+H IVS+ESAT+LEEEEVEVPV         + 
Sbjct  455  KISTYTIGPFQSSKGEKAKLKVKVRLNIHAIVSLESATMLEEEEVEVPVSATSEVPKDAN  514

Query  176  KMETDDIPPQDSSETDVNMQDDKVTSDASE----NHVLESGDKPVQMETDakaeapkkkv  343
            KMETD         TDVNMQ+ K T+D +E    N   +S +KP  M+TDAK E  KKKV
Sbjct  515  KMETD--------VTDVNMQEPKGTTDTAEGVTENGAQDSEEKPASMDTDAKTELAKKKV  566

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTNVPV ELVYGA+  A+++KAVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLY+
Sbjct  567  KKTNVPVVELVYGAMGAAELEKAVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYE  626

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY ++V   +KE L+AKLQE
Sbjct  627  KYSDYVTSEDKEALMAKLQE  646



>gb|AFW77408.1| hypothetical protein ZEAMMB73_835876 [Zea mays]
Length=1186

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 147/198 (74%), Gaps = 4/198 (2%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlke-STK  178
            KISTYTIGPFQ  K E+ KLKVKV L++HGIV+V+SA +LEE+         +  + +TK
Sbjct  798  KISTYTIGPFQPSKCEKTKLKVKVCLSIHGIVTVDSAMMLEEDVEVPVSSANEALKDTTK  857

Query  179  METDDIPPQDSSETDVNMQDDK---VTSDASENHVLESGDKPVQMETDakaeapkkkvkk  349
            M+TDD P    S TD NM + +    T   +EN   +S +K V METDAK E  K+K+KK
Sbjct  858  MDTDDAPSDHVSGTDANMHEHRSADTTEAPAENGAQDSEEKSVPMETDAKVEPSKRKIKK  917

Query  350  TNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKY  529
            T+VP+ ELVYGALS  D+QKAVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDKY
Sbjct  918  TSVPIHELVYGALSATDLQKAVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDKY  977

Query  530  QEFVVDSEKEQLIAKLQE  583
             +FV   EKE LIAKLQE
Sbjct  978  NDFVTPEEKEGLIAKLQE  995



>gb|EMT31029.1| Heat shock 70 kDa protein 4L [Aegilops tauschii]
Length=842

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 157/200 (79%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlke--ST  175
            KISTYTIGPFQS KGE+AKLKVKVRLN+HGIVS+ESAT+LEEEEVEVPV         +T
Sbjct  455  KISTYTIGPFQSSKGEKAKLKVKVRLNIHGIVSLESATMLEEEEVEVPVSSTSEVPKDAT  514

Query  176  KMETDDIPPQDSSETDVNMQDDKVTSD----ASENHVLESGDKPVQMETDakaeapkkkv  343
            +METDD P   +S    +MQ+ K  +D    A+EN   +S +K V M+TD K E  KKKV
Sbjct  515  RMETDDAPQDPASSAGDHMQEPKGAADPAEGAAENGAQDSEEKTVPMDTDTKVEPSKKKV  574

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTNVPV+ELVYGA+   +++KAVEKE+EMALQDR+MEETKDKKN+VEAYVYDMRNK+++
Sbjct  575  KKTNVPVAELVYGAMGTVELEKAVEKEYEMALQDRVMEETKDKKNSVEAYVYDMRNKIHE  634

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY +FV+  + E L+AKLQE
Sbjct  635  KYNDFVMSEDIEGLMAKLQE  654



>ref|XP_008654914.1| PREDICTED: heat shock 70 kDa protein 4 isoform X1 [Zea mays]
Length=833

 Score =   188 bits (478),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 143/195 (73%), Gaps = 4/195 (2%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHG-IvsvesatlleeeevevpvvkeqlkeSTK  178
            KISTYTIGPFQ+  GE+AKLKVKVRLN+HG +       L E+ EV V    E   ++ K
Sbjct  454  KISTYTIGPFQTSNGEKAKLKVKVRLNIHGTVTVDSVIMLEEDVEVPVSSANEAPNDTMK  513

Query  179  METDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNV  358
            M+TDD+P   ++ +DV MQ+      A+ N   ++ +K V METDAK    KKKVKKT V
Sbjct  514  MDTDDVPSDPAAGSDVTMQEQ---PPAAGNGAQDNEEKSVSMETDAKVXXXKKKVKKTTV  570

Query  359  PVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEF  538
            PV ELVYGAL+ AD+QKAVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDKY +F
Sbjct  571  PVHELVYGALAAADLQKAVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDKYSDF  630

Query  539  VVDSEKEQLIAKLQE  583
            V   +KE LI KLQE
Sbjct  631  VTPEDKEGLIGKLQE  645



>ref|NP_001147805.1| heat shock 70 kDa protein 4 [Zea mays]
 gb|ACG28747.1| heat shock 70 kDa protein 4 [Zea mays]
Length=833

 Score =   188 bits (477),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 144/195 (74%), Gaps = 4/195 (2%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHG-IvsvesatlleeeevevpvvkeqlkeSTK  178
            KISTYTIGPFQ+  GE+AKLKVKVRLN+HG +       L E+ EV V    E   ++ K
Sbjct  454  KISTYTIGPFQTSNGEKAKLKVKVRLNIHGTVTVDSVIMLEEDVEVPVSSANEAPNDTMK  513

Query  179  METDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNV  358
            M+TDD+P   ++ +DV MQ+      A+ N   ++ +K V METDAK E  KKKVKKT V
Sbjct  514  MDTDDVPSDPAAGSDVTMQEQ---PPAAGNGAQDNEEKSVSMETDAKVEPSKKKVKKTTV  570

Query  359  PVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEF  538
            PV ELVYGAL+ AD+QKAVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDKY +F
Sbjct  571  PVHELVYGALAAADLQKAVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDKYSDF  630

Query  539  VVDSEKEQLIAKLQE  583
            V   +KE LI KLQE
Sbjct  631  VTPEDKEGLIGKLQE  645



>ref|XP_009408938.1| PREDICTED: heat shock 70 kDa protein 15-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408939.1| PREDICTED: heat shock 70 kDa protein 15-like [Musa acuminata 
subsp. malaccensis]
Length=852

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 157/208 (75%), Gaps = 15/208 (7%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            ISTYTIGPFQ+ KGERAKLKVKVRLNLHGIVS+ESAT+LEEEEVEV V          M+
Sbjct  462  ISTYTIGPFQTSKGERAKLKVKVRLNLHGIVSIESATMLEEEEVEVAVSDTAEVTKESMD  521

Query  185  TDDIPPQDS-----------SETDVNMQDDKVTSDAS----ENHVLESGDKPVQMETDak  319
             D+     S           +E DV+MQ+ + T+D S    EN   ++G+KPVQM+TD+K
Sbjct  522  MDEATKFSSKTENDENGSSKTENDVDMQEAEGTTDNSSAGFENGAPKAGEKPVQMDTDSK  581

Query  320  aeapkkkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVY  499
             E  KKKVKKTNVPV+ELVYG +   ++QKAVEKEFEMALQDR+MEETKDKKNAVEAYVY
Sbjct  582  VEVSKKKVKKTNVPVTELVYGGMLAEELQKAVEKEFEMALQDRVMEETKDKKNAVEAYVY  641

Query  500  DMRNKLYDKYQEFVVDSEKEQLIAKLQE  583
            DMRNKLYDKYQ+FV  +EKE LI KLQE
Sbjct  642  DMRNKLYDKYQDFVTPTEKEALIMKLQE  669



>ref|XP_002439385.1| hypothetical protein SORBIDRAFT_09g005580 [Sorghum bicolor]
 gb|EES17815.1| hypothetical protein SORBIDRAFT_09g005580 [Sorghum bicolor]
Length=842

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 150/201 (75%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatllee--eevevpvvkeqlkeST  175
            KISTYTIGPFQ+ KGE+AKLKVKVRLN+HG V+V+SA +LEE   EV V    E  K++ 
Sbjct  454  KISTYTIGPFQTSKGEKAKLKVKVRLNIHGTVTVDSAMMLEEEDVEVPVSSANEAPKDTM  513

Query  176  KMETDDIPPQDSSETDVNMQDDKVTSDASENHVLESG-----DKPVQMETDakaeapkkk  340
            KM+TDD P   ++ +DVNMQ+ K           E+G      K V METDAK E  KKK
Sbjct  514  KMDTDDAPSDAAAGSDVNMQEPKSAETTEAAPAAENGAQDTEQKSVPMETDAKVELSKKK  573

Query  341  vkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLY  520
            VKKT VPV ELVYGAL+  D+QKAVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLY
Sbjct  574  VKKTTVPVHELVYGALAAIDLQKAVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLY  633

Query  521  DKYQEFVVDSEKEQLIAKLQE  583
            DKY +FV   +KE LIAKLQE
Sbjct  634  DKYSDFVTPEDKEGLIAKLQE  654



>gb|EMS61926.1| Heat shock 70 kDa protein 4L [Triticum urartu]
Length=841

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 155/200 (78%), Gaps = 14/200 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlke--ST  175
            KISTYTIGPFQS KGE+AKLKVKVRLN+HGIVS+ESAT+LEEEEVEVPV         + 
Sbjct  455  KISTYTIGPFQSSKGEKAKLKVKVRLNIHGIVSLESATMLEEEEVEVPVSATSEVPKDAN  514

Query  176  KMETDDIPPQDSSETDVNMQDDKVTSDASE----NHVLESGDKPVQMETDakaeapkkkv  343
            KMETD         TDVNMQ+ K T+D +E    +   +S +K   M+TDAK E  KKKV
Sbjct  515  KMETD--------ATDVNMQEPKGTTDTAEGATGDGAQDSEEKSAPMDTDAKTEPSKKKV  566

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTNVPV+ELVYGA+  A+++KAVEKE+EMALQDR+MEETK+KKN+VEAYVYDMRNKLY+
Sbjct  567  KKTNVPVAELVYGAMGSAELEKAVEKEYEMALQDRVMEETKEKKNSVEAYVYDMRNKLYE  626

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY ++V   +KE L AKLQE
Sbjct  627  KYSDYVTWEDKETLTAKLQE  646



>gb|EMS52665.1| Heat shock 70 kDa protein 4L [Triticum urartu]
Length=1269

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 156/200 (78%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlke--ST  175
            KISTYTIGPFQS KGE+AKLKVKVRLN+HGIVS+ESAT+LEEEEVEVPV         +T
Sbjct  615  KISTYTIGPFQSSKGEKAKLKVKVRLNIHGIVSLESATMLEEEEVEVPVSSTSEVPKDAT  674

Query  176  KMETDDIPPQDSSETDVNMQDDKVTSD----ASENHVLESGDKPVQMETDakaeapkkkv  343
            +METDD P   +S    + Q+ K  +D    A+EN   +S +K V M+TD K E  KKKV
Sbjct  675  RMETDDAPQDPASSAGDHTQEPKGAADPAEGAAENGAQDSEEKTVPMDTDTKVEPSKKKV  734

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTNVPV+E+VYGA+   +++KAVEKE+EMALQDR+MEETKDKKN+VEAYVYDMRNK+++
Sbjct  735  KKTNVPVAEMVYGAMGTVELEKAVEKEYEMALQDRVMEETKDKKNSVEAYVYDMRNKIHE  794

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY +FV+  + E L+AKLQE
Sbjct  795  KYNDFVMLEDIEGLMAKLQE  814



>gb|EMT09857.1| Heat shock 70 kDa protein 4L [Aegilops tauschii]
Length=901

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 150/199 (75%), Gaps = 13/199 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlke-STK  178
            KISTY IGPFQS KGE+AKLKVKVRLN+HGIVS+ESAT+LEEE         ++ + + K
Sbjct  455  KISTYMIGPFQSSKGEKAKLKVKVRLNIHGIVSLESATMLEEEVEVPVSTTSEVPKDANK  514

Query  179  METDDIPPQDSSETDVNMQDDKVTSDASE----NHVLESGDKPVQMETDakaeapkkkvk  346
            METD          DVNMQ+ K T+D +E    +   +S +K   M+TDAK E  K+KVK
Sbjct  515  METD--------AADVNMQEPKGTTDTAEGATGDGAQDSEEKSAPMDTDAKTEPSKRKVK  566

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            KTNVPV+ELVYGA+  A+++KAVEKE+EMALQDR+MEETK+KKN+VEAYVYDMRNKLY+K
Sbjct  567  KTNVPVAELVYGAMGSAELEKAVEKEYEMALQDRVMEETKEKKNSVEAYVYDMRNKLYEK  626

Query  527  YQEFVVDSEKEQLIAKLQE  583
            Y ++V   +KE L AKLQE
Sbjct  627  YSDYVTSEDKETLTAKLQE  645



>ref|XP_010231645.1| PREDICTED: heat shock 70 kDa protein 14-like [Brachypodium distachyon]
Length=843

 Score =   180 bits (456),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 152/200 (76%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatllee--eevevpvvkeqlkeST  175
            KISTYTIGPFQ   GE+AK+KVKVRLN+HGIVS+ESAT+LEE   EV V    E  K++T
Sbjct  455  KISTYTIGPFQPSNGEKAKVKVKVRLNIHGIVSLESATMLEEDEVEVPVSSASEVPKDAT  514

Query  176  KMETDDIPPQDSSETDVNMQDDKVTSD----ASENHVLESGDKPVQMETDakaeapkkkv  343
            KM+TDD     +S  DVNM+D K  +D    A EN   +S +K V M+TD K +  KK+V
Sbjct  515  KMDTDDAQRDPASGNDVNMEDSKGATDTAEGAVENGAHDSEEKSVPMDTDTKVQPSKKRV  574

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            KKTNVP++ELVYG L   +++KAVEKE+EMALQDR+MEETK+KKN+VEAYVY+MRNKL +
Sbjct  575  KKTNVPIAELVYGTLGADELEKAVEKEYEMALQDRVMEETKEKKNSVEAYVYEMRNKLSE  634

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            KY +FV+  + E L+AKLQE
Sbjct  635  KYNDFVMSEDMEVLMAKLQE  654



>ref|XP_009388669.1| PREDICTED: heat shock 70 kDa protein 14-like [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 150/202 (74%), Gaps = 10/202 (5%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeev--evpvvkeqlkeST  175
            KISTY IGPFQSGKG   KLKVKVR+NLHGIVSVESAT+LEEEEV   V    E   E+T
Sbjct  461  KISTYAIGPFQSGKGGIVKLKVKVRMNLHGIVSVESATMLEEEEVDVPVSSATELTMEAT  520

Query  176  KMETDDIPPQDSSET--DVNMQDDKVT----SDASENHVLESGDKPVQMETDakaeapkk  337
             M+ D+    DSS+T  DVNMQ+ K +    S   EN   E  +  V+METD K E P+K
Sbjct  521  NMDMDE-ATNDSSKTENDVNMQEAKGSVGNSSGGIENGTSEIEENAVRMETDTKVEVPRK  579

Query  338  kvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKL  517
              K TNVP++ELVYG +   ++QKAVE+EFEMALQD++MEETKD+KN VEAYVYDMRNKL
Sbjct  580  VKK-TNVPITELVYGGMLAEELQKAVEQEFEMALQDKVMEETKDRKNTVEAYVYDMRNKL  638

Query  518  YDKYQEFVVDSEKEQLIAKLQE  583
            +DKYQ+FV  +EK++ IAKLQE
Sbjct  639  HDKYQDFVTSTEKKEFIAKLQE  660



>gb|EPS57643.1| hypothetical protein M569_17174, partial [Genlisea aurea]
Length=237

 Score =   162 bits (410),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 4/142 (3%)
 Frame = +2

Query  170  STKMETDDI----PPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkk  337
            ST+METD++     P   +  D+NM D      A+EN   +S +KPV METD+K EAPKK
Sbjct  19   STQMETDEVQAASAPSGFTGIDLNMHDGTADGPAAENGAPQSDEKPVPMETDSKVEAPKK  78

Query  338  kvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKL  517
            KV+KTNVP+SE+VYGAL+ AD+QKAV++EF+MALQDR+MEETKDKKNAVEAYVYD RNKL
Sbjct  79   KVRKTNVPISEVVYGALASADLQKAVDEEFDMALQDRVMEETKDKKNAVEAYVYDFRNKL  138

Query  518  YDKYQEFVVDSEKEQLIAKLQE  583
            +DKY EFV D E+EQ IAKLQE
Sbjct  139  HDKYAEFVTDPEREQFIAKLQE  160



>emb|CCM07272.1| Putative 97 kDa heat shock protein [Musa balbisiana]
Length=845

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 148/202 (73%), Gaps = 10/202 (5%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeev--evpvvkeqlkeST  175
            KI+TY IGPFQSGKG   KLKVKVR+NLHGIVSVESAT+LEEEEV   V    E   E+T
Sbjct  461  KITTYAIGPFQSGKGGIVKLKVKVRMNLHGIVSVESATMLEEEEVDVPVSSATELTMEAT  520

Query  176  KMETDDIPPQDSSET--DVNMQDDKVT----SDASENHVLESGDKPVQMETDakaeapkk  337
             M+ D+    DSS+T  D+N Q+ + +    S   EN   E  +  V+METD K E P+K
Sbjct  521  NMDMDEAT-NDSSKTENDINTQEARGSVGNYSGGIENGTSEIEENAVRMETDTKVEVPRK  579

Query  338  kvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKL  517
              K TN+P++ELVYG +   ++QKAVEKEFEMALQD++MEETKD+KN VEAYVYDMRNKL
Sbjct  580  VKK-TNIPITELVYGGMLAEELQKAVEKEFEMALQDKVMEETKDRKNTVEAYVYDMRNKL  638

Query  518  YDKYQEFVVDSEKEQLIAKLQE  583
             DKYQ+FV  ++KE+ IAKLQE
Sbjct  639  DDKYQDFVTSTKKEEFIAKLQE  660



>ref|XP_006654112.1| PREDICTED: heat shock 70 kDa protein 15-like [Oryza brachyantha]
Length=856

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 144/197 (73%), Gaps = 4/197 (2%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlke-STKM  181
            ISTYTIGPFQS K ++A+L VK  L++HGIVSVESA +LEEE         +  + +TKM
Sbjct  457  ISTYTIGPFQSSKFKKAELNVKACLDIHGIVSVESAMMLEEEVEVPVASTNETVKDATKM  516

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDA---SENHVLESGDKPVQMETDakaeapkkkvkkT  352
            +TDD P   +S T  NM++ K  +DA   +EN   +S +    M+TDAK E PKK VK+ 
Sbjct  517  DTDDAPTDPASGTGGNMEESKCAADAHGAAENGGPDSEETSSPMDTDAKVEPPKKNVKRI  576

Query  353  NVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQ  532
            +VPV  LVYGA+   +++KAVE E+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDKY 
Sbjct  577  SVPVFGLVYGAMGAEELEKAVENEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDKYN  636

Query  533  EFVVDSEKEQLIAKLQE  583
            +FV+   K++LIAKLQE
Sbjct  637  DFVMPEYKDELIAKLQE  653



>gb|ACN40183.1| unknown [Picea sitchensis]
Length=388

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 134/204 (66%), Gaps = 17/204 (8%)
 Frame = +2

Query  20   IGPFQSGKGERAKLKVKVRLNLHGI-----vsvesatlleeeevevpvvkeqlkeSTKME  184
            IGPFQ+ KGE+AKLKV+V+L+ HGI      ++     +E          ++ KE+  ME
Sbjct  2    IGPFQTSKGEKAKLKVRVQLDKHGIVFVDSATMIEEEEIEVPVSSGKEGSKEDKETAAME  61

Query  185  TDDIPPQDSS----ETDVNMQDDK-------VTSDASENHVLESGDKPVQMETDa-kaea  328
            TDD     +S      DVNMQD K         +  +EN   E+ DK  QMETDA     
Sbjct  62   TDDAQNNGASAAGDNADVNMQDAKSAAGTATAGTSGAENGFPEAEDKAAQMETDAKVKTV  121

Query  329  pkkkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMR  508
             KKKVKKT VP++E ++GAL  AD+QKA ++EFEMALQDR+MEETK+KKNAVEAYVYDMR
Sbjct  122  RKKKVKKTEVPINEKIFGALPRADLQKATDEEFEMALQDRVMEETKEKKNAVEAYVYDMR  181

Query  509  NKLYDKYQEFVVDSEKEQLIAKLQ  580
            NKLY+KYQ +V +S++E+L  KLQ
Sbjct  182  NKLYEKYQAYVTESQREELTLKLQ  205



>gb|ACL53343.1| unknown [Zea mays]
Length=357

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 107/140 (76%), Gaps = 2/140 (1%)
 Frame = +2

Query  170  STKMETDDIPPQDSSETDVNMQDDKVT--SDASENHVLESGDKPVQMETDakaeapkkkv  343
            +TKM+TDD P    S TDVN+ +   T  + A+EN      +K V METDAK E  K+KV
Sbjct  21   TTKMDTDDAPSDPVSGTDVNVHEPDTTEAAPAAENGTQNPEEKSVPMETDAKVEPSKRKV  80

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            K+T+VPV  LVYGAL+ AD+QKAVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYD
Sbjct  81   KRTSVPVHALVYGALAAADLQKAVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYD  140

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            +Y +FV   EKE LI KLQE
Sbjct  141  RYNDFVTPEEKEGLIGKLQE  160



>gb|EAY72790.1| hypothetical protein OsI_00654 [Oryza sativa Indica Group]
Length=813

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 111/142 (78%), Gaps = 4/142 (3%)
 Frame = +2

Query  170  STKMETDDIPPQDSSETDVNMQDDKVTSDAS----ENHVLESGDKPVQMETDakaeapkk  337
            S KMETDD P + +S TDVNMQ+ K  +DA+    EN    S +K V METDAK E  KK
Sbjct  481  SAKMETDDAPNEAASGTDVNMQEAKAPADAAADGAENGAPNSEEKSVPMETDAKVEPSKK  540

Query  338  kvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKL  517
            KVKKTNVPV+ELVYGAL   ++QKAVEKE+EMALQDR+MEETKDKKNAVE+YVYDMRNKL
Sbjct  541  KVKKTNVPVAELVYGALGTTELQKAVEKEYEMALQDRVMEETKDKKNAVESYVYDMRNKL  600

Query  518  YDKYQEFVVDSEKEQLIAKLQE  583
            YDKY +FV   +KE  IAKLQE
Sbjct  601  YDKYNDFVTAEDKEAFIAKLQE  622



>ref|NP_001054812.1| Os05g0181000 [Oryza sativa Japonica Group]
 gb|AAW57812.1| putative heat shock protein Hsp70 [Oryza sativa Japonica Group]
 dbj|BAF16726.1| Os05g0181000 [Oryza sativa Japonica Group]
 gb|EEE62549.1| hypothetical protein OsJ_17347 [Oryza sativa Japonica Group]
Length=853

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 135/199 (68%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS+YTIGPFQS K E+AK+ VK  LN+HGIVS+ESA +LEEE         +  +    
Sbjct  455  KISSYTIGPFQSSKPEKAKVNVKACLNIHGIVSIESAMMLEEEVDVPVATTNETLKDDTK  514

Query  182  ETDDIPPQD-SSETDVNMQDDKVTSDA----SENHVLESGDKPVQMETDakaeapkkkvk  346
               D    D +S TD NMQ+ K ++DA    +EN   +S +    M+TDAK E   K VK
Sbjct  515  MDTDDALGDPASGTDENMQESKCSADATHGAAENGKPDSEEISAPMDTDAKVEPLIKNVK  574

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            K +VPVS LVYGAL   ++ KA E E+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDK
Sbjct  575  KIDVPVSGLVYGALGSEELVKASENEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDK  634

Query  527  YQEFVVDSEKEQLIAKLQE  583
            Y +FV+   KE  IAKLQE
Sbjct  635  YNDFVMSEYKEGFIAKLQE  653



>ref|XP_008659628.1| PREDICTED: heat shock 70 kDa protein 14-like [Zea mays]
Length=239

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 106/140 (76%), Gaps = 2/140 (1%)
 Frame = +2

Query  170  STKMETDDIPPQDSSETDVNMQDDKVT--SDASENHVLESGDKPVQMETDakaeapkkkv  343
            +TKM+TDD P    S TDVN+ +   T  + A+EN      +K V METDAK E  ++KV
Sbjct  20   TTKMDTDDAPSDPVSGTDVNVHEPDTTEAAPAAENGAENPEEKSVPMETDAKVEPSERKV  79

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            K+T+VPV  LVYGAL+ AD+QKAVEKE+EMALQDR+MEETK+KKN VEAYVYDMRNKLYD
Sbjct  80   KRTSVPVHALVYGALAVADLQKAVEKEYEMALQDRVMEETKEKKNVVEAYVYDMRNKLYD  139

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            +Y +FV   EKE LI KL+E
Sbjct  140  RYNDFVTPEEKEGLIGKLRE  159



>ref|XP_002986462.1| hypothetical protein SELMODRAFT_124091 [Selaginella moellendorffii]
 gb|EFJ12319.1| hypothetical protein SELMODRAFT_124091 [Selaginella moellendorffii]
Length=774

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 145/196 (74%), Gaps = 12/196 (6%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIST+TIGPF   + E+AK+KVK+RLNLHGIVSVESAT++EEEEVEVPV KE     T M
Sbjct  459  KISTFTIGPFTPTRSEKAKIKVKIRLNLHGIVSVESATMVEEEEVEVPVTKE----PTAM  514

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQ--METDakaeapkkkvkkTN  355
            ETD    ++  + DV M++     +++E    ++G  P++  +ET       KKK K+T+
Sbjct  515  ETD----KEDDKGDVPMEEGDAKVESAEGT--DNGAPPMEEPVETQKAEPVKKKKTKRTD  568

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            VPV+E V   L PA++QKAVEKE+E ALQDR+MEETKD+KNAVEAYVYDMRNKLY+K  +
Sbjct  569  VPVTETVPCGLPPAELQKAVEKEYEYALQDRVMEETKDRKNAVEAYVYDMRNKLYEKLHD  628

Query  536  FVVDSEKEQLIAKLQE  583
            +V D EKE+L AKLQ+
Sbjct  629  YVTDFEKEELTAKLQQ  644



>gb|EAY96776.1| hypothetical protein OsI_18700 [Oryza sativa Indica Group]
Length=853

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 133/199 (67%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS+YTIGPFQS   E+AK+ VK  LN+HGIVS+ESA +LEEE         +  +    
Sbjct  455  KISSYTIGPFQSSNPEKAKVNVKACLNIHGIVSIESAMMLEEEVDVPVATTNETLKDDTK  514

Query  182  ETDDIPPQDSSE-TDVNMQDDKVTSDA----SENHVLESGDKPVQMETDakaeapkkkvk  346
               D    D +  TD NMQ+ K ++DA    +EN   +S +    M+TDAK E   K VK
Sbjct  515  MDTDDALGDPAPGTDENMQESKCSADATHGAAENGKPDSEEISAPMDTDAKVEPLIKNVK  574

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
            K +VPVS LVYGAL   ++ KA E E+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDK
Sbjct  575  KIDVPVSGLVYGALGSEELVKASENEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDK  634

Query  527  YQEFVVDSEKEQLIAKLQE  583
            Y +FV+   KE  IAKLQE
Sbjct  635  YTDFVMSEYKEGFIAKLQE  653



>ref|XP_008659497.1| PREDICTED: heat shock 70 kDa protein 14-like [Zea mays]
Length=449

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 106/140 (76%), Gaps = 2/140 (1%)
 Frame = +2

Query  170  STKMETDDIPPQDSSETDVNMQDDKVT--SDASENHVLESGDKPVQMETDakaeapkkkv  343
            +TKM+TDD P    S TDVN+ +   T  + A+EN      +K V METDAK E  ++KV
Sbjct  228  TTKMDTDDAPSDPVSGTDVNVHEPDTTEAAPAAENGAENPEEKSVPMETDAKVEPSERKV  287

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
            K+T+VPV  LVYGAL+ AD+QKAVEKE+EMALQDR+MEETK+KKN VEAYVYDMRNKLYD
Sbjct  288  KRTSVPVHALVYGALAVADLQKAVEKEYEMALQDRVMEETKEKKNVVEAYVYDMRNKLYD  347

Query  524  KYQEFVVDSEKEQLIAKLQE  583
            +Y +FV   EKE LI KL+E
Sbjct  348  RYNDFVTPEEKEGLIGKLRE  367



>ref|XP_002978946.1| hypothetical protein SELMODRAFT_109750 [Selaginella moellendorffii]
 gb|EFJ19903.1| hypothetical protein SELMODRAFT_109750 [Selaginella moellendorffii]
Length=779

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 142/196 (72%), Gaps = 10/196 (5%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIST+TIGPF   + E+AK+KVK+RLNLHGIVSVESAT++EEEEVEVPV KE       M
Sbjct  459  KISTFTIGPFTPTRSEKAKIKVKIRLNLHGIVSVESATMVEEEEVEVPVTKE----PIAM  514

Query  182  ETDDIPPQDSSETDVNMQ--DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTN  355
            ETD    ++  + DV M+  D KV S    ++     ++PV+ +        KKK K+T+
Sbjct  515  ETD----KEDDKGDVPMEEGDAKVESAEGTDNGAPPMEEPVETQKVCAEPVKKKKTKRTD  570

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            VPV+E V   L PA++QKAVEKE+E ALQDR+MEETKD+KNAVEAYVYDMRNKLY+K  +
Sbjct  571  VPVTETVPCGLPPAELQKAVEKEYEYALQDRVMEETKDRKNAVEAYVYDMRNKLYEKLHD  630

Query  536  FVVDSEKEQLIAKLQE  583
            +V D EKE+L AKLQ+
Sbjct  631  YVTDFEKEELTAKLQQ  646



>ref|XP_001755636.1| predicted protein [Physcomitrella patens]
 gb|EDQ79696.1| predicted protein [Physcomitrella patens]
Length=770

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 123/194 (63%), Gaps = 13/194 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +I+T+TIGPF     E+AK+KVK+RLNLHG+             +E   + E+ +    +
Sbjct  462  RIATFTIGPFTPTVAEKAKIKVKIRLNLHGV-----------VSLEAATMIEEEEVEVPV  510

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
               DI   DS E      DDK    A  +    S + PV+MET+A     KKK K+T+VP
Sbjct  511  TKKDISKDDSGEKASAPTDDKPEDAAGVDS--SSTEGPVKMETEAPKAEVKKKTKRTDVP  568

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            V E++YG L   ++ KAVEKE+EMALQDR+MEETK+ KNAVEAYVY MRNKLY+K Q +V
Sbjct  569  VHEVIYGGLPQPELTKAVEKEYEMALQDRVMEETKESKNAVEAYVYSMRNKLYEKLQSYV  628

Query  542  VDSEKEQLIAKLQE  583
             + E+E++ A+LQE
Sbjct  629  TEFEREEMSARLQE  642



>ref|XP_001760080.1| predicted protein [Physcomitrella patens]
 gb|EDQ75205.1| predicted protein [Physcomitrella patens]
Length=816

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 135/196 (69%), Gaps = 20/196 (10%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KI+T+TIGPF     E+AK+KVK+RLNLHG+VS+E+AT++EEEEVEVP        +TK 
Sbjct  462  KIATFTIGPFTPTMTEKAKIKVKIRLNLHGVVSLEAATMIEEEEVEVP--------TTKK  513

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvk--kTN  355
            +  +   + S  TD   +D  V  + +        D P +METDA      KK K  +T+
Sbjct  514  DESE---KASPPTDAKPEDAAVAENGA-------ADVPAKMETDAPKPEVVKKKKTKRTD  563

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            VPV E+++G L   ++ KAVEKEFEMALQDR+MEETK+ KNAVEAYVY MRNKLY+K Q 
Sbjct  564  VPVHEVIHGGLPQPELTKAVEKEFEMALQDRVMEETKESKNAVEAYVYSMRNKLYEKLQN  623

Query  536  FVVDSEKEQLIAKLQE  583
            +V +SE+E++ A+LQE
Sbjct  624  YVTESEREEMTARLQE  639



>gb|AIL24130.1| heat shock protein 2, partial [Tamarix hispida]
Length=212

 Score =   136 bits (342),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 121/153 (79%), Gaps = 5/153 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRL+LHGIVS+ESATLLEEEEVEVPV KE  K+S KM
Sbjct  61   KISTYTIGPFQSSKGERAKLKVKVRLSLHGIVSIESATLLEEEEVEVPVTKELAKDS-KM  119

Query  182  ETDDI---PPQDSSETDVNMQDDKVTSDAS-ENHVLESGDKPVQMETDakaeapkkkvkk  349
            +TD      P    E DVNMQD K  ++ S EN   E G+KP QMETD KAEAPKKKVKK
Sbjct  120  DTDQASGDAPSAPPEGDVNMQDAKGAAEVSAENGTSELGEKPAQMETDTKAEAPKKKVKK  179

Query  350  TNVPVSELVYGALSPADVQKAVEKEFEMALQDR  448
            TNVPV ELVYG + P D+QK VEKEFEMALQDR
Sbjct  180  TNVPVVELVYGGVLPTDLQKLVEKEFEMALQDR  212



>gb|AEA86324.1| 70 kDa heat shock protein [Solanum nigrum]
Length=222

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            V+E+VYGA++ ADVQKAVEKEFEMALQDR+MEETKDKKNAVE+YVYDMRNKL DKYQEFV
Sbjct  1    VNEIVYGAMAAADVQKAVEKEFEMALQDRVMEETKDKKNAVESYVYDMRNKLSDKYQEFV  60

Query  542  VDSEKEQLIAKLQE  583
             DSE+EQ +AKLQE
Sbjct  61   TDSEREQFMAKLQE  74



>gb|EPS62237.1| hypothetical protein M569_12554, partial [Genlisea aurea]
Length=269

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +2

Query  353  NVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQ  532
            NVPVSE+VYGAL P+D+QKAVE+E +MA QDR+MEETKDKKNAVEAYVYD RNKL DKY 
Sbjct  12   NVPVSEVVYGALPPSDLQKAVEEECKMARQDRVMEETKDKKNAVEAYVYDFRNKLRDKYA  71

Query  533  EFVVDSEKEQLIAKLQE  583
            EFV DSE+EQ IAKLQE
Sbjct  72   EFVKDSEREQFIAKLQE  88



>ref|XP_001764380.1| predicted protein [Physcomitrella patens]
 gb|EDQ70934.1| predicted protein [Physcomitrella patens]
Length=820

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 135/197 (69%), Gaps = 20/197 (10%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +I+T+TIGPF     E+AK+KVK+RLNLHG+VS+E+AT++E+EEVEVPV       + K 
Sbjct  462  RIATFTIGPFTPTVAEKAKIKVKIRLNLHGVVSLEAATMIEDEEVEVPV-------TKKD  514

Query  182  ETDDI-PPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvk--kT  352
            ET+   PP D+   D         + ++EN    + D    METDA      KK K  +T
Sbjct  515  ETEKAAPPADAKPEDAG-------TSSAENG---AADGVANMETDAPKPEVVKKKKAKRT  564

Query  353  NVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQ  532
            ++ V E+++G L   ++ KAVEKE+EMALQDR+MEETK+ KNAVEAYVY MR+KLY+K Q
Sbjct  565  DISVHEVIHGGLPQPELTKAVEKEYEMALQDRVMEETKESKNAVEAYVYSMRSKLYEKLQ  624

Query  533  EFVVDSEKEQLIAKLQE  583
            ++V +SE+E + A+LQE
Sbjct  625  DYVTESEREDMSARLQE  641



>ref|XP_009372708.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Pyrus 
x bretschneideri]
Length=718

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 113/193 (59%), Gaps = 13/193 (7%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            I  +TIGPFQ    E+ ++KVKV LNLHG+VSVESA ++EE   +         +   M+
Sbjct  457  ICCFTIGPFQCSHSEKTRVKVKVVLNLHGVVSVESAMVMEEHGDDSSTRGLTNSKMDPMD  516

Query  185  TDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  364
            TD +    S+E    + D    S    N    SGD               K  ++  +PV
Sbjct  517  TDYVTASGSTEA---VADGFEKSTMQHNSSHTSGDP----------RRNNKASRRLEIPV  563

Query  365  SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  544
            SE +YG ++ A++ +A++KE ++A QDRIME+TKDKKNA+E+YVY+MRNKL++ Y+ F  
Sbjct  564  SESIYGGMTRAELSEALDKELQLAQQDRIMEQTKDKKNALESYVYEMRNKLFNTYRSFAS  623

Query  545  DSEKEQLIAKLQE  583
            D E+E +   LQ+
Sbjct  624  DQEREGISRSLQQ  636



>ref|XP_009372707.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Pyrus 
x bretschneideri]
Length=761

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 113/193 (59%), Gaps = 13/193 (7%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            I  +TIGPFQ    E+ ++KVKV LNLHG+VSVESA ++EE   +         +   M+
Sbjct  457  ICCFTIGPFQCSHSEKTRVKVKVVLNLHGVVSVESAMVMEEHGDDSSTRGLTNSKMDPMD  516

Query  185  TDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  364
            TD +    S+E    + D    S    N    SGD               K  ++  +PV
Sbjct  517  TDYVTASGSTEA---VADGFEKSTMQHNSSHTSGDP----------RRNNKASRRLEIPV  563

Query  365  SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  544
            SE +YG ++ A++ +A++KE ++A QDRIME+TKDKKNA+E+YVY+MRNKL++ Y+ F  
Sbjct  564  SESIYGGMTRAELSEALDKELQLAQQDRIMEQTKDKKNALESYVYEMRNKLFNTYRSFAS  623

Query  545  DSEKEQLIAKLQE  583
            D E+E +   LQ+
Sbjct  624  DQEREGISRSLQQ  636



>gb|AEZ00882.1| putative heat shock protein hsp70, partial [Elaeis guineensis]
Length=254

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  380  GALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKE  559
            G +   D+QKAVE+EFEMALQDR+MEETKDKKNAVEAYVYDMRNKLYDKYQ+FV  +EK+
Sbjct  1    GGMLAEDLQKAVEREFEMALQDRVMEETKDKKNAVEAYVYDMRNKLYDKYQDFVTATEKD  60

Query  560  QLIAKLQE  583
            +LIAKLQE
Sbjct  61   ELIAKLQE  68



>ref|XP_007020850.1| Heat shock protein 70 family protein [Theobroma cacao]
 gb|EOY12375.1| Heat shock protein 70 family protein [Theobroma cacao]
Length=765

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 117/194 (60%), Gaps = 21/194 (11%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS +TIGPFQS   ERA++KVKV+LNLHGIV+VESA L+EE                  
Sbjct  456  KISCFTIGPFQSSHIERARVKVKVQLNLHGIVTVESAMLIEE------------------  497

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
              DD   +  + ++++ ++ +  ++ SE+       KP    TD K      +     +P
Sbjct  498  HIDDSITRKDTHSEMSTKEAQHVANGSEDST-SVQSKPSHASTDGKTNDKATRR--LEIP  554

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            + E +YGA++ A++ +A +KE ++A  DR ME+TK+KKNA+E+YVY+MRNKL++ Y+ F 
Sbjct  555  ICENIYGAMTKAELIEAQDKELKLAQHDRTMEQTKEKKNALESYVYEMRNKLFNTYRSFA  614

Query  542  VDSEKEQLIAKLQE  583
             D EKE +   LQE
Sbjct  615  SDKEKEGISMSLQE  628



>ref|XP_009352433.1| PREDICTED: heat shock 70 kDa protein 16-like [Pyrus x bretschneideri]
Length=762

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 115/193 (60%), Gaps = 13/193 (7%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            I  + IGPFQ   GE+ ++KVKV L+LHG+VSVESA ++E+   +         +   M+
Sbjct  457  ICCFMIGPFQCSHGEKPRVKVKVMLDLHGVVSVESAMVMEDHRYDSSTRGLAGSKMEPMD  516

Query  185  TDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  364
            TD +    S+E           +D  E    ESG +     T  +A+   K  ++  +PV
Sbjct  517  TDYVTASGSTEA---------VADGFE----ESGMQHNSSHTGGEAKRNNKATRRLEIPV  563

Query  365  SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  544
            SE +YG ++ A++ +A EKE ++A QDRIME+TKDKKNA+E+YVY+MRNKL + Y+ F  
Sbjct  564  SESIYGGMTKAELSEAQEKELQLAQQDRIMEQTKDKKNALESYVYEMRNKLLNTYRSFAS  623

Query  545  DSEKEQLIAKLQE  583
            D E+E +   LQ+
Sbjct  624  DQEREGISRSLQQ  636



>gb|KDP39123.1| hypothetical protein JCGZ_00880 [Jatropha curcas]
Length=771

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 117/199 (59%), Gaps = 26/199 (13%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +IS++TIGPF     E+A++KVKV LNLHGIV+VESA L+E+             E  K+
Sbjct  456  QISSFTIGPFPGSCSEKARIKVKVLLNLHGIVTVESAMLMEDHAEGHARRGNAHPEVDKI  515

Query  182  ETDDIPPQDSSETDVNMQDDKVT-----SDASENHVLESGDKPVQMETDakaeapkkkvk  346
            E D +    SS    N  DD +T     SDAS N + +   + ++               
Sbjct  516  EVDSVA---SSTKLENGDDDDLTIHARSSDASANGMKDKASRRLE---------------  557

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
               +PVSE VYG ++ +++ +A EKEF++A QD+I+E+ KD+KNA+E+YVY+ RNKL++ 
Sbjct  558  ---IPVSEKVYGGITESELSEAKEKEFQLAQQDKIVEQAKDQKNALESYVYETRNKLFNT  614

Query  527  YQEFVVDSEKEQLIAKLQE  583
            Y+ F  D E+E +   LQE
Sbjct  615  YRSFASDREREGISRNLQE  633



>ref|XP_008348295.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=261

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +2

Query  386  LSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQL  565
            + P +VQKA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKY EFV +SE+E  
Sbjct  1    MPPNEVQKAIEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDKYHEFVTESEREAF  60

Query  566  IAKLQE  583
            IA+LQE
Sbjct  61   IARLQE  66



>ref|XP_007020851.1| Heat shock protein 70 family protein [Theobroma cacao]
 gb|EOY12376.1| Heat shock protein 70 family protein [Theobroma cacao]
Length=764

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 118/194 (61%), Gaps = 21/194 (11%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KI  +TIGPFQS   ERA++KVKV+LNLHGIV+VESA L+EE                  
Sbjct  456  KICCFTIGPFQSSHIERARVKVKVQLNLHGIVTVESAILIEE------------------  497

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
              DD   ++ + ++++ ++ +  +++SE+       KP     D       K  ++  +P
Sbjct  498  HVDDSITREDTHSEMSTKEAQHVTNSSEDSTTVR-SKPSHASAD--GRPNDKATRRLEIP  554

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            + E +YGA++ A++ +A +KE ++A  DR ME+TK++KNA+E+YVY+MRNKL++ Y+ F 
Sbjct  555  ICENIYGAMTKAELIEAQDKELKLAQHDRTMEQTKERKNALESYVYEMRNKLFNSYRSFA  614

Query  542  VDSEKEQLIAKLQE  583
             D EKE +   LQE
Sbjct  615  SDEEKEGISKSLQE  628



>emb|CBI26631.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 112/194 (58%), Gaps = 13/194 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KI  +TIGPFQ+  G  AK+KVKV LN+HGIV+VESA+L+E+ E +          S KM
Sbjct  78   KIGCFTIGPFQASHG--AKVKVKVHLNVHGIVTVESASLIEDHEDDSVTRDHAQLNSDKM  135

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            E + +    SS    N  +D  ++ +  +    +G       T               +P
Sbjct  136  EAESVSGSGSSVAVENGVEDGTSTQSKSSQTTSAGGVRKHKSTRRHE-----------IP  184

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            VSE +YG ++ A++ +A EKE ++  QDR +E+TK+KKNA+E+YVYDMRNKL+  Y+ F 
Sbjct  185  VSENIYGGMTEAELSEAQEKEIQLTQQDRTVEQTKEKKNALESYVYDMRNKLFHTYRSFA  244

Query  542  VDSEKEQLIAKLQE  583
             D E+E +   LQ+
Sbjct  245  SDQEREGISRSLQQ  258



>ref|XP_010278704.1| PREDICTED: heat shock 70 kDa protein 16 [Nelumbo nucifera]
Length=777

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 116/196 (59%), Gaps = 20/196 (10%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS + IGPFQ    E+ K+KVKV+LNLHGIV+++SA+L E+                  
Sbjct  456  KISCFKIGPFQVSHTEKTKVKVKVQLNLHGIVTIDSASLFED------------------  497

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESG-DKPVQMETDak-aeapkkkvkkTN  355
            + DD   + ++++ V+ +     SD   N   +    +P  +   A       + +K+  
Sbjct  498  QADDPVTRSNTQSKVDTESVSGPSDVVSNGAKDGCFSQPETLPMSAADGMRKGRFLKRLE  557

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            +PVSE +YG ++ ADV +A EKE ++A QDR ME+TKDKKNA+E+YVY+MRNKL++ Y+ 
Sbjct  558  MPVSETIYGGMTKADVLEAQEKELQLAQQDRTMEQTKDKKNALESYVYEMRNKLFNTYRS  617

Query  536  FVVDSEKEQLIAKLQE  583
            F  D E+E +   LQ+
Sbjct  618  FATDLEREGISRNLQQ  633



>ref|XP_010092150.1| Heat shock 70 kDa protein 16 [Morus notabilis]
 gb|EXB50301.1| Heat shock 70 kDa protein 16 [Morus notabilis]
Length=749

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 108/194 (56%), Gaps = 13/194 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS +TIGP Q    E+A++KVKV LNLHGIV VESATL+++         E       M
Sbjct  456  KISCFTIGPIQGTCSEKARVKVKVHLNLHGIVRVESATLIDDHVGNSVSRGEVHSMDA-M  514

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            + D       SE   N  +D  +     +H      K             +K  ++  +P
Sbjct  515  DVDGASVSGGSERVANGVEDSASIQTESSHPSAKATK------------EEKSTRRLEIP  562

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            VSE +YG ++  ++ +A EKE ++A QDR MEETK+KKNA+E+YVY+MRNKL+  Y+ F 
Sbjct  563  VSENIYGGMTKVELSEAQEKELQLAQQDRTMEETKNKKNALESYVYEMRNKLFSTYRSFA  622

Query  542  VDSEKEQLIAKLQE  583
             D E+E +   LQ+
Sbjct  623  SDQEREGISRSLQQ  636



>ref|XP_002522946.1| Heat-shock protein 105 kDa, putative [Ricinus communis]
 gb|EEF39376.1| Heat-shock protein 105 kDa, putative [Ricinus communis]
Length=740

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 113/194 (58%), Gaps = 22/194 (11%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS +TIGPF     E+A+LK+KV L+LHGIV++ES  L+E+   +         E  KM
Sbjct  456  KISFFTIGPFPGSHSEKARLKIKVHLSLHGIVTIESVMLMEDHMDDPVRRTSAHSEIEKM  515

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            + D     +  E D        +SDAS N  ++  DK  +               +  +P
Sbjct  516  DVDS---ANGDEDDAKFHVR--SSDASANGSIK--DKSSR---------------RLEIP  553

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            VSE +YG ++ A++ +A EKE +++ QDRI+E+ KD+KNA+E+YVY+MRNKL++ Y+ F 
Sbjct  554  VSENIYGGMTEAELSEAKEKELQLSQQDRIVEQAKDQKNALESYVYEMRNKLFNTYRSFA  613

Query  542  VDSEKEQLIAKLQE  583
             D E+E +   LQE
Sbjct  614  NDQEREGISRSLQE  627



>ref|XP_002278262.1| PREDICTED: heat shock 70 kDa protein 16 [Vitis vinifera]
Length=771

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 114/194 (59%), Gaps = 13/194 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KI  +TIGPFQ+  G  AK+KVKV LN+HGIV+VESA+L+E+ E +          S KM
Sbjct  456  KIGCFTIGPFQASHG--AKVKVKVHLNVHGIVTVESASLIEDHEDDSVTRDHAQLNSDKM  513

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            E + +    SS    N  +D  ++ +  +    +G       T           ++  +P
Sbjct  514  EAESVSGSGSSVAVENGVEDGTSTQSKSSQTTSAGGVRKHKST-----------RRHEIP  562

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            VSE +YG ++ A++ +A EKE ++  QDR +E+TK+KKNA+E+YVYDMRNKL+  Y+ F 
Sbjct  563  VSENIYGGMTEAELSEAQEKEIQLTQQDRTVEQTKEKKNALESYVYDMRNKLFHTYRSFA  622

Query  542  VDSEKEQLIAKLQE  583
             D E+E +   LQ+
Sbjct  623  SDQEREGISRSLQQ  636



>ref|XP_008226915.1| PREDICTED: heat shock 70 kDa protein 16 [Prunus mume]
Length=777

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 114/194 (59%), Gaps = 13/194 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS + IGPFQ    E+A++KVK++L+L+G+V VESA ++EE   +             M
Sbjct  456  KISCFKIGPFQCSHSEKARVKVKIQLDLNGVVFVESAMVIEEHGDDSSTRGVADSMD-PM  514

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            + D +    SSE   +   +  +  +  +H   SGD           +   K  ++  +P
Sbjct  515  DIDCVTASGSSEAVADGFQESSSMQSKSSHA--SGDG----------KRDNKSTRRLEIP  562

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            V+E +YG ++ A++ +A EKE ++  QDRIME+TKDKKNA+E+YVYDMRNKL++ Y+ F 
Sbjct  563  VTENIYGGMTKAELSEAQEKELQLGQQDRIMEQTKDKKNALESYVYDMRNKLFNTYRSFA  622

Query  542  VDSEKEQLIAKLQE  583
             D E+E +   LQ+
Sbjct  623  SDEEREGISRSLQQ  636



>ref|XP_010931798.1| PREDICTED: heat shock 70 kDa protein 16 [Elaeis guineensis]
Length=784

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 118/194 (61%), Gaps = 13/194 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS++ +GPFQ+   E+ K+KV+VRLNLHGIVSVESA+L+E++  +         +  + 
Sbjct  457  KISSFQVGPFQASWSEKPKVKVRVRLNLHGIVSVESASLVEDDINDPVSRDRSRMDRVEP  516

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            E     P D   T  N  ++  ++        E G +P   +        +   ++  + 
Sbjct  517  EFPSGVPHD---TVANTVENGTSTQT------EPGSRPSHAD----RIKREGTCRRNELA  563

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            +SE++YG ++  ++ +A E E  +A QD++ME+TKD+KNA+EAYVY++R+KL+DKY+ F 
Sbjct  564  ISEIIYGGMTKEELLEAQEHEQVLAFQDKVMEQTKDRKNALEAYVYEIRDKLFDKYRCFA  623

Query  542  VDSEKEQLIAKLQE  583
             DSE+E +  +LQ+
Sbjct  624  TDSEREGISGRLQQ  637



>ref|XP_002317001.1| hypothetical protein POPTR_0011s14240g [Populus trichocarpa]
 gb|EEE97613.1| hypothetical protein POPTR_0011s14240g [Populus trichocarpa]
Length=770

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 117/200 (59%), Gaps = 31/200 (16%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeee--vevpvvkeqlkeSTK  178
            +S++TIGPFQ+   E+A++KVKV+LNLHGIV+VESA L+E+               + TK
Sbjct  457  MSSFTIGPFQASSNEKARIKVKVQLNLHGIVTVESAMLVEDHMDDSARRGNIHPQMDRTK  516

Query  179  METDDIPPQDSSETDVNMQDDKVT-----SDASENHVLESGDKPVQMETDakaeapkkkv  343
            M++D       S T+V   +D  T     SDA+ N  L+  DK  Q              
Sbjct  517  MDSD-------SSTNVANSEDNTTVHSQSSDATGNGTLK--DKANQ--------------  553

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  523
             +  +PV+E +YG ++  ++ +A EKE  +A  D+ +E+ KD+KNA+E+YVY+MRNKL++
Sbjct  554  -RFEIPVNENIYGGMTKDELSEAQEKELHLAQHDKAVEQAKDQKNALESYVYEMRNKLFN  612

Query  524  KYQEFVVDSEKEQLIAKLQE  583
             Y+ F  D E+E +   LQE
Sbjct  613  TYRSFASDMEREGISRSLQE  632



>emb|CAN63915.1| hypothetical protein VITISV_004852 [Vitis vinifera]
Length=810

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 111/194 (57%), Gaps = 13/194 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KI  +TIGPFQ+  G  AK+KVKV LN HGIV+VESA+L+E+ E +          S KM
Sbjct  469  KIGCFTIGPFQASHG--AKVKVKVHLNXHGIVTVESASLIEDHEDDSVTRDHAQLNSDKM  526

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            E + +    SS    N  +D  ++ +  +    +G       T               +P
Sbjct  527  EAESVSGSGSSVAVENGVEDGTSTQSKSSQTTSAGGVRKHKSTRRH-----------EIP  575

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            VSE +YG ++ A++ +A EKE ++  QDR +E+TK+KKNA+E+YVYDMRNKL+  Y+ F 
Sbjct  576  VSENIYGGMTEAELSEAQEKEIQLTQQDRTVEQTKEKKNALESYVYDMRNKLFHTYRSFA  635

Query  542  VDSEKEQLIAKLQE  583
             D E+E +   LQ+
Sbjct  636  SDQEREGISRSLQQ  649



>ref|XP_004294376.1| PREDICTED: heat shock 70 kDa protein 16 [Fragaria vesca subsp. 
vesca]
Length=767

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 107/194 (55%), Gaps = 23/194 (12%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KI  + IGPF     ER ++KVK++L+LHGIVSV SA ++EE      +          M
Sbjct  456  KICCFRIGPFHGFNSERTRVKVKIQLDLHGIVSVVSARVVEEHGDNSKMD--------PM  507

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            +TD +    S E   +   + + S +S      +GD      T              ++P
Sbjct  508  DTDCVTASVSPEAPADGFQESMKSKSSH----AAGDGRHHKGTSR-----------LDIP  552

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            +SE +YG ++ A + +A  KE ++A QDR ME+TKDKKNA+E+YVYDMRNKL++ Y+ F 
Sbjct  553  ISENIYGGMTKAQLSEAQGKELQLAQQDRAMEQTKDKKNALESYVYDMRNKLFNTYRSFA  612

Query  542  VDSEKEQLIAKLQE  583
             D E+E +   LQ+
Sbjct  613  SDQEREAISRSLQQ  626



>ref|XP_007213641.1| hypothetical protein PRUPE_ppa001697mg [Prunus persica]
 gb|EMJ14840.1| hypothetical protein PRUPE_ppa001697mg [Prunus persica]
Length=777

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 113/194 (58%), Gaps = 13/194 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS + IGPFQ    E+ ++KVK++L+L+G+V VESA ++EE   +             M
Sbjct  456  KISCFKIGPFQCSHSEKTRVKVKIQLDLNGVVFVESAMMMEEHGDDSSTRGVADSMD-PM  514

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            + D +    SSE   +   +  +  +  +H   SGD           +   K  ++  +P
Sbjct  515  DIDCVTASGSSEAVGDGFQESSSMQSKSSHA--SGDG----------KRDNKSTRRLEIP  562

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            V+E +YG ++ A++ +A EKE ++  QDRIME+TKDKKNA+E+YVYDMRNKL++ Y+ F 
Sbjct  563  VTENIYGGMTKAELSEAQEKELQLGQQDRIMEQTKDKKNALESYVYDMRNKLFNTYRSFA  622

Query  542  VDSEKEQLIAKLQE  583
             D E+E +   LQ+
Sbjct  623  SDQEREGISRSLQQ  636



>ref|XP_008365284.1| PREDICTED: heat shock 70 kDa protein 16, partial [Malus domestica]
Length=683

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 112/193 (58%), Gaps = 13/193 (7%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            I  + IGPFQ   GE+ ++KVKV L+LHG+VSVESA ++E+   +         +   M+
Sbjct  457  ICCFXIGPFQCSHGEKTRVKVKVMLDLHGVVSVESAMVMEDHGDDSSTGGLAGSKMEPMD  516

Query  185  TDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  364
            TD +    S+E           +D  E    ES  +     T  +A+  KK  ++  +PV
Sbjct  517  TDYVTASGSTEA---------VADGFE----ESSMQHNSSHTGGEAKRNKKATRRLEIPV  563

Query  365  SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  544
            SE +YG ++ A++ +A EKE ++A QDRIME+TKDKKNA+E+YVY+M NKL + Y+ F  
Sbjct  564  SESIYGGMTKAELSEAQEKELQLAQQDRIMEQTKDKKNALESYVYEMXNKLLNTYRSFAS  623

Query  545  DSEKEQLIAKLQE  583
              E E +   LQ+
Sbjct  624  YQEMEGISRSLQQ  636



>gb|KHG25442.1| Heat shock 70 kDa 16 -like protein [Gossypium arboreum]
Length=757

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 106/193 (55%), Gaps = 29/193 (15%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            IS +TIGPFQ+   ERA++KVKV+LNLHGI                            +E
Sbjct  457  ISCFTIGPFQASNSERARVKVKVQLNLHGI--------------------------VTVE  490

Query  185  TDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  364
            +  +  +   +++++ ++ +  ++ SE+       KP     D K      +     +PV
Sbjct  491  SAMLIEEHVDDSELSTKEARHVTNGSEDGTYMQ-SKPSNASADGKTNDKTMRR--LEIPV  547

Query  365  SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  544
            SE + G ++  ++ +A +KE ++A QDR ME+TK+KKNA+E+YVY+MRNKL++ Y+ F  
Sbjct  548  SENINGTMTGVELMEAQDKELKLAQQDRTMEQTKEKKNALESYVYEMRNKLFNTYRGFAS  607

Query  545  DSEKEQLIAKLQE  583
            D E++ +   LQE
Sbjct  608  DEERDGISKSLQE  620



>gb|KJB22068.1| hypothetical protein B456_004G027900 [Gossypium raimondii]
 gb|KJB22070.1| hypothetical protein B456_004G027900 [Gossypium raimondii]
Length=757

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 106/193 (55%), Gaps = 29/193 (15%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            IS +TIGPFQ+   ERA++KVKV+LNLHGI                            +E
Sbjct  457  ISCFTIGPFQASNSERARVKVKVQLNLHGI--------------------------VNVE  490

Query  185  TDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  364
            +  +  +   +++++ ++ +  ++ SE+       KP     D K      +     +PV
Sbjct  491  SAMLIEEHVDDSELSTKEVRHVTNGSEDGTYMQ-PKPSNASADGKTNDKTMRR--LEIPV  547

Query  365  SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  544
            SE + G ++  ++ +A +KE ++A QDR ME+TK+KKNA+E+YVY+MRNKL++ Y+ F  
Sbjct  548  SENINGTMTGVELMEAQDKELKLAQQDRTMEQTKEKKNALESYVYEMRNKLFNIYRGFAS  607

Query  545  DSEKEQLIAKLQE  583
            D E+E +   LQE
Sbjct  608  DEEREGISKSLQE  620



>ref|XP_011030786.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Populus 
euphratica]
Length=770

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/195 (38%), Positives = 115/195 (59%), Gaps = 21/195 (11%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeee--vevpvvkeqlkeSTK  178
            +S++TIGPFQ+   E+AK+KVKV+LNLHGIV+VESA L+E+               + TK
Sbjct  457  MSSFTIGPFQASSNEKAKIKVKVQLNLHGIVTVESAMLVEDHLDDSARRGNIHPQMDRTK  516

Query  179  METDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNV  358
            M++D +    +SE +  +     +SDA+ N  L+  DK  Q               +  +
Sbjct  517  MDSDSLTNVANSEDNTAVHSQ--SSDATVNGTLK--DKANQ---------------RFEI  557

Query  359  PVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEF  538
            PV E + G ++  ++ +A EKE  +A  D+ +E+ KD+KNA+E+YVY+MRNKL++ Y+ F
Sbjct  558  PVKENISGGMTKDELTEAQEKELHLAQHDKAVEQAKDQKNALESYVYEMRNKLFNTYRSF  617

Query  539  VVDSEKEQLIAKLQE  583
              D E+E +   LQE
Sbjct  618  ASDKEREGISRSLQE  632



>gb|KHM99573.1| Heat shock 70 kDa protein 16 [Glycine soja]
Length=769

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 120/194 (62%), Gaps = 19/194 (10%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS  TIGPF    G + ++KV+V L+LHGIVS+ESATL++++  ++ +  +    S  M
Sbjct  456  KISCVTIGPFHGSHGSKIRVKVRVPLDLHGIVSIESATLIKDDMDDLVMAGDYHSNSDAM  515

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            + D I     SET  N  +D        N  LE    P        A+  +K  ++ NVP
Sbjct  516  DIDPI-----SETVTNGFEDDT------NKKLEF---PCS-----SADGTRKDNRRLNVP  556

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            V+E VYG ++ A++ +A+EKE ++A QDRI+E+TK+KKN++E++VYDMR+KL+  Y+ F 
Sbjct  557  VNENVYGGMTKAEISEALEKELQLAQQDRIVEQTKEKKNSLESFVYDMRSKLFHTYRSFA  616

Query  542  VDSEKEQLIAKLQE  583
             + EK+ +   LQE
Sbjct  617  SEQEKDGISRSLQE  630



>ref|XP_003532123.1| PREDICTED: heat shock 70 kDa protein 16-like [Glycine max]
Length=769

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 120/194 (62%), Gaps = 19/194 (10%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS  TIGPF    G + ++KV+V L+LHGIVS+ESATL++++  ++ +  +    S  M
Sbjct  456  KISCVTIGPFHGSHGSKIRVKVRVPLDLHGIVSIESATLIKDDMDDLVMAGDYHSNSDAM  515

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            + D I     SET  N  +D        N  LE    P        A+  +K  ++ NVP
Sbjct  516  DIDPI-----SETVTNGFEDDT------NKKLEF---PCS-----SADGTRKDNRRLNVP  556

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            V+E VYG ++ A++ +A+EKE ++A QDRI+E+TK+KKN++E++VYDMR+KL+  Y+ F 
Sbjct  557  VNENVYGGMTKAEISEALEKELQLAQQDRIVEQTKEKKNSLESFVYDMRSKLFHTYRSFA  616

Query  542  VDSEKEQLIAKLQE  583
             + EK+ +   LQE
Sbjct  617  SEQEKDGISRSLQE  630



>gb|AII99889.1| heat shock protein [Cicer arietinum]
Length=771

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 114/194 (59%), Gaps = 17/194 (9%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS +TIGP     G +  ++V+++LNLHGIV++ES+TL+E+   +    ++    S  +
Sbjct  456  KISCFTIGPLNGSHGSKMGVEVRIQLNLHGIVNIESSTLIEDHAEDSVTTRDCHSNSEAI  515

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            + + I     SETD N  + +       +H    G +              K  K+ +VP
Sbjct  516  DVEPI-----SETDQNTNEYRKDKKCESSHHSSDGTR------------KDKANKRLHVP  558

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            VSE +YG ++ A++ +A E+E ++  QDR ME TKDK+N++E+YVYDMRNKL+++Y+ F 
Sbjct  559  VSENIYGGMTQAEIIEAQEQECQLTQQDRTMELTKDKRNSLESYVYDMRNKLFNEYRNFA  618

Query  542  VDSEKEQLIAKLQE  583
             + E++ +   LQE
Sbjct  619  SEQERDGISRSLQE  632



>ref|XP_004491392.1| PREDICTED: heat shock 70 kDa protein 16-like [Cicer arietinum]
Length=773

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 114/194 (59%), Gaps = 17/194 (9%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS +TIGP     G +  ++V+++LNLHGIV++ES+TL+E+   +    ++    S  +
Sbjct  456  KISCFTIGPLNGSHGSKMGVEVRIQLNLHGIVNIESSTLIEDHAEDSVTTRDCHSNSEAI  515

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            + + I     SETD N  + +       +H    G +              K  K+ +VP
Sbjct  516  DVEPI-----SETDQNTNEYRKDKKCESSHHSSDGTR------------KDKANKRLHVP  558

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            VSE +YG ++ A++ +A E+E ++  QDR ME TKDK+N++E+YVYDMRNKL+++Y+ F 
Sbjct  559  VSENIYGGMTQAEIIEAQEQECQLTQQDRTMELTKDKRNSLESYVYDMRNKLFNEYRNFA  618

Query  542  VDSEKEQLIAKLQE  583
             + E++ +   LQE
Sbjct  619  SEQERDGISRSLQE  632



>ref|XP_007146461.1| hypothetical protein PHAVU_006G042400g [Phaseolus vulgaris]
 gb|ESW18455.1| hypothetical protein PHAVU_006G042400g [Phaseolus vulgaris]
Length=771

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 119/194 (61%), Gaps = 17/194 (9%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS  TIGPF    G ++++KV+V L+LHGI+++ESATL++ +  ++ +  +    S +M
Sbjct  456  KISCVTIGPFHGSHGSKSRVKVRVSLDLHGILNIESATLIKNDMDDLVMAGDHNSNSDEM  515

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            + D IP     ET  N  +D +T     N  LES    V            K  ++ +VP
Sbjct  516  DIDPIP-----ETVTNGFED-IT-----NKKLESPYSSVD------GIRKDKGTRRVDVP  558

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            V+E +YG ++ A++ +A EKE ++A QD I+E+TK+KKN++E+YVYDMR+KL+  Y+ F 
Sbjct  559  VNENIYGGMTKAEISEAREKELQLAQQDIIIEQTKEKKNSLESYVYDMRSKLFHTYRSFA  618

Query  542  VDSEKEQLIAKLQE  583
             + E++ +   LQE
Sbjct  619  SEHERDDISRSLQE  632



>ref|XP_009420545.1| PREDICTED: heat shock 70 kDa protein 16 [Musa acuminata subsp. 
malaccensis]
Length=781

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 113/202 (56%), Gaps = 30/202 (15%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS + +GPF   +GER K+KVKVRLNLHG+VSVES                     + +
Sbjct  457  KISCFQVGPFPVHEGERYKVKVKVRLNLHGMVSVESV--------------------SLI  496

Query  182  ETDD--IPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTN  355
            E DD     +D+S  D NM+ +   SDA+ +  + + +  +    +  +       K   
Sbjct  497  EDDDNSTVSRDASRVD-NMETEP-ASDANSDSTVHTAENGIYEHVEHGSIPSSDTSKAER  554

Query  356  VP------VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKL  517
            +P      ++E +YG  +   + +A E+E  +A QD+ ME+TKDKKNA+EAYVY++RNKL
Sbjct  555  LPRRHELLITETIYGGTTKEWLLEAQEQEKWLAYQDKQMEQTKDKKNALEAYVYEIRNKL  614

Query  518  YDKYQEFVVDSEKEQLIAKLQE  583
            +++Y+ F  DSE+E +   LQ+
Sbjct  615  FERYRSFANDSEREGISVSLQQ  636



>ref|XP_009352450.1| PREDICTED: heat shock 70 kDa protein 16-like, partial [Pyrus 
x bretschneideri]
Length=736

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 109/197 (55%), Gaps = 21/197 (11%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            I  +TIGPFQ   GER  +KVK  L+LHG+VSVESA ++E+   +           + ME
Sbjct  457  ICCFTIGPFQCSHGERTMVKVKFMLDLHGVVSVESAMVMEDHGDDSSTRGLA---GSTME  513

Query  185  TDDIPPQDSSETDVNMQDDKVTSDASENHVL----ESGDKPVQMETDakaeapkkkvkkT  352
              DI              D VT+      V     ES  +     T  +A+  KK  ++ 
Sbjct  514  PMDI--------------DCVTASGYTGAVADGFEESSTQHNSSHTGGEAKRNKKATRRL  559

Query  353  NVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQ  532
             +PVSE +YG ++ A++ +A EKE ++A  DRIME+ KDKKNA+E+YVY+M+ KL + YQ
Sbjct  560  EIPVSESIYGGMTKAELSEAQEKELQLAQWDRIMEQIKDKKNALESYVYEMQTKLLNTYQ  619

Query  533  EFVVDSEKEQLIAKLQE  583
             F  D E+E +   LQ+
Sbjct  620  SFASDQEREGISRSLQQ  636



>ref|XP_007024113.1| Heat shock protein 91 isoform 2 [Theobroma cacao]
 gb|EOY26735.1| Heat shock protein 91 isoform 2 [Theobroma cacao]
Length=575

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 89/110 (81%), Gaps = 6/110 (5%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPF + + ER KLKVKVRLNLHGIVS+ESATLLEEEEVEVPV KE +KE TKM
Sbjct  459  KISTYTIGPFPTIRSERPKLKVKVRLNLHGIVSLESATLLEEEEVEVPVSKEPVKEDTKM  518

Query  182  ETDDIPPQDSS----ETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETD  313
            ETD+IP   ++    ETDVNMQD K T+DA   EN V ESGDKPVQMETD
Sbjct  519  ETDEIPSDAAAPCANETDVNMQDAKGTADAEGVENGVPESGDKPVQMETD  568



>ref|XP_003553093.1| PREDICTED: heat shock 70 kDa protein 16-like [Glycine max]
Length=766

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 116/193 (60%), Gaps = 22/193 (11%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            IS  TIGPF    G + ++KV+V L+LHGIVS+ESATL++++ V           S  M+
Sbjct  457  ISCVTIGPFHGSHGSKIRVKVRVPLDLHGIVSIESATLIKDDSVMAGDYHSN---SDAMD  513

Query  185  TDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  364
             D I     SET  N  +D        N  LES   P        A+  +K  ++ NVPV
Sbjct  514  IDPI-----SETVTNGFEDNT------NKNLES---PCS-----SADGTRKDNRRLNVPV  554

Query  365  SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  544
            +E VYG ++ A++ +A EKE ++A QDRI+E+TK+KKN++E+YVYDMR+KL+  Y+ F  
Sbjct  555  NENVYGGMTKAEISEAREKELQLAHQDRIVEQTKEKKNSLESYVYDMRSKLFHTYRSFAS  614

Query  545  DSEKEQLIAKLQE  583
            + EK+ +   LQE
Sbjct  615  EQEKDDISRTLQE  627



>ref|XP_011030785.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Populus 
euphratica]
Length=771

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 116/196 (59%), Gaps = 22/196 (11%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeee--vevpvvkeqlkeSTK  178
            +S++TIGPFQ+   E+AK+KVKV+LNLHGIV+VESA L+E+               + TK
Sbjct  457  MSSFTIGPFQASSNEKAKIKVKVQLNLHGIVTVESAMLVEDHLDDSARRGNIHPQMDRTK  516

Query  179  METDDIPPQDSSETDVNMQDDKVTSDASE-NHVLESGDKPVQMETDakaeapkkkvkkTN  355
            M++D +    +SE +  +     +SDA++ N  L+  DK  Q               +  
Sbjct  517  MDSDSLTNVANSEDNTAVHSQ--SSDATQVNGTLK--DKANQ---------------RFE  557

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            +PV E + G ++  ++ +A EKE  +A  D+ +E+ KD+KNA+E+YVY+MRNKL++ Y+ 
Sbjct  558  IPVKENISGGMTKDELTEAQEKELHLAQHDKAVEQAKDQKNALESYVYEMRNKLFNTYRS  617

Query  536  FVVDSEKEQLIAKLQE  583
            F  D E+E +   LQE
Sbjct  618  FASDKEREGISRSLQE  633



>ref|XP_006475182.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Citrus 
sinensis]
 gb|KDO62656.1| hypothetical protein CISIN_1g004296mg [Citrus sinensis]
Length=708

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 109/194 (56%), Gaps = 14/194 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            K+S +TIGPFQ    E AK+KV V+LNLHGIVSVESA L+E    +         +  KM
Sbjct  458  KVSCFTIGPFQGSNSENAKVKVTVKLNLHGIVSVESAWLIEGHGDDPVTKHNARSKMDKM  517

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            E++ +   DSS T  ++QD       S +    S  +              K  ++ ++ 
Sbjct  518  ESEGVS-IDSSTTVEDVQDSASVQSKSSHSSAVSVVR-------------DKAGRRLDIS  563

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            +SE +YG ++  ++  A E E  +A QD  ME+TKDKKNA+E+YVY+MRNKL+  Y+ F 
Sbjct  564  ISETIYGGMTKPELALAQETENLLAQQDITMEQTKDKKNALESYVYEMRNKLFSTYRSFA  623

Query  542  VDSEKEQLIAKLQE  583
             D E+E +   LQE
Sbjct  624  SDQEREGISRSLQE  637



>gb|KJB22069.1| hypothetical protein B456_004G027900 [Gossypium raimondii]
Length=686

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 105/194 (54%), Gaps = 29/194 (15%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            ++  Y IGPFQ+   ERA++KVKV+LNLHGI                            +
Sbjct  385  RVRDYEIGPFQASNSERARVKVKVQLNLHGI--------------------------VNV  418

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            E+  +  +   +++++ ++ +  ++ SE+       KP     D K      +     +P
Sbjct  419  ESAMLIEEHVDDSELSTKEVRHVTNGSEDGTYMQ-PKPSNASADGKTNDKTMRR--LEIP  475

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            VSE + G ++  ++ +A +KE ++A QDR ME+TK+KKNA+E+YVY+MRNKL++ Y+ F 
Sbjct  476  VSENINGTMTGVELMEAQDKELKLAQQDRTMEQTKEKKNALESYVYEMRNKLFNIYRGFA  535

Query  542  VDSEKEQLIAKLQE  583
             D E+E +   LQE
Sbjct  536  SDEEREGISKSLQE  549



>emb|CDP04389.1| unnamed protein product [Coffea canephora]
Length=767

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 109/195 (56%), Gaps = 20/195 (10%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS + IGP+Q    E+AK+KV+V LN+HGIV VESA+L+E+   +          S  M
Sbjct  455  KISDFMIGPYQVSHSEKAKVKVRVHLNIHGIVGVESASLIEDHADDPTSNNCADALSENM  514

Query  182  ETDDIPP--QDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTN  355
            ET +       +   D N    K +  A+       GD+     T           ++ +
Sbjct  515  ETSNHETFYTANGPGDSNSAHSKFSPAAA-------GDERRAKAT-----------RRQD  556

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            +P+SE + G ++P ++ +A EKE ++A QD  ME TKD+KN++E+YVYD RNKL + Y+ 
Sbjct  557  IPISENICGGMTPVELSQAQEKELQLAEQDTKMERTKDRKNSLESYVYDTRNKLLNSYRS  616

Query  536  FVVDSEKEQLIAKLQ  580
            F  D+E+E + + LQ
Sbjct  617  FATDAEREGISSSLQ  631



>ref|XP_006452327.1| hypothetical protein CICLE_v10007538mg [Citrus clementina]
 ref|XP_006475181.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Citrus 
sinensis]
 gb|ESR65567.1| hypothetical protein CICLE_v10007538mg [Citrus clementina]
 gb|KDO62654.1| hypothetical protein CISIN_1g004296mg [Citrus sinensis]
 gb|KDO62655.1| hypothetical protein CISIN_1g004296mg [Citrus sinensis]
Length=763

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 109/194 (56%), Gaps = 14/194 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            K+S +TIGPFQ    E AK+KV V+LNLHGIVSVESA L+E    +         +  KM
Sbjct  458  KVSCFTIGPFQGSNSENAKVKVTVKLNLHGIVSVESAWLIEGHGDDPVTKHNARSKMDKM  517

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            E++ +   DSS T  ++QD       S +    S  +              K  ++ ++ 
Sbjct  518  ESEGVS-IDSSTTVEDVQDSASVQSKSSHSSAVSVVR-------------DKAGRRLDIS  563

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            +SE +YG ++  ++  A E E  +A QD  ME+TKDKKNA+E+YVY+MRNKL+  Y+ F 
Sbjct  564  ISETIYGGMTKPELALAQETENLLAQQDITMEQTKDKKNALESYVYEMRNKLFSTYRSFA  623

Query  542  VDSEKEQLIAKLQE  583
             D E+E +   LQE
Sbjct  624  SDQEREGISRSLQE  637



>ref|XP_004966217.1| PREDICTED: heat shock 70 kDa protein 16-like [Setaria italica]
Length=750

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 112/194 (58%), Gaps = 46/194 (24%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +I ++ IGPFQ+   E +K+KVK+RLNLHG++SVESA L                     
Sbjct  460  RIGSFQIGPFQADT-EASKVKVKIRLNLHGLISVESAAL---------------------  497

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
              DD   ++++  D +M+ D    D S N      ++ +Q +               ++P
Sbjct  498  -IDDYE-RNATSAD-HMEVDSSGDDTSRN------ERSIQRQ---------------DLP  533

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            ++E +YGA+S  ++ +A E+E ++A QD++ME TKD+KNA+E+YVYD RNKL ++Y+ F 
Sbjct  534  IAEYIYGAMSKQELLEAQEQEQQLAYQDKLMERTKDRKNALESYVYDTRNKLSERYRSFA  593

Query  542  VDSEKEQLIAKLQE  583
             DSE+E++   LQ+
Sbjct  594  TDSEREEISVNLQQ  607



>gb|KHN45217.1| Heat shock 70 kDa protein 16 [Glycine soja]
Length=766

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/193 (35%), Positives = 106/193 (55%), Gaps = 22/193 (11%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            IS  TIGPF    G + ++KV+V L+LHGIVS+E                     S  + 
Sbjct  457  ISCVTIGPFHGSHGSKIRVKVRVPLDLHGIVSIE---------------------SATLI  495

Query  185  TDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  364
             DD+       ++ +  D    S+   N   ++ +K ++    +     K   +  NVPV
Sbjct  496  KDDLVMAGDYHSNSDAMDIDPISETVTNGFEDNTNKNLESPCSSADGTRKDNRR-LNVPV  554

Query  365  SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  544
            +E VYG ++ A++ +A EKE ++A QDRI+E+TK+KKN++E+YVYDMR+KL+  Y+ F  
Sbjct  555  NENVYGGMTKAEILEAHEKELQLAHQDRIVEQTKEKKNSLESYVYDMRSKLFHTYRSFAS  614

Query  545  DSEKEQLIAKLQE  583
            + EK+ +   LQE
Sbjct  615  EQEKDDISRTLQE  627



>ref|XP_008806738.1| PREDICTED: heat shock 70 kDa protein 16 isoform X1 [Phoenix dactylifera]
Length=783

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 119/194 (61%), Gaps = 13/194 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS + +GPFQ+ + E+ K+KV+VRLNLHGIVSVESA+L+E++  +      +  ++ + 
Sbjct  457  KISCFQVGPFQASRSEKPKVKVRVRLNLHGIVSVESASLIEDDIDDPVSRDTRRIDTVEP  516

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            E     P D++   V       T         E G +P Q +        +   ++  + 
Sbjct  517  EIASGGPHDTAANTVENGTSAQT---------EPGSRPSQAD----RIKREGTRRRNELA  563

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            V+E +YG ++  ++ +A E+E  +A QD++ME+TKD+KN++EAYVY++R+KL+DKY+ F 
Sbjct  564  VAETIYGGMTKEELLEAQEQEQALAYQDKVMEQTKDRKNSLEAYVYEIRDKLFDKYRCFA  623

Query  542  VDSEKEQLIAKLQE  583
             DSE+E +  +LQ+
Sbjct  624  TDSEREGISVRLQQ  637



>ref|XP_003563414.2| PREDICTED: heat shock 70 kDa protein 16 [Brachypodium distachyon]
Length=736

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 109/194 (56%), Gaps = 44/194 (23%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KI ++ IGPF +   E++K+KVK+RLNLHG++SVES                    +  +
Sbjct  455  KIGSFQIGPFHA-HTEKSKVKVKIRLNLHGLISVES--------------------AVLI  493

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            E D      S   +V+  +D    D S N      ++P+Q +               ++ 
Sbjct  494  EDDQRDTNSSDSMEVDHNND--VGDKSRN------ERPIQRQ---------------DLQ  530

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            +   +YGA+S  ++ +A E+E+++A QD++ME TK++KNA+E+YVYD+RNKL ++Y+ F 
Sbjct  531  IIGSIYGAMSKQELLEAQEQEYQLAYQDKLMERTKERKNALESYVYDIRNKLSERYRSFA  590

Query  542  VDSEKEQLIAKLQE  583
             DSE+EQ+   LQ+
Sbjct  591  TDSEREQISVNLQQ  604



>gb|KJB35057.1| hypothetical protein B456_006G098500 [Gossypium raimondii]
Length=628

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 103/131 (79%), Gaps = 6/131 (5%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTY IGPF + + E+ KLKVKVRLNLHGIVSVESATLLEEEEVEVPV KE  KE  KM
Sbjct  459  KISTYMIGPFPTLRSEKPKLKVKVRLNLHGIVSVESATLLEEEEVEVPVSKEPAKEDAKM  518

Query  182  ETDDIPPQDSS----ETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  343
            ETD+ P   S+    ETDVNMQD K T++A+  EN V +SGDKPVQMETD K EAPKKKV
Sbjct  519  ETDEKPNDTSAPGANETDVNMQDAKGTAEAAGVENGVPQSGDKPVQMETDTKVEAPKKKV  578

Query  344  kkTNVPVSELV  376
            KKTNVPV+E  
Sbjct  579  KKTNVPVAEFC  589



>gb|AFA36608.1| 70 kDa heat shock protein, partial [Lolium perenne]
Length=289

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 107/150 (71%), Gaps = 11/150 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlke--ST  175
            KISTYTIGPFQ  KGE+AKLKVKVRLN+HGIVS+ESA +LEEEEVEVPV         +T
Sbjct  145  KISTYTIGPFQPSKGEKAKLKVKVRLNIHGIVSLESAMMLEEEEVEVPVSATSEVPKDAT  204

Query  176  KMETDDIPPQDSSETDVNMQDDKVTSD----ASENHVLESGDKPVQMETDakaeapkkkv  343
            KM+T      D+   D NMQ+ K  SD    A+EN   +S +K V M+TD K E  KKKV
Sbjct  205  KMDT-----DDAPRDDDNMQESKGASDTAEGAAENGAGDSEEKTVPMDTDTKVEPSKKKV  259

Query  344  kkTNVPVSELVYGALSPADVQKAVEKEFEM  433
            KKTNVPV+E VYGA++  ++ KAVEKE+EM
Sbjct  260  KKTNVPVAETVYGAMAADELAKAVEKEYEM  289



>ref|XP_008366399.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=777

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 111/193 (58%), Gaps = 13/193 (7%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            I  +TIGPFQ    ++ ++KVKV LNLHG+VSVESA ++EE   +         +   M+
Sbjct  457  ICCFTIGPFQCSHSKKTRVKVKVVLNLHGVVSVESAMVMEEHGDDSSTRGLADSKMDPMD  516

Query  185  TDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  364
             D +    S+E    + D    S    N    SGD           E   K  ++  +PV
Sbjct  517  IDYVTASGSTEA---VADGFEKSSIQHNSSHTSGDP----------ERNNKASRRLEIPV  563

Query  365  SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  544
            SE +YG ++ A++ +A +KE ++A  DRIME+TKDKKNA+E+YVY+MRNKL++ Y+ F  
Sbjct  564  SESMYGGMTKAELSEAQDKELQLAQHDRIMEQTKDKKNALESYVYEMRNKLFNTYRSFAS  623

Query  545  DSEKEQLIAKLQE  583
            D E+E +   LQ+
Sbjct  624  DQEREGISRSLQQ  636



>ref|XP_008806739.1| PREDICTED: heat shock 70 kDa protein 16 isoform X2 [Phoenix dactylifera]
Length=782

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 121/194 (62%), Gaps = 14/194 (7%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS + +GPFQ+ + E+ K+KV+VRLNLHGIVSVESA+L+E++  +      +  ++ + 
Sbjct  457  KISCFQVGPFQASRSEKPKVKVRVRLNLHGIVSVESASLIEDDIDDPVSRDTRRIDTVEP  516

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            E     P D++   V    +  TS  +E     S D+  +  T           ++  + 
Sbjct  517  EIASGGPHDTAANTV----ENGTSAQTEPGSRPSADRIKREGT----------RRRNELA  562

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            V+E +YG ++  ++ +A E+E  +A QD++ME+TKD+KN++EAYVY++R+KL+DKY+ F 
Sbjct  563  VAETIYGGMTKEELLEAQEQEQALAYQDKVMEQTKDRKNSLEAYVYEIRDKLFDKYRCFA  622

Query  542  VDSEKEQLIAKLQE  583
             DSE+E +  +LQ+
Sbjct  623  TDSEREGISVRLQQ  636



>ref|XP_006595737.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Glycine 
max]
Length=773

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 110/193 (57%), Gaps = 17/193 (9%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS +TI PF    G +A++KV+V+LNLHGI+S+ESATL+E+   +     +    S  M
Sbjct  456  KISCFTIDPFHGSHGSKARIKVRVQLNLHGIISIESATLMEDHVDDSVTTGDYHSNSEAM  515

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
              + +     SET  N+ +D +         L  G K              K  ++ +VP
Sbjct  516  NVEPV-----SETVENVTEDSINKKCEAPRHLADGTK------------KDKANRRLHVP  558

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            VSE +YG ++ A++ +A EKE ++A QDR +E TKD+KN++E+Y+Y+ R+KL+  Y  F 
Sbjct  559  VSENIYGGMTKAEILEAQEKELQLADQDRTIELTKDRKNSLESYIYETRSKLFSTYLSFS  618

Query  542  VDSEKEQLIAKLQ  580
             + E++ +   L+
Sbjct  619  SEHERKDISRSLK  631



>ref|XP_004167874.1| PREDICTED: LOW QUALITY PROTEIN: heat shock 70 kDa protein 16-like 
[Cucumis sativus]
Length=762

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 108/199 (54%), Gaps = 42/199 (21%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KI  +TIGPFQ      +++KV+V+LN++GI++VE                     S  +
Sbjct  456  KIGCFTIGPFQGSNNSNSRVKVRVQLNMNGIITVE---------------------SATL  494

Query  182  ETDDI----PPQDSSETDV-NMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvk  346
              D I    P +D++ ++   M+ + V S  SE+ V        +++             
Sbjct  495  VEDTIDQQMPRRDATYSNTEKMETEFVDSSHSESDVSRKARGTRRID-------------  541

Query  347  kTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDK  526
               +PVSE +YG ++ A++ +A  +E ++A QD+ ME+ K+KKNA+E+YVY+MRNKL++ 
Sbjct  542  ---IPVSEHIYGGMTKAELLEAQGRELQLAQQDKNMEQAKNKKNALESYVYEMRNKLFNT  598

Query  527  YQEFVVDSEKEQLIAKLQE  583
            Y+ F  D E+E + + LQ+
Sbjct  599  YRSFASDQEREGISSSLQQ  617



>ref|XP_004151979.1| PREDICTED: heat shock 70 kDa protein 16-like [Cucumis sativus]
 gb|KGN57923.1| hypothetical protein Csa_3G391900 [Cucumis sativus]
Length=762

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 115/195 (59%), Gaps = 34/195 (17%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeST-K  178
            KI  +TIGPFQ      +++KV+V+LN++GI++VESATL+E+   +    ++    +T K
Sbjct  456  KIGCFTIGPFQGSNNSNSRVKVRVQLNMNGIITVESATLVEDTIDQQMPRRDATYSNTEK  515

Query  179  METDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNV  358
            MET+ +   DSS ++         SD S       G + +                  ++
Sbjct  516  METEFV---DSSHSE---------SDVSRK---ARGTRRI------------------DI  542

Query  359  PVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEF  538
            PVSE +YG ++ A++ +A  +E ++A QD+ ME+ K+KKNA+E+YVY+MRNKL++ Y+ F
Sbjct  543  PVSEHIYGGMTKAELLEAQGRELQLAQQDKNMEQAKNKKNALESYVYEMRNKLFNTYRSF  602

Query  539  VVDSEKEQLIAKLQE  583
              D E+E + + LQ+
Sbjct  603  ASDQEREGISSSLQQ  617



>ref|XP_008465078.1| PREDICTED: heat shock 70 kDa protein 16 [Cucumis melo]
 ref|XP_008465079.1| PREDICTED: heat shock 70 kDa protein 16 [Cucumis melo]
Length=762

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 116/197 (59%), Gaps = 38/197 (19%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeST-K  178
            KI  +TIGPFQ      +++KV+V+LN++GI++VESAT++E+   +    ++    +T K
Sbjct  456  KIGCFTIGPFQGSNNSNSRVKVRVQLNMNGIITVESATIVEDTIDQQISRRDATHSNTEK  515

Query  179  METDDIPPQDS--SETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkT  352
            MET+ +   DS  SE+DV+ +                G + +                  
Sbjct  516  METEFV---DSFHSESDVSRK--------------ARGTRRI------------------  540

Query  353  NVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQ  532
            ++PVSE +YG ++ A++ +A  +E ++A QD+ ME+ K+KKNA+E+YVY+MRNKL++ Y+
Sbjct  541  DIPVSEHIYGGMTKAELLEAQGRELQLAQQDKNMEQAKNKKNALESYVYEMRNKLFNTYR  600

Query  533  EFVVDSEKEQLIAKLQE  583
             F  D E+E + + LQ+
Sbjct  601  SFASDQEREGISSSLQQ  617



>ref|XP_002973871.1| hypothetical protein SELMODRAFT_267697 [Selaginella moellendorffii]
 gb|EFJ24826.1| hypothetical protein SELMODRAFT_267697 [Selaginella moellendorffii]
Length=751

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 66/195 (34%), Positives = 102/195 (52%), Gaps = 53/195 (27%)
 Frame = +2

Query  8    STYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMET  187
            +T+T+GP    K E ++L++ + LN HGI+ + S                    +T ME 
Sbjct  478  ATFTVGPLSCRKPESSRLRLSIHLNQHGILMLSS--------------------ATLMED  517

Query  188  DDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDa---kaeapkkkvkkTNV  358
            ++                           LESG   +Q ET     + ++  ++++ T+V
Sbjct  518  EE---------------------------LESG---MQQETSLCRFQGQSRMRRLRHTDV  547

Query  359  PVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEF  538
            P+ E+    LS  ++Q A+EKEFEM  QDR+ EETK+ KNA+EA VYDMRNK Y K QE+
Sbjct  548  PIVEMTTKELSSLELQNAIEKEFEMEFQDRVSEETKEAKNALEALVYDMRNKFYGKLQEY  607

Query  539  VVDSEKEQLIAKLQE  583
              ++EK+ L+ KLQ+
Sbjct  608  ASETEKKDLLKKLQD  622



>ref|XP_006657253.1| PREDICTED: heat shock 70 kDa protein 16-like [Oryza brachyantha]
Length=729

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 108/193 (56%), Gaps = 41/193 (21%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            + ++ IGPFQ+   E++K+K+++RLNLHG++                             
Sbjct  440  VGSFQIGPFQA-HTEKSKVKLRIRLNLHGLI-----------------------------  469

Query  185  TDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  364
                    S E+   + DD+  ++++++  ++S     +M          K +++ ++P+
Sbjct  470  --------SVESAALVDDDQSNANSADSMEVDSNG---EMGQQGDTSRSGKLIQRQDLPI  518

Query  365  SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  544
             E +YGA+S  ++ +A E+E ++A QD++ME TKD+KNA+E+YVYD RNKL ++Y+ F  
Sbjct  519  IESIYGAMSKQELLEAQEQETQLAYQDKLMERTKDRKNALESYVYDTRNKLSERYRSFAT  578

Query  545  DSEKEQLIAKLQE  583
            DSE+E++   LQ+
Sbjct  579  DSEREEISFNLQQ  591



>ref|XP_009614255.1| PREDICTED: heat shock 70 kDa protein 16 [Nicotiana tomentosiformis]
Length=753

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 99/194 (51%), Gaps = 43/194 (22%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS  TIGPFQ    E+AK+KVK++LNLHGIV+VESA L++++             +  M
Sbjct  456  KISKSTIGPFQVPHSEKAKIKVKIQLNLHGIVTVESAWLIKDQTSHSTSENNTDTHAEDM  515

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            E DD     +    V  QD                                       +P
Sbjct  516  EGDDTRKSKA----VKRQD---------------------------------------IP  532

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            VSE V G ++ A++ +A EKE ++A QD  +E TKDKKN +EAYVY+ RNKL + Y+ F 
Sbjct  533  VSESVNGGMTLAELSQAQEKECQLAEQDIKVERTKDKKNTLEAYVYETRNKLLNTYRSFA  592

Query  542  VDSEKEQLIAKLQE  583
             DSE+E +   LQ+
Sbjct  593  TDSEREGISCNLQQ  606



>ref|XP_009760615.1| PREDICTED: heat shock 70 kDa protein 16 [Nicotiana sylvestris]
 ref|XP_009760616.1| PREDICTED: heat shock 70 kDa protein 16 [Nicotiana sylvestris]
Length=753

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 97/194 (50%), Gaps = 43/194 (22%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS  TIGPFQ    E+AK+KVK++LNLHGIV+VESA L++++             +  M
Sbjct  456  KISKSTIGPFQVPNSEKAKIKVKIQLNLHGIVTVESAWLIKDQTSHSTSENNTDTHAEDM  515

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            E DD          V  QD                                       +P
Sbjct  516  EGDDT----RKSMAVKRQD---------------------------------------IP  532

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            VSE V G ++ A++ +A EKE  +A QD  +E TKDKKN +EAYVY+ RNKL + Y+ F 
Sbjct  533  VSESVNGGMTLAELSQAQEKECHLAEQDIKVERTKDKKNTLEAYVYETRNKLLNTYRSFA  592

Query  542  VDSEKEQLIAKLQE  583
             DSE+E +   LQ+
Sbjct  593  TDSEREGISCNLQQ  606



>gb|AET00484.2| heat shock 70 kDa protein [Medicago truncatula]
Length=774

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 111/194 (57%), Gaps = 17/194 (9%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS +TIGPFQ     +A ++V++ LNLHGIVS+ES+TL+E+   +    +E    S   
Sbjct  456  KISCFTIGPFQRSGESKAVVEVRIDLNLHGIVSIESSTLIEDRVEDSVTPREYQSNS---  512

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            E  D+ P   SET+ N  +  +       H    G +              K   + ++P
Sbjct  513  EAGDVEP--ISETEQNDNEHSINEKCGSPHRSSDGTR------------KDKANIRVHIP  558

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            VSE VYG ++ A+V +A EKE ++  QD  ME TKDK+N++E+YVYD+RNKL ++Y++F 
Sbjct  559  VSENVYGGMTKAEVTEAQEKERQLMQQDITMELTKDKRNSLESYVYDVRNKLLNEYRKFA  618

Query  542  VDSEKEQLIAKLQE  583
             + EK+ +   L E
Sbjct  619  SEQEKDGISRSLLE  632



>ref|XP_008648938.1| PREDICTED: LOW QUALITY PROTEIN: heat shock 70 kDa protein 16-like 
[Zea mays]
Length=838

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 67/193 (35%), Positives = 106/193 (55%), Gaps = 43/193 (22%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            I ++ IGPFQ+   E +K+KVK+RLNLHG+VSVESA L+ + +           +S+   
Sbjct  546  IGSFQIGPFQA-HTEASKVKVKIRLNLHGLVSVESAVLINDYQRNGSSTDHMEVDSSG--  602

Query  185  TDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  364
             DD+  +  SE  +  Q+                                       +P+
Sbjct  603  -DDMGHKSRSERSIQRQE---------------------------------------LPI  622

Query  365  SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  544
            +E +YGA+S  ++ +A E+E ++A QD+++E TKD+KNA+E+YVYD RNKL ++Y+ F  
Sbjct  623  TEYIYGAMSKHELLEAQEQEQQLAYQDKLVEWTKDRKNALESYVYDTRNKLSERYRSFAT  682

Query  545  DSEKEQLIAKLQE  583
            DSE+EQ+   LQ+
Sbjct  683  DSEREQISVNLQQ  695



>dbj|BAD45483.1| putative heat-shock protein [Oryza sativa Japonica Group]
 gb|EAZ38028.1| hypothetical protein OsJ_22372 [Oryza sativa Japonica Group]
Length=753

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 108/194 (56%), Gaps = 44/194 (23%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KI  + IGPFQ+   E++K+KV++RLNLHG+VSVE                     S  +
Sbjct  461  KIGAFQIGPFQA-HTEKSKVKVRIRLNLHGLVSVE---------------------SAAL  498

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
              DD             Q D  ++D+ E  V  +G+   Q++         +  +   +P
Sbjct  499  IDDD-------------QSDAHSADSME--VDSNGEMGQQVD-------KSRSERLIQLP  536

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            + + +YGA+S  ++ +A E+E ++A QD++ME TK++KNA+E+YVYD RNKL ++Y+ F 
Sbjct  537  IVQSIYGAMSNQELLEAQEQESQLAYQDKLMERTKERKNALESYVYDTRNKLSERYRSFA  596

Query  542  VDSEKEQLIAKLQE  583
             DSE+E++   LQ+
Sbjct  597  TDSEREEISLSLQQ  610



>gb|EYU27799.1| hypothetical protein MIMGU_mgv1a001740mg [Erythranthe guttata]
Length=766

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 103/197 (52%), Gaps = 35/197 (18%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +IS++ IGPF+    ER K+KVK++LNLHGI                            +
Sbjct  456  RISSFKIGPFRVSHEERTKIKVKLQLNLHGIF--------------------------SI  489

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDK---PVQMETDakaeapkkkvkkT  352
            E+  +      ++ VN + D + S+  E    ES DK   P   E         K +++ 
Sbjct  490  ESASLVDDQVDDSTVNNRID-IHSENFEPSNHESSDKANGPFGHEM-----RRLKAIRRQ  543

Query  353  NVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQ  532
            ++ + E V+G ++  ++ +A EKE ++A QD  ME TK+KKN +EAYVY+ RNKL + Y+
Sbjct  544  DIFIDETVHGGMTQGELSQAQEKELQLAQQDINMERTKEKKNTLEAYVYETRNKLLNSYR  603

Query  533  EFVVDSEKEQLIAKLQE  583
             F  DSEKE + + LQ+
Sbjct  604  SFATDSEKEGICSNLQQ  620



>gb|EYU27798.1| hypothetical protein MIMGU_mgv1a001740mg [Erythranthe guttata]
Length=722

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 101/197 (51%), Gaps = 35/197 (18%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +IS++ IGPF+    ER K+KVK++LNLHGI                            +
Sbjct  456  RISSFKIGPFRVSHEERTKIKVKLQLNLHGIF--------------------------SI  489

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDK---PVQMETDakaeapkkkvkkT  352
            E+  +      ++ VN + D + S+  E    ES DK   P   E        ++     
Sbjct  490  ESASLVDDQVDDSTVNNRID-IHSENFEPSNHESSDKANGPFGHEMRRLKAIRRQ-----  543

Query  353  NVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQ  532
            ++ + E V+G ++  ++ +A EKE ++A QD  ME TK+KKN +EAYVY+ RNKL + Y+
Sbjct  544  DIFIDETVHGGMTQGELSQAQEKELQLAQQDINMERTKEKKNTLEAYVYETRNKLLNSYR  603

Query  533  EFVVDSEKEQLIAKLQE  583
             F  DSEKE + + LQ+
Sbjct  604  SFATDSEKEGICSNLQQ  620



>ref|XP_007142281.1| hypothetical protein PHAVU_008G267400g [Phaseolus vulgaris]
 gb|ESW14275.1| hypothetical protein PHAVU_008G267400g [Phaseolus vulgaris]
Length=548

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 105/194 (54%), Gaps = 23/194 (12%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KI  +TIGPF      +A+++V+V+LN HGI+ +ES  L+E+   +           +  
Sbjct  239  KICCFTIGPFHGSHASKARIEVQVQLNFHGIIGIESVVLVEDHVDDSR---------SNS  289

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            ET +I P   SET  N   D +      +H    G +                 ++ +VP
Sbjct  290  ETINIEP--VSETIENASKDSINEKCEASHHSADGTR------------KDNANRRLHVP  335

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            VSE +YGA++ A++ +A EKE ++A QD+ +E+ KD+KN +E+Y+Y+ R+KL+  Y  F 
Sbjct  336  VSENIYGAMTKAEISEAQEKELKLADQDKTIEQIKDRKNLLESYIYETRSKLFSTYLSFS  395

Query  542  VDSEKEQLIAKLQE  583
             + E++ +   L+E
Sbjct  396  SEHERKDISRSLKE  409



>ref|XP_006348107.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Solanum 
tuberosum]
Length=753

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 99/194 (51%), Gaps = 43/194 (22%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS  TIGPFQ    E+AK+KVK++LNLHG+V+VE                      +  
Sbjct  456  KISKSTIGPFQVPHSEKAKVKVKIQLNLHGVVTVE----------------------SAW  493

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
               D     +SE +++   + +  D +         K V+ +               ++P
Sbjct  494  LIKDQSSHSTSENNIDTHAENMEGDDTRK------SKAVKRQ---------------DIP  532

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            VSE V G ++  ++ +A EKE ++A QD  +E TKDKKN +EAYVY+ RNKL + Y+ F 
Sbjct  533  VSESVDGGMTLMELSQAQEKECQLAEQDIKVERTKDKKNTLEAYVYETRNKLLNTYRSFA  592

Query  542  VDSEKEQLIAKLQE  583
             DSE+E +   LQ+
Sbjct  593  TDSEREGISCNLQQ  606



>ref|XP_008385666.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=266

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +2

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            +PVSE +YG ++ A++ +A +KE ++A  DRIME+TKDKKNA+E+YVY+MRNKL++ Y+ 
Sbjct  50   IPVSESMYGGMTKAELSEAQDKELQLAQHDRIMEQTKDKKNALESYVYEMRNKLFNTYRS  109

Query  536  FVVDSEKEQLIAKLQE  583
            F  D E+E +   LQ+
Sbjct  110  FASDQEREGISRSLQQ  125



>ref|XP_002969191.1| hypothetical protein SELMODRAFT_440676 [Selaginella moellendorffii]
 gb|EFJ30307.1| hypothetical protein SELMODRAFT_440676 [Selaginella moellendorffii]
Length=743

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +2

Query  350  TNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKY  529
            T+VP+ E+    LS  ++Q A+EKEFEM  QDR+ EETK+ KNA+EA VYDMRNK Y K 
Sbjct  537  TDVPIVEMTTKELSSLELQNAIEKEFEMEFQDRVSEETKEAKNALEALVYDMRNKFYGKL  596

Query  530  QEFVVDSEKEQLIAKLQE  583
            QE+  ++EK+ L+ KLQ+
Sbjct  597  QEYASETEKKDLLKKLQD  614



>ref|XP_007142282.1| hypothetical protein PHAVU_008G267400g [Phaseolus vulgaris]
 gb|ESW14276.1| hypothetical protein PHAVU_008G267400g [Phaseolus vulgaris]
Length=765

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 105/194 (54%), Gaps = 23/194 (12%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KI  +TIGPF      +A+++V+V+LN HGI+ +ES  L+E+   +           +  
Sbjct  456  KICCFTIGPFHGSHASKARIEVQVQLNFHGIIGIESVVLVEDHVDDSR---------SNS  506

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            ET +I P   SET  N   D +      +H    G +                 ++ +VP
Sbjct  507  ETINIEP--VSETIENASKDSINEKCEASHHSADGTR------------KDNANRRLHVP  552

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            VSE +YGA++ A++ +A EKE ++A QD+ +E+ KD+KN +E+Y+Y+ R+KL+  Y  F 
Sbjct  553  VSENIYGAMTKAEISEAQEKELKLADQDKTIEQIKDRKNLLESYIYETRSKLFSTYLSFS  612

Query  542  VDSEKEQLIAKLQE  583
             + E++ +   L+E
Sbjct  613  SEHERKDISRSLKE  626



>gb|KCW67009.1| hypothetical protein EUGRSUZ_F00767 [Eucalyptus grandis]
Length=718

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 110/196 (56%), Gaps = 21/196 (11%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS + +GP +   GE++K+KV+V+LNLHGI++++SAT++EE         +      KM
Sbjct  400  KISCFMVGPVKGLHGEKSKVKVRVQLNLHGIITIDSATMIEEGVEGTVSNDDTQAHGDKM  459

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakae--apkkkvkkTN  355
            +T+                    S A +N V E G       + A        K  KK +
Sbjct  460  DTES------------------ASFAGDNGV-EDGTHSHSQSSHASDHHIRKHKVTKKHD  500

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            +PV   +YG ++  +V +A EKE+++A QD+I E+TK+KKNA+E+YVY+ RNKL + Y+ 
Sbjct  501  IPVHLKIYGGMTEVEVLEAQEKEYQLAQQDKIAEQTKEKKNALESYVYETRNKLLNTYRS  560

Query  536  FVVDSEKEQLIAKLQE  583
            F  D E+E +   LQ+
Sbjct  561  FASDREREGISRSLQQ  576



>gb|KCW67010.1| hypothetical protein EUGRSUZ_F00767 [Eucalyptus grandis]
Length=711

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 108/198 (55%), Gaps = 25/198 (13%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS + +GP +   GE++K+KV+V+LNLHGI++++S                    +T +
Sbjct  456  KISCFMVGPVKGLHGEKSKVKVRVQLNLHGIITIDS--------------------ATMI  495

Query  182  E--TDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkT-  352
            E   +     D ++   +  D +  S A +N V E G       + A     +K      
Sbjct  496  EEGVEGTVSNDDTQAHGDKMDTESASFAGDNGV-EDGTHSHSQSSHASDHHIRKHKVTKK  554

Query  353  -NVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKY  529
             ++PV   +YG ++  +V +A EKE+++A QD+I E+TK+KKNA+E+YVY+ RNKL + Y
Sbjct  555  HDIPVHLKIYGGMTEVEVLEAQEKEYQLAQQDKIAEQTKEKKNALESYVYETRNKLLNTY  614

Query  530  QEFVVDSEKEQLIAKLQE  583
            + F  D E+E +   LQ+
Sbjct  615  RSFASDREREGISRSLQQ  632



>ref|XP_010060358.1| PREDICTED: heat shock 70 kDa protein 16 [Eucalyptus grandis]
Length=774

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 110/196 (56%), Gaps = 21/196 (11%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS + +GP +   GE++K+KV+V+LNLHGI++++SAT++EE         +      KM
Sbjct  456  KISCFMVGPVKGLHGEKSKVKVRVQLNLHGIITIDSATMIEEGVEGTVSNDDTQAHGDKM  515

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakae--apkkkvkkTN  355
            +T+                    S A +N V E G       + A        K  KK +
Sbjct  516  DTES------------------ASFAGDNGV-EDGTHSHSQSSHASDHHIRKHKVTKKHD  556

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            +PV   +YG ++  +V +A EKE+++A QD+I E+TK+KKNA+E+YVY+ RNKL + Y+ 
Sbjct  557  IPVHLKIYGGMTEVEVLEAQEKEYQLAQQDKIAEQTKEKKNALESYVYETRNKLLNTYRS  616

Query  536  FVVDSEKEQLIAKLQE  583
            F  D E+E +   LQ+
Sbjct  617  FASDREREGISRSLQQ  632



>ref|XP_006417329.1| hypothetical protein EUTSA_v10006883mg [Eutrema salsugineum]
 gb|ESQ35682.1| hypothetical protein EUTSA_v10006883mg [Eutrema salsugineum]
Length=763

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 103/196 (53%), Gaps = 36/196 (18%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +IS++TIGPFQ   GE A++KV+V+LNLHGIV+++                     S  +
Sbjct  457  QISSFTIGPFQISHGEAARVKVRVQLNLHGIVTID---------------------SASL  495

Query  182  ETDDIPPQDSSET--DVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTN  355
              D      S ET  + N Q       AS+  +  +G+ P  ++             +  
Sbjct  496  IEDHKENMTSEETISENNHQSSATKDGASDPSLGSTGNDPKAIK-------------RME  542

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            +PV + V GAL+  ++ +A ++E  +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+ 
Sbjct  543  IPVVQSVSGALTKNELSEAKQRENSLVEQDLKMESTKDKKNALESFVYEMRDKMLNTYRS  602

Query  536  FVVDSEKEQLIAKLQE  583
               +SE+E +   LQE
Sbjct  603  TATESERECIARNLQE  618



>ref|XP_004500055.1| PREDICTED: heat shock 70 kDa protein 16-like [Cicer arietinum]
Length=770

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 107/194 (55%), Gaps = 20/194 (10%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS +TIGP     G + ++KV++ LNLHGI S+ESATL+++               ++ 
Sbjct  456  KISCFTIGPLLGSHGSKTRVKVRLHLNLHGIFSIESATLIKDHAD-----------DSEF  504

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            +  DI P   +  + N   +    D++  H     D P    + A      K  ++  + 
Sbjct  505  DAMDIDPVSETSDNTNFVANGA-EDSTNKH-----DSP---RSSADNSRKDKANRRIPIQ  555

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            V+E +YG +  A++ +A +KE ++A QDR +E TK+KKN +E+YVYD R+KL++ Y+ F 
Sbjct  556  VNENIYGGMKTAEISEAHKKELQLAQQDRTVELTKEKKNTLESYVYDTRSKLFNTYRSFA  615

Query  542  VDSEKEQLIAKLQE  583
             D E++ +   LQE
Sbjct  616  SDQERDGISRSLQE  629



>ref|XP_003600064.1| Heat shock 70 kDa protein 4L [Medicago truncatula]
 gb|AES70315.1| heat shock 70 kDa protein [Medicago truncatula]
Length=774

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 109/195 (56%), Gaps = 20/195 (10%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS++TIGP    +G +AK+KV+ +LNLHGI S++SATL                   K 
Sbjct  450  KISSFTIGPLPGSQGSKAKVKVRAQLNLHGIFSIDSATL------------------IKD  491

Query  182  ETDDIPPQ-DSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNV  358
             TDD     D+ + D   +    TS  + N   ES +K    ++ A      K  ++  +
Sbjct  492  HTDDHHSNFDAMDVDPKSETSDSTSSVA-NGAEESTNKRDSPQSYADCLRKDKANRRIPI  550

Query  359  PVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEF  538
             V+E +YG ++  ++ +A EKE ++A QDR +E TK+KKN +E+YVY+ R+KL++ Y+ F
Sbjct  551  AVNENIYGGMTMKEISEAHEKELQLAQQDRAVELTKEKKNTLESYVYETRSKLFNTYRSF  610

Query  539  VVDSEKEQLIAKLQE  583
              D E++ +   LQE
Sbjct  611  ASDQERDVISRSLQE  625



>ref|XP_010533816.1| PREDICTED: heat shock 70 kDa protein 16 [Tarenaya hassleriana]
Length=763

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 107/194 (55%), Gaps = 29/194 (15%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +IS++TIGPFQ    E A++KV+++LNLHGIV+++                     S  +
Sbjct  456  QISSFTIGPFQIAHREAARVKVRIQLNLHGIVTID---------------------SASL  494

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
              D    Q+S+ +D  M ++  TS A+++   +    P   ++        K  K+  +P
Sbjct  495  VEDH---QNSTSSDEIMSENNRTSSATKDDNSDPSAGPTGNDS-----TKHKTSKRMEIP  546

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            V E   GAL+  ++ +A ++E  +  QD  ME TKD+KNA+E+YVY+MR+K+ + Y+ F 
Sbjct  547  VVERASGALTKDELLEAKQRENSLVQQDLKMELTKDRKNALESYVYEMRDKMLNTYRSFA  606

Query  542  VDSEKEQLIAKLQE  583
             ++E+E +   LQE
Sbjct  607  TEAEREGIARNLQE  620



>gb|AFW68969.1| hypothetical protein ZEAMMB73_497308 [Zea mays]
Length=873

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 64/188 (34%), Positives = 102/188 (54%), Gaps = 43/188 (23%)
 Frame = +2

Query  20   IGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP  199
            IGPFQ+   E +K+KVK+RLNLHG+VSVESA L+++ +           +++    DD+ 
Sbjct  531  IGPFQA-HMEASKVKVKIRLNLHGLVSVESAALIDDYQRNATSADHMEVDTSG---DDMG  586

Query  200  PQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVY  379
             +  SE  +  Q+                                       +P++E + 
Sbjct  587  HKSRSERSIQRQE---------------------------------------LPITEYIC  607

Query  380  GALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKE  559
             A+S  ++ +A E+E ++A QD++ME TKD+KNA+E+YVYD RNKL ++Y+ F  DSE+E
Sbjct  608  CAMSKQELLEAQEQEHQLAYQDKLMERTKDRKNALESYVYDTRNKLSERYRSFATDSERE  667

Query  560  QLIAKLQE  583
            Q+   LQ+
Sbjct  668  QISFNLQQ  675



>gb|AII99893.1| heat shock protein [Cicer arietinum]
Length=771

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 107/194 (55%), Gaps = 20/194 (10%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS +TIGP     G + ++KV++ LNLHGI S+ESATL+++               ++ 
Sbjct  456  KISCFTIGPLLGSHGSKTRVKVRLHLNLHGIFSIESATLIKDHAD-----------DSEF  504

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            +  DI P   +  + N   +    D++  H     D P    + A      K  ++  + 
Sbjct  505  DAMDIDPVSETSDNTNFVANGA-EDSTNKH-----DSP---RSSADNSRKDKANRRIPIQ  555

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            V+E +YG +  A++ +A +KE ++A QDR +E TK+KKN +E+YVYD R+KL++ Y+ F 
Sbjct  556  VNENIYGGMKTAEISEAHKKELQLAQQDRTVELTKEKKNTLESYVYDTRSKLFNTYRSFA  615

Query  542  VDSEKEQLIAKLQE  583
             D E++ +   LQE
Sbjct  616  SDQERDGISRSLQE  629



>ref|XP_003617525.1| 97 kDa heat shock protein [Medicago truncatula]
Length=789

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 111/206 (54%), Gaps = 26/206 (13%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlke----  169
            KIS +TIGPFQ     +A ++V++ LNLHGIVS+ES+T+ ++    +  V   L E    
Sbjct  456  KISCFTIGPFQRSGESKAVVEVRIDLNLHGIVSIESSTVSKKPNFNLFNVTSSLIEDRVE  515

Query  170  --------STKMETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakae  325
                     +  E  D+ P   SET+ N  +  +       H    G +           
Sbjct  516  DSVTPREYQSNSEAGDVEP--ISETEQNDNEHSINEKCGSPHRSSDGTR-----------  562

Query  326  apkkkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDM  505
               K   + ++PVSE VYG ++ A+V +A EKE ++  QD  ME TKDK+N++E+YVYD+
Sbjct  563  -KDKANIRVHIPVSENVYGGMTKAEVTEAQEKERQLMQQDITMELTKDKRNSLESYVYDV  621

Query  506  RNKLYDKYQEFVVDSEKEQLIAKLQE  583
            RNKL ++Y++F  + EK+ +   L E
Sbjct  622  RNKLLNEYRKFASEQEKDGISRSLLE  647



>dbj|BAK01312.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=730

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 106/203 (52%), Gaps = 62/203 (31%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +I ++ IGPFQ+   E++K+KVK+RLNLHG++                            
Sbjct  449  QIGSFEIGPFQA-HSEKSKVKVKIRLNLHGLI----------------------------  479

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGD---------KPVQMETDakaeapk  334
                     S E+ V + DD+   +++++  L+S D         +P+  +         
Sbjct  480  ---------SVESAVLIDDDQRDVNSADSMELDSNDDMDHKSKNERPMHRQ---------  521

Query  335  kkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNK  514
                  ++ + E +YG +S  ++ +A E+E ++A QD+++E TK++KNA+E+YVYD RNK
Sbjct  522  ------DLQIVESIYGVMSKQELLEAQEQEQQLAYQDKLVERTKERKNALESYVYDTRNK  575

Query  515  LYDKYQEFVVDSEKEQLIAKLQE  583
            L ++Y+ F  DSE+E++   LQ+
Sbjct  576  LSERYRSFATDSEREEISVNLQQ  598



>gb|EYU24689.1| hypothetical protein MIMGU_mgv1a001324mg [Erythranthe guttata]
Length=573

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 79/104 (76%), Gaps = 5/104 (5%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSVESATLLEEEE EVPVVK   +ESTKM
Sbjct  461  KISTYTIGPFQSAKGERAKLKVKVRLNLHGIVSVESATLLEEEETEVPVVKGSSQESTKM  520

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETD  313
            ETD++    +  +    +D       +EN V ESGDK VQMETD
Sbjct  521  ETDELAADSAPPSTTETED-----AGAENGVEESGDKSVQMETD  559



>ref|XP_004232717.1| PREDICTED: heat shock 70 kDa protein 16 [Solanum lycopersicum]
Length=753

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 97/194 (50%), Gaps = 43/194 (22%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS YT+GPFQ    E+AK+KVK++LNLHG+V+VESA L++++             +  M
Sbjct  456  KISKYTLGPFQVPHSEKAKVKVKIQLNLHGVVTVESAWLIKDQSSHSTSENNIDTYAENM  515

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            E DD     +    V  QD                                       +P
Sbjct  516  EGDDTRKSKA----VKRQD---------------------------------------IP  532

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            VS  V G ++  ++ +A EKE ++  QD  +E TKDKKN +EAYVY+ RNKL + Y+ F 
Sbjct  533  VSGSVDGGMTLMELSQAKEKERQLTEQDIKVERTKDKKNTLEAYVYETRNKLLNTYRSFA  592

Query  542  VDSEKEQLIAKLQE  583
             DSE+E +   LQ+
Sbjct  593  TDSEREGISCNLQQ  606



>ref|XP_002305580.2| hypothetical protein POPTR_0004s01640g [Populus trichocarpa]
 gb|EEE86091.2| hypothetical protein POPTR_0004s01640g [Populus trichocarpa]
Length=757

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 106/196 (54%), Gaps = 39/196 (20%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +IS++ IGPF   + E  K+KV+V+LNLHGIV++E+                       M
Sbjct  456  QISSFMIGPFPVYQLEMVKVKVRVQLNLHGIVNIEAF----------------------M  493

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkk---vkkT  352
            + +D                +VT+  SEN V +S   P   +  A+     +K    K+ 
Sbjct  494  QIED--------------GAEVTNVTSENMVAKSDHSPSVEQNGAEVTNVAQKGKIFKRL  539

Query  353  NVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQ  532
             +PVSE VYG ++ A++ +A + E ++A QD  ME  KDKKNA+E+YVY+MR+K++ KYQ
Sbjct  540  EIPVSEEVYGGMTKAELSEAEKIELQLAQQDLKMERIKDKKNALESYVYEMRDKIFSKYQ  599

Query  533  EFVVDSEKEQLIAKLQ  580
             F  +SE+ ++   L+
Sbjct  600  SFATESERNEISINLE  615



>emb|CDY49794.1| BnaCnng18070D [Brassica napus]
Length=761

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/194 (31%), Positives = 108/194 (56%), Gaps = 32/194 (16%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +I ++TIGPFQS  G+ A++KV+V+LNLHGIV+++                     S  +
Sbjct  458  QIGSFTIGPFQSSHGQAARVKVRVQLNLHGIVTID---------------------SASL  496

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
              D   P++++ ++  + ++   S A+++   +    P   +         K +K+  + 
Sbjct  497  IED---PKENTTSEETVSENNHQSPATKDGTSDPSSGPTGND--------HKAIKRMKIS  545

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            V E V GAL+  ++ +A ++E+ +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+   
Sbjct  546  VVENVSGALTKDELLEAKQREYSLVQQDLKMESTKDKKNALESFVYEMRDKMLNTYRSTA  605

Query  542  VDSEKEQLIAKLQE  583
             +SE+E +   LQE
Sbjct  606  TESERECIARNLQE  619



>ref|XP_006858198.1| hypothetical protein AMTR_s00062p00172210 [Amborella trichopoda]
 gb|ERN19665.1| hypothetical protein AMTR_s00062p00172210 [Amborella trichopoda]
Length=226

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +2

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            +PV+E V G +S A++ +  E E ++A QDR+ME TKD+KNA+EAYVY++RNKL+DKY+ 
Sbjct  25   IPVNETVSGCMSKAELAQVHEIELQLAHQDRVMELTKDRKNALEAYVYEIRNKLFDKYRS  84

Query  536  FVVDSEKEQLIAKLQE  583
            +  +SE+E +   LQ+
Sbjct  85   YASESEREGISRSLQQ  100



>ref|XP_011096072.1| PREDICTED: heat shock 70 kDa protein 16 [Sesamum indicum]
 ref|XP_011096074.1| PREDICTED: heat shock 70 kDa protein 16 [Sesamum indicum]
 ref|XP_011096075.1| PREDICTED: heat shock 70 kDa protein 16 [Sesamum indicum]
Length=756

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 105/194 (54%), Gaps = 29/194 (15%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +IS+  IGPF+    E++++K+KV+L+LHGIVS+ SA+L                     
Sbjct  456  RISSSKIGPFRVSHVEKSRIKIKVQLDLHGIVSIVSASL---------------------  494

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
              DD   Q    T  N  D    +    NH  ES  KP    T        K +++ ++ 
Sbjct  495  -VDD---QVDDATVKNNGDTLSENVGPGNH--ESFIKP--NGTSGHEIRRLKAIRRQDIF  546

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            ++E VYG ++  ++ +A EKE ++A QD  +E TK+KKNA+EAYVY+ RNKL   Y+ F 
Sbjct  547  IAEDVYGGMTQGELSQAQEKELQLAEQDLKVERTKEKKNALEAYVYESRNKLLSTYRSFA  606

Query  542  VDSEKEQLIAKLQE  583
             DSEKE + + LQ+
Sbjct  607  TDSEKEGISSNLQQ  620



>emb|CEF99759.1| Heat shock protein 70 family [Ostreococcus tauri]
Length=801

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 109/193 (56%), Gaps = 25/193 (13%)
 Frame = +2

Query  2    KISTYTIGPF-QSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTK  178
            K+  + IGP  +  KGE+ KLKVKVRLN++ +                        ES +
Sbjct  456  KVGAFQIGPLPKIAKGEKHKLKVKVRLNMNSL---------------------VSVESAQ  494

Query  179  METDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNV  358
            +  +     ++S T+  M+D    +D ++   +E+  K      + +  APKKKVKKT+V
Sbjct  495  VVEEIEEEVEASATEEEMKDAPAPADGADG--METDAKEESKSEEKEKPAPKKKVKKTDV  552

Query  359  PVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEF  538
            PV+  V G L    ++K  ++EF+MALQD+I+EETK++KNAVE YVY MRNKL ++  E+
Sbjct  553  PVTSEV-GGLPQKVLEKFTQEEFDMALQDKIIEETKERKNAVEEYVYSMRNKLSEQLAEY  611

Query  539  VVDSEKEQLIAKL  577
            V D+ +E   A L
Sbjct  612  VDDATRESFSALL  624



>gb|EAZ02096.1| hypothetical protein OsI_24183 [Oryza sativa Indica Group]
Length=240

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +2

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            +P+ + +YGA+S  ++ +A E+E ++A QD++ME TK++KNA+E+YVYD RNKL ++Y+ 
Sbjct  22   LPIVQSIYGAMSNQELLEAQEQESQLAYQDKLMERTKERKNALESYVYDTRNKLSERYRS  81

Query  536  FVVDSEKEQLIAKLQE  583
            F  DSE+E++   LQ+
Sbjct  82   FATDSEREEISLSLQQ  97



>ref|XP_006468028.1| PREDICTED: heat shock 70 kDa protein 16-like [Citrus sinensis]
 gb|KDO75456.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
 gb|KDO75457.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
Length=768

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 110/194 (57%), Gaps = 30/194 (15%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +IS++ IGPFQ+   E A++KV+V L+L G+V V+SA+L+EE                  
Sbjct  457  QISSFMIGPFQTSHAETARVKVRVHLDLDGVVRVQSASLIEEF-----------------  499

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
              DD   ++S +  + +++D     A  +H   +         D +     K +K+  +P
Sbjct  500  -VDDSVRRESRDAHLTLEED-----AKSDHTPATA-------IDPEINRKGKVLKRLEIP  546

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            V+E V G ++  ++ +AVEKE ++  QD  ME TKD+KNA+E+YVY+MR+K+ + Y+ F 
Sbjct  547  VNENVNGGMTKTELSEAVEKEHQLVQQDLKMERTKDRKNALESYVYEMRDKISNIYRSFA  606

Query  542  VDSEKEQLIAKLQE  583
             +SE+E +   L++
Sbjct  607  TESEREGISRNLRD  620



>gb|KDO75458.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
 gb|KDO75459.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
Length=692

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 110/194 (57%), Gaps = 30/194 (15%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +IS++ IGPFQ+   E A++KV+V L+L G+V V+SA+L+EE                  
Sbjct  457  QISSFMIGPFQTSHAETARVKVRVHLDLDGVVRVQSASLIEEF-----------------  499

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
              DD   ++S +  + +++D     A  +H   +         D +     K +K+  +P
Sbjct  500  -VDDSVRRESRDAHLTLEED-----AKSDHTPATA-------IDPEINRKGKVLKRLEIP  546

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            V+E V G ++  ++ +AVEKE ++  QD  ME TKD+KNA+E+YVY+MR+K+ + Y+ F 
Sbjct  547  VNENVNGGMTKTELSEAVEKEHQLVQQDLKMERTKDRKNALESYVYEMRDKISNIYRSFA  606

Query  542  VDSEKEQLIAKLQE  583
             +SE+E +   L++
Sbjct  607  TESEREGISRNLRD  620



>gb|EPS74057.1| hypothetical protein M569_00693, partial [Genlisea aurea]
Length=738

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 107/194 (55%), Gaps = 27/194 (14%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +IS++ IGPF+    E+A +K+KV+LNL+GIV+V + +L+++   +          S K 
Sbjct  459  RISSFKIGPFRVSSDEKANIKIKVQLNLNGIVAVNAVSLVDDHLDD----------SLKS  508

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
             T +  P++ S++               NH  +S  K              K V++ +V 
Sbjct  509  STTETLPENLSQS---------------NH--DSFGKACVPSLMGHGMRRLKAVRRQDVF  551

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            ++E  Y  ++  ++ +A  KE ++A QD+ ME TK+KKNA+EAYVY+ RNKL D Y+ F 
Sbjct  552  INETTYCGMTKEELSQARSKEHDLAQQDKNMERTKEKKNALEAYVYETRNKLMDTYRGFA  611

Query  542  VDSEKEQLIAKLQE  583
              SEKE +  KLQ+
Sbjct  612  SASEKEGISDKLQQ  625



>ref|XP_010665569.1| PREDICTED: heat shock 70 kDa protein 16 [Beta vulgaris subsp. 
vulgaris]
Length=767

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 95/194 (49%), Gaps = 20/194 (10%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KIS ++IGPF +   E A +K K  L +HG                       L  ++ +
Sbjct  457  KISNFSIGPFPATHTENAYVKAKALLTVHG--------------------TVTLVSASLV  496

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
               D  P   S  D++ +  +  SD +EN   +    P             K + +++V 
Sbjct  497  GGYDDDPVIRSNRDMSAEKMEDESDYAENGAEDRYSAPKPGPASYSHNRKGKAMTRSSVM  556

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            + E VYG LS  ++ KA EKE E++ QD  +E+ K+KKN +E+YVY+ RNK+   Y++F 
Sbjct  557  IDETVYGRLSGTELSKAREKEAELSEQDYKVEQAKEKKNTLESYVYETRNKILSTYKDFT  616

Query  542  VDSEKEQLIAKLQE  583
             DSEKE +   LQ+
Sbjct  617  ADSEKEGICENLQQ  630



>ref|XP_010476099.1| PREDICTED: heat shock 70 kDa protein 16 [Camelina sativa]
Length=764

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 109/193 (56%), Gaps = 32/193 (17%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            IS++ IGPF    GE A++KV+V+LNLHGIV+++SA+L+E  +               + 
Sbjct  458  ISSFKIGPFHISHGEAARVKVRVQLNLHGIVTIDSASLIEHHKE-------------NIT  504

Query  185  TDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  364
            ++D+  +++ ++     D   T DAS      +G++P  ++             +  +PV
Sbjct  505  SEDVISENNHQSAATKDD---TLDASSG---PTGNEPKAIK-------------RMEIPV  545

Query  365  SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  544
               + GAL+  ++ +A ++E  +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+    
Sbjct  546  VANLSGALTKDELSEAKQRENSLVEQDLKMESTKDKKNALESFVYEMRDKMLNTYRNTAT  605

Query  545  DSEKEQLIAKLQE  583
            +SE+E +   LQE
Sbjct  606  ESERECIARNLQE  618



>ref|XP_006449031.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
 gb|ESR62271.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
Length=752

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 109/194 (56%), Gaps = 30/194 (15%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +IS++ IGPFQ+   E A++KV+V L+L G+V V+SA+L+EE                  
Sbjct  441  QISSFMIGPFQTSHAETARVKVRVHLDLDGVVRVQSASLIEEF-----------------  483

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
              DD   ++S +  + +++D     A  +H   +         D +     K +K+  +P
Sbjct  484  -VDDSVRRESRDAHLTLEED-----AKSDHTPATA-------IDPEINRKGKVLKRLEIP  530

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            V+E V G  +  ++ +AVEKE ++  QD  ME TKD+KNA+E+YVY+MR+K+ + Y+ F 
Sbjct  531  VNENVNGGTTKTELSEAVEKEHQLVQQDLKMERTKDRKNALESYVYEMRDKISNIYRSFA  590

Query  542  VDSEKEQLIAKLQE  583
             +SE+E +   L++
Sbjct  591  TESEREGISRNLRD  604



>ref|XP_008644888.1| PREDICTED: heat shock 70 kDa protein 16 isoform X1 [Zea mays]
Length=750

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +2

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            +P++E +  A+S  ++ +A E+E ++A QD++ME TKD+KNA+E+YVYD RNKL ++Y+ 
Sbjct  532  LPITEYICCAMSKQELLEAQEQEHQLAYQDKLMERTKDRKNALESYVYDTRNKLSERYRS  591

Query  536  FVVDSEKEQLIAKLQE  583
            F  DSE+EQ+   LQ+
Sbjct  592  FATDSEREQISFNLQQ  607



>ref|XP_006449032.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
 gb|ESR62272.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
Length=646

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 109/194 (56%), Gaps = 30/194 (15%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +IS++ IGPFQ+   E A++KV+V L+L G+V V+SA+L+EE                  
Sbjct  441  QISSFMIGPFQTSHAETARVKVRVHLDLDGVVRVQSASLIEEF-----------------  483

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
              DD   ++S +  + +++D     A  +H   +         D +     K +K+  +P
Sbjct  484  -VDDSVRRESRDAHLTLEED-----AKSDHTPATA-------IDPEINRKGKVLKRLEIP  530

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            V+E V G  +  ++ +AVEKE ++  QD  ME TKD+KNA+E+YVY+MR+K+ + Y+ F 
Sbjct  531  VNENVNGGTTKTELSEAVEKEHQLVQQDLKMERTKDRKNALESYVYEMRDKISNIYRSFA  590

Query  542  VDSEKEQLIAKLQE  583
             +SE+E +   L++
Sbjct  591  TESEREGISRNLRD  604



>ref|XP_010458573.1| PREDICTED: heat shock 70 kDa protein 16-like [Camelina sativa]
Length=765

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 109/193 (56%), Gaps = 31/193 (16%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            IS++ IGPF    GE A++KV+V+LNLHG+V+++SA+L+E  +               + 
Sbjct  458  ISSFKIGPFHISHGEAARVKVRVQLNLHGVVTIDSASLIEHHKE-------------NIT  504

Query  185  TDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  364
            ++D+  +++ ++     D   T DAS      +G++P  ++             +  +PV
Sbjct  505  SEDVISENNHQSAATKDD---TLDASSGPT--TGNEPKAIK-------------RMEIPV  546

Query  365  SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  544
               + GAL+  ++ +A ++E  +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+    
Sbjct  547  VANLSGALTKDELSEAKQRENSLVEQDLKMESTKDKKNALESFVYEMRDKMLNTYRNTAT  606

Query  545  DSEKEQLIAKLQE  583
            +SE+E +   LQE
Sbjct  607  ESERECIARNLQE  619



>ref|XP_002889885.1| hypothetical protein ARALYDRAFT_888478 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66144.1| hypothetical protein ARALYDRAFT_888478 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 102/197 (52%), Gaps = 28/197 (14%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +IS++ IGPF    GE A++KV+V+LNLHGIV+++                     S  +
Sbjct  457  QISSFMIGPFHISHGEAARVKVRVQLNLHGIVTID---------------------SATV  495

Query  182  ETDDIPPQDSSETDVNMQDDKVTSD---ASENHVLESGDKPVQMETDakaeapkkkvkkT  352
            E+        SE  +    + +TS+   + ENH   +        +        K +K+ 
Sbjct  496  ESK----LSLSEQLIEYHKENITSEEMISEENHQSSAMKDGTLDPSSGSTGNEPKAIKRM  551

Query  353  NVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQ  532
             +PV   V GAL+  ++ +A ++E  +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+
Sbjct  552  EIPVVANVSGALTKDELSEAKQREKSLVEQDLKMESTKDKKNALESFVYEMRDKMLNTYR  611

Query  533  EFVVDSEKEQLIAKLQE  583
                +SE+E +   LQE
Sbjct  612  NTATESERECIARNLQE  628



>ref|XP_010493114.1| PREDICTED: heat shock 70 kDa protein 16-like [Camelina sativa]
 ref|XP_010493121.1| PREDICTED: heat shock 70 kDa protein 16-like [Camelina sativa]
Length=764

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 108/193 (56%), Gaps = 32/193 (17%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            I ++ IGPF    GE A++KV+V+LNLHGIV+++SA+L+E  +               + 
Sbjct  458  ICSFKIGPFHISYGEAARVKVRVQLNLHGIVTIDSASLIEHHKE-------------NIT  504

Query  185  TDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  364
            ++D+  +++ ++     D   T DAS      +G++P  ++             +  +PV
Sbjct  505  SEDVISENNHQSAATKDD---TLDASSG---PTGNEPKAIK-------------RMEIPV  545

Query  365  SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  544
               + GAL+  ++ +A ++E  +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+    
Sbjct  546  IANLSGALTKDELSEAKQRENSLVEQDLKMESTKDKKNALESFVYEMRDKMLNTYRNTAT  605

Query  545  DSEKEQLIAKLQE  583
            +SE+E +   LQE
Sbjct  606  ESERECIARNLQE  618



>gb|AFW81561.1| hypothetical protein ZEAMMB73_352123 [Zea mays]
Length=564

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 70/107 (65%), Gaps = 3/107 (3%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsv-esatlleeeevevpvvkeqlkeSTK  178
            KISTYTIGPFQ  KGERAKLKVKVRLN+HGIV+V  +  L E+  V V    E  K++TK
Sbjct  455  KISTYTIGPFQPSKGERAKLKVKVRLNIHGIVTVDSAMMLEEDVAVPVSSANEAPKDTTK  514

Query  179  METDDIPPQDSSETDVNMQDDKVT--SDASENHVLESGDKPVQMETD  313
            M+TDD P    S TDVN+ +   T  + A+EN      +K V METD
Sbjct  515  MDTDDAPSDPVSGTDVNVHEPDTTEAAPAAENGTQNPEEKSVPMETD  561



>ref|XP_006306833.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
 gb|EOA39731.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
Length=737

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 108/193 (56%), Gaps = 32/193 (17%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            IS++ IGPF    GE A++KV+V+LNLHGIV+++SA+L+E  +               + 
Sbjct  458  ISSFMIGPFHISHGEAARVKVRVQLNLHGIVTIDSASLIEYHKE-------------NLT  504

Query  185  TDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  364
            ++++  +++ ++     D   T D S      +G++P  ++             +  VPV
Sbjct  505  SEEMISENNHQSSATKDD---TLDPSSG---PTGNEPKAIK-------------RMEVPV  545

Query  365  SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  544
               V GAL+  ++ +A ++E  +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+    
Sbjct  546  VANVSGALTKDELLEAKQRENSLVEQDLKMESTKDKKNALESFVYEMRDKMLNTYRNTAT  605

Query  545  DSEKEQLIAKLQE  583
            +SE+E +   LQE
Sbjct  606  ESERECIAKNLQE  618



>ref|XP_006306834.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
 gb|EOA39732.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
Length=763

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 108/193 (56%), Gaps = 32/193 (17%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            IS++ IGPF    GE A++KV+V+LNLHGIV+++SA+L+E  +               + 
Sbjct  458  ISSFMIGPFHISHGEAARVKVRVQLNLHGIVTIDSASLIEYHKE-------------NLT  504

Query  185  TDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  364
            ++++  +++ ++     D   T D S      +G++P  ++             +  VPV
Sbjct  505  SEEMISENNHQSSATKDD---TLDPSSG---PTGNEPKAIK-------------RMEVPV  545

Query  365  SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  544
               V GAL+  ++ +A ++E  +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+    
Sbjct  546  VANVSGALTKDELLEAKQRENSLVEQDLKMESTKDKKNALESFVYEMRDKMLNTYRNTAT  605

Query  545  DSEKEQLIAKLQE  583
            +SE+E +   LQE
Sbjct  606  ESERECIAKNLQE  618



>gb|KJB69295.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
 gb|KJB69296.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
 gb|KJB69297.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
 gb|KJB69298.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
Length=774

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 113/194 (58%), Gaps = 16/194 (8%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            +I+T+TIGP Q      AK+KV+V+LNLHGIV ++SA L+E++      + +    S ++
Sbjct  456  QINTFTIGPIQC-HINMAKVKVRVQLNLHGIVKLDSAVLIEDQLDNSVTINDPHLTSEEV  514

Query  182  ETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP  361
            E       D S+   ++++    SD S++   E    P      A      K VK+  +P
Sbjct  515  E-------DKSDRISSVENIAQVSDNSQS---EPPSCP-----GAGVARRGKAVKRLEIP  559

Query  362  VSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFV  541
            +SE V   +   ++ KA EKE  +  QD  ME+TKDKKNA+E+YVY+MR+K+ + Y+ F 
Sbjct  560  ISESVCDGMKRDEIAKAEEKERWLMQQDLKMEQTKDKKNALESYVYEMRDKILNAYRSFA  619

Query  542  VDSEKEQLIAKLQE  583
             +S++E++  KLQE
Sbjct  620  NESDREEISRKLQE  633



>ref|XP_011037663.1| PREDICTED: heat shock 70 kDa protein 16 [Populus euphratica]
Length=769

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +2

Query  356  VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  535
            +PVSE VYG ++ A++ +A + E ++A QD  ME  KDKKNA+E+YVY+MR+K++ KYQ 
Sbjct  553  IPVSEEVYGGMTKAELSEAEKIELQLAHQDLKMERIKDKKNALESYVYEMRDKIFSKYQS  612

Query  536  FVVDSEKEQLIAKLQ  580
            F  +SE++++   LQ
Sbjct  613  FATESERDEISINLQ  627



>ref|XP_002505210.1| heat shock protein 70 [Micromonas sp. RCC299]
 gb|ACO66468.1| heat shock protein 70 [Micromonas sp. RCC299]
Length=811

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 110/195 (56%), Gaps = 20/195 (10%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGE--RAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeST  175
            +I ++ +GP  S   +  + KLKVKVRLNL+G+VSVESA  +EE E EV    E    + 
Sbjct  455  QIGSFDVGPIPSTNSDDGKTKLKVKVRLNLNGLVSVESAQAVEEIEEEVAPAPEVAPAAE  514

Query  176  KMETDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTN  355
                 D P ++   T            A E+    +G+KP++ E  A     KKKVKK +
Sbjct  515  APMDTDAPAENGENT------------APED---PNGEKPMETEAAAPVPEKKKKVKKID  559

Query  356  VPVSELVYGALSPADV-QKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQ  532
            VPVS  V G   PA V ++ V +EFEMALQDR+MEETK++KNAVE YVY MR K+     
Sbjct  560  VPVSSTVGGL--PAQVLEQFVNEEFEMALQDRVMEETKERKNAVEEYVYGMRTKVTGALS  617

Query  533  EFVVDSEKEQLIAKL  577
            +FV     E  +A L
Sbjct  618  DFVAPEAAESFVALL  632



>ref|XP_008354138.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=558

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 73/90 (81%), Gaps = 4/90 (4%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPF S K ERAKLKVK RLNLHGIVSV+SATLLEEEE+EVPV KEQ KE+ KM
Sbjct  461  KISTYTIGPFPSVKSERAKLKVKARLNLHGIVSVDSATLLEEEEIEVPVTKEQTKEAAKM  520

Query  182  ETDDIP----PQDSSETDVNMQDDKVTSDA  259
            ETD+ P    P  + ETDV+MQD K T+DA
Sbjct  521  ETDEAPSDVAPPSTEETDVSMQDAKDTADA  550



>ref|XP_006389708.1| hypothetical protein EUTSA_v100181451mg, partial [Eutrema salsugineum]
 gb|ESQ26994.1| hypothetical protein EUTSA_v100181451mg, partial [Eutrema salsugineum]
Length=569

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 81/101 (80%), Gaps = 5/101 (5%)
 Frame = +2

Query  2    KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  181
            KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPV KEQ +E+ K+
Sbjct  461  KISTYTIGPFQSSKGERAKLKVKVRLNLHGIVSVESATLLEEEEVEVPVSKEQPEETIKI  520

Query  182  ETDDIPPQ---DSSETDVNMQDDKVTSDAS--ENHVLESGD  289
            ++D    +    S ++DVNMQD K +SDA+  +N V +S D
Sbjct  521  DSDKATAEAAPASGDSDVNMQDAKESSDAAGTDNGVPDSAD  561



>gb|AFW75994.1| hypothetical protein ZEAMMB73_975582 [Zea mays]
Length=209

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +2

Query  386  LSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQL  565
            +S  ++ +A E+E ++A QD+++E TKD+KNA+E+YVYD RNKL ++Y+ F  DSE+EQ+
Sbjct  1    MSKHELLEAQEQEQQLAYQDKLVEWTKDRKNALESYVYDTRNKLSERYRSFATDSEREQI  60

Query  566  IAKLQE  583
               LQ+
Sbjct  61   SVNLQQ  66



>ref|XP_002401154.1| heat shock protein, putative [Ixodes scapularis]
 gb|EEC00620.1| heat shock protein, putative [Ixodes scapularis]
Length=799

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 95/188 (51%), Gaps = 25/188 (13%)
 Frame = +2

Query  35   SGKGERAKLKVKVRLNLHGIvsvesatll-----eeeevevpvvkeqlkeSTKMETDDIP  199
            + +GE +K+KVKVRLNLHGI SV SA+ +       +          L  +     ++ P
Sbjct  466  AAEGEASKIKVKVRLNLHGIFSVVSASAVDRKPDGRQASAGCANGGDLAAAGAASNEEAP  525

Query  200  PQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVY  379
            P +  + D            +E   ++  ++P   E         K+ K   +PV   V 
Sbjct  526  PTEGGDPD----------KVAEGEPVKKEERPSPKE---------KQAKAIELPVEARV-  565

Query  380  GALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKE  559
              LS +++ + VE+E +M   DR+ +E  D KNAVE YVY+MR+ L D+YQ FVV SE+E
Sbjct  566  PQLSASELDQLVEREVQMVHTDRMEKERVDAKNAVEEYVYEMRDHLSDRYQPFVVPSERE  625

Query  560  QLIAKLQE  583
              +A L E
Sbjct  626  AFLAALNE  633



>ref|XP_006389709.1| hypothetical protein EUTSA_v100181450mg, partial [Eutrema salsugineum]
 gb|ESQ26995.1| hypothetical protein EUTSA_v100181450mg, partial [Eutrema salsugineum]
Length=216

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  458  ETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  583
            ETKD+KNAVE+YVYDMRNKL DKYQE++ DSE+E  +A LQE
Sbjct  1    ETKDRKNAVESYVYDMRNKLSDKYQEYITDSEREAFLASLQE  42



>ref|XP_008644889.1| PREDICTED: heat shock 70 kDa protein 16 isoform X2 [Zea mays]
Length=727

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 61/193 (32%), Positives = 98/193 (51%), Gaps = 43/193 (22%)
 Frame = +2

Query  5    ISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME  184
            I ++ IGPFQ+   E +K+KVK+RLNLHG+VSVESA L+++ +           +++   
Sbjct  458  IGSFQIGPFQAHM-EASKVKVKIRLNLHGLVSVESAALIDDYQRNATSADHMEVDTSG--  514

Query  185  TDDIPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  364
             DD+  +  SE  +  Q+                                       +P+
Sbjct  515  -DDMGHKSRSERSIQRQE---------------------------------------LPI  534

Query  365  SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  544
            +E +  A+S  ++ +A E+E ++A QD++ME TKD+KNA+E+YVYD RNK  D   E   
Sbjct  535  TEYICCAMSKQELLEAQEQEHQLAYQDKLMERTKDRKNALESYVYDTRNKTEDWLYEEGD  594

Query  545  DSEKEQLIAKLQE  583
            D  +    +KL+E
Sbjct  595  DETEVVYSSKLEE  607



>ref|XP_006595736.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Glycine 
max]
 gb|KHN11927.1| Heat shock 70 kDa protein 16 [Glycine soja]
Length=802

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +2

Query  353  NVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQ  532
            +VPVSE +YG ++ A++ +A EKE ++A QDR +E TKD+KN++E+Y+Y+ R+KL+  Y 
Sbjct  585  HVPVSENIYGGMTKAEILEAQEKELQLADQDRTIELTKDRKNSLESYIYETRSKLFSTYL  644

Query  533  EFVVDSEKEQLIAKLQ  580
             F  + E++ +   L+
Sbjct  645  SFSSEHERKDISRSLK  660



>ref|XP_009843226.1| hypothetical protein H257_16484 [Aphanomyces astaci]
 gb|ETV67238.1| hypothetical protein H257_16484 [Aphanomyces astaci]
Length=795

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  383  ALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQ  562
             L+ ADV +A E+E  MA QDR++EET +K+N +E +VYD RN L DKY EFV  S+++ 
Sbjct  570  GLTAADVNRASEEELTMAQQDRVIEETANKRNELETFVYDNRNHLSDKYSEFVSTSDRDA  629

Query  563  LIAKLQE  583
              AKL +
Sbjct  630  FDAKLND  636



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 723952452455